Compositions and methods for inhibiting gene expressions
09932563 ยท 2018-04-03
Assignee
Inventors
- Loren D. Williams (Atlanta, GA, US)
- Po-Yu Fang (Atlanta, GA, US)
- Chiaolong Hsiao (Atlanta, GA, US)
- Justin Williams (Atlanta, GA, US)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2795/18152
CHEMISTRY; METALLURGY
C12N2795/18151
CHEMISTRY; METALLURGY
C12N2795/18142
CHEMISTRY; METALLURGY
C12N15/88
CHEMISTRY; METALLURGY
International classification
C12N15/11
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N15/88
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
Abstract
A combined packing and assembly method that efficiently packs ribonucleic acid (RNA) into virus like particles (VLPs) has been developed. The VLPs can spontaneously assemble and load RNA in vivo, efficiently packaging specifically designed RNAs at high densities and with high purity. In some embodiments the RNA is capable of interference activity, or is a precursor of a RNA capable of causing interference activity. Compositions and methods for the efficient expression, production and purification of VLP-RNAs are provided. VLP-RNAs can be used for the storage of RNA for long periods, and provide the ability to deliver RNA in stable form that is readily taken up by cells.
Claims
1. A virus like particle (VLP) containing ribonucleic acid (RNA) comprising a) a virus like particle formed from coat proteins of a bacteriophage; and b) RNA comprising a capsid binding tag, wherein the capsid binding tag comprises SEQ ID NO:1;and wherein the coat proteins of the bacteriophage self-assemble to encapsidate three of the RNAs per VLP.
2. The VLP containing RNA of claim 1 wherein the RNA is processed in vivo into short interfering RNAs (siRNAs).
3. The VLP containing RNA of claim 1 wherein the bacteriophage coat protein is the bacteriophage q beta coat protein.
4. The VLP containing RNA of claim 1 wherein the VLP stabilizes the RNA against chemical, photochemical and enzymatic degradation processes.
5. The VLP containing RNA of claim 1 wherein the RNA comprises one or more selected from the group consisting of thermal-stable tetraloops, G-quartets, and triple strands.
6. The VLP containing RNA of claim 1 wherein the RNA is at least 180 nucleotides in length.
7. The VLP containing RNA of claim 1 wherein the RNA is inhibitory RNA specific for cellulase of a cellulose dependent insect.
8. The VLP containing RNA of claim 7 wherein the cellulose dependent insect is the eastern termite Reticulitermes flavipes.
9. The VLP containing RNA of claim 1 wherein the RNA is inhibitory RNA specific tumor-specific transcription factors.
10. The VLP containing RNA of claim 1 wherein the RNA is inhibitory RNA specific for regulators of cellular proliferation.
11. The VLP containing RNA of claim 1 wherein the target mRNA encodes proteins of infectious pathogens.
12. The VLP containing RNA of claim 1 wherein the RNA further contains a sequence tag for purification of the RNA.
13. The VLP containing RNA of claim 1, wherein the VLP is spontaneously taken up by human, insect, plant and other cells.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
DETAILED DESCRIPTION OF THE INVENTION
(8) I. Definitions
(9) The term host cell refers to prokaryotic and eukaryotic cells into which a recombinant expression vector can be introduced.
(10) The terms transformed and transfected encompass the introduction of a nucleic acid (e.g., a vector) into a cell by a number of techniques known in the art.
(11) The term specifically binds to a target refers to a binding reaction which is determinative of the presence of the molecule in the presence of a heterogeneous population of other biologics.
(12) Localization Signal or Localization Sequence or Recognition Sequence or Targeting Signal or Recognition Sequence or Recognition Tag or Recognition polynucleotide are used interchangeably and refer to a signal that directs a molecule to a specific cell, tissue, organelle, or intracellular region. The signal can be polynucleotide, polypeptide, or carbohydrate moiety or can be an organic or inorganic compound sufficient to direct an attached molecule to a desired location.
(13) The term vector refers to a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors described herein can be expression vectors.
(14) The term expression vector refers to a vector that includes one or more expression control sequences.
(15) The term gene refers to a DNA sequence that encodes through its template or messenger RNA a sequence of amino acids characteristic of a specific peptide, polypeptide, or protein. The term gene also refers to a DNA sequence that encodes an RNA product. The term gene as used herein with reference to genomic DNA includes intervening, non-coding regions as well as regulatory regions and can include 5 and 3 ends.
(16) The term iRNA refers to a ribonucleic acid (RNA) molecule which can bind by complementary base pairing to a target messenger RNA transcripts (mRNAs), usually causing translational repression or target degradation which results in gene silencing reduced gene expression. Exemplary iRNA molecules include but are not limited to short interfering RNA (siRNA) and micro RNA (miRNA).
(17) The terms target gene and target sequence are used interchangeably and refer to a sequence that can hybridize with an iRNA and induce gene silencing.
(18) The terms individual, individual, subject, and patient are used interchangeably herein, and refer to a mammal, including, but not limited to, humans, rodents, such as mice and rats, and other laboratory animals.
(19) The terms virus like particle, or VLP refer to a viral capsid formed from the assembly of viral coat proteins, that does not contain any viral genetic material. A VLP-RNA is a recombinant virus like particle containing a capsid of viral or bacteriophage coat proteins and one or more RNA molecules enclosed within the capsid.
(20) II. Compositions for Delivery of RNA
(21) Virus-like particles (VLPs) represent a promising delivery vehicle for RNAs. VLPs are symmetric, multi-protein structures that self-assemble into 100 nm-scale particles with virus-like morphology. Compositions for the delivery of RNA which employ VLPs as vessels containing RNA cargo are disclosed for a range of applications, including therapeutics, agriculture, the development of biofuels and as tools for basic research.
(22) A. RNAs Capable of Interference Activity
(23) RNA is a biological polymer with key roles in transcription, translation and many other biological functions. Over the last several decades RNA has been found to play a variety of regulatory roles in gene expression. An RNA polynucleotide with interference activity of a given gene will down-regulate the gene by causing degradation of the specific messenger RNA (mRNA) with the corresponding complementary sequence and preventing the production of protein (see Sledz and Williams, Blood, 106(3):787-794 (2005)). When an RNA molecule forms complementary Watson-Crick base pairs with an mRNA, it induces mRNA cleavage by accessory proteins. The source of the RNA can be viral infection, transcription, or introduction from exogenous sources.
(24) VLPs that contain RNA designed for RNA interference activity are disclosed. VLPs containing RNA offer several advantages over traditional RNA synthesis, packaging and delivery methods. Specifically, in vivo synthesis of VLPs containing RNA in Escherichia coli is cost-effective, adaptable and reliable.
(25) B. Virus-Like Particles (VLPs)
(26) Virus-like particles (VLPs) are symmetric, multi-protein structures that self-assemble into 100 nm-scale particles with virus-like morphology. On their exterior, VLPs resemble bacteriophages and viruses, but internally, VLPs can lack native genomic material (RNA or DNA required for integration, reverse transcription, replication, infection, etc.). Mutations and chemical modifications of VLP surfaces confer a variety of chemical and physical properties to VLPs. VLPs can be engineered as nano-containers that protect and deliver cargo such as RNA.
(27) It is known that self-assembly of VLPs can follow naturally from expression of viral envelope, capsid or coat proteins. A variety of small molecule and macromolecular cargo can be incorporated into a VLP without influencing the external morphology.
(28) C. VLPs Containing RNA
(29) VLPs are disclosed for the packaging, protection and delivery of one or more RNA molecules within a viral capsid vessel. Virus like particles containing RNA are called VLP-RNAs. RNA can be engineered to be packaged within VLPs for the production of VLP-RNAs in a single-step process (
(30) RNAs are designed for use in a simple in vivo system (in Escherichia coli) that spontaneously produces and packages the RNA into VLPs.
(31) To provide RNA for incorporation within VLPs, one or more genes are built by recursive PCR or are cloned from a cDNA or genomic library. Methods and techniques for the production and design of cDNA are known in the art (see, for example, Bowman, et al., Recombinant and in vitro RNA synthesis: Methods and protocols, methods in molecular biology, Conn G L, editor. Springer Science, LLC. pp: 19-41 (2012)).
(32) Typically the RNA includes a sequence complimentary to a target gene within a target organism, a viral coat protein recognition tag and optionally an additional sequence or tag for purification. The viral coat protein recognition tag facilitates the efficient and spontaneous uptake and assembly of the RNA into VLPs. In some embodiments the RNA is double stranded RNA. For the production of dsRNA, an expression vector is designed to include the DNA template from which both strands of RNA are to be derived. a. RNA Stability
(33) Production, packaging, storage and delivery of RNA remains the central challenge to the therapeutic application of RNAi technology. Purified RNAs are notoriously unstable and are extremely vulnerable to degradation, for example by nucleases, hydroxyl radicals, UV light, and Mg.sup.2+-mediated inline attack. The low-stability of RNAs precludes storage for long periods of time and severely limits the potential range of distribution and application methods for RNA-based pharmaceutical compounds. As a result, RNA-based applications commonly require costly and inefficient chemical modification of RNA for stabilization and delivery. As we show in
(34) DNA templates can be designed to express RNAs that have interfering activity against a specific target gene within a specific target organism (
(35) In some embodiments the RNA can induce sequence-specific silencing of the expression or translation of the target polynucleotide, thereby down-regulating or preventing gene expression. In one embodiment the RNA can induce the complete lack of expression of the target gene. In another embodiment the RNA can reduce the level of expression of the target gene below that of an untreated control.
(36) In some embodiments the RNA polynucleotide is a double-stranded small interfering RNA (siRNA). Typically, small interfering RNAs are between 21 and 23 nucleotides in length. The siRNAs can be expressed within the host cell.
(37) In other embodiments the RNA polynucleotide is a micro RNA (miRNA). A miRNA is a small RNA that adopts a hairpin conformation. The miRNA can be cleaved into biologically active dsRNA within the target cell by the activity of the endogenous cellular enzymes, for example the enzyme Dicer and Dicer-like enzymes.
(38) In some embodiments the RNA polynucleotide is a long double stranded RNA molecule (dsRNA) that is at least 24 nucleotides in length. The dsRNA is processed into a biologically active siRNA or 21-23 nucleotides by the activity of the endogenous cellular enzymes, for example the enzyme Dicer and Dicer-like enzymes within the target organism. The dsRNA contains a nucleotide sequence that is complimentary to one or more genes that are to be targeted for down-regulation.
(39) The one or more target genes can be of any desired sequence. In some embodiments the sequence of the RNA is 100% complementary to the sequence of the target gene. In other embodiments the RNA is less than 100% complementary to the target gene. In certain embodiments the RNA is at least 95%, at least 90%, at least 85% or at least 80% complementary to the nucleotide sequence of the target gene, so that sequence variations that can occur, for example due to genetic mutation, evolutionary divergence and strain polymorphism can be tolerated.
(40) The size of RNA contained within the VLP can be fewer than 50 nucleotides to many kilo-bases in length.
(41) The results of confocal laser scanning microscopy indicate the spontaneous uptake of undecorated VLPs by mammalian cells (HeLa cells). This is the first demonstration of uptake by human cells of undecorated Q VLPs, although uptake has been demonstrated for MS2 (Stockley, 2013). Spontaneous Q VLP uptake is fast (
(42) VLP-RNA interference of gene expression in vivo. Our lab designed and constructed a new RNA expression vector that generates hybrid pre-miRNA (hpmiRNA) directed against Green Fluorescent Protein (GFP) expression (
(43) RNA that is designed for incorporation within VLPs contains a sequence that is a recognition tag for the bacteriophage or virus coat protein of the VLP. Typically the recognition tag facilitates efficient packaging of the RNA into the VLP. Recognition tags for viral and bacteriophage coat proteins are known in the art and include, but are not limited to the q beta bacteriophage coat protein (See, for example, Witherell, et al., Biochemistry, 28:71-76 (1989)), the PP7 coat protein (see Lim and Peabody, Nucleic Acids Res., 30 (19) 4138-4144 (2002)). In one embodiment the recognition tag is a 54-nucleotide RNA containing two hairpin structures specific for the enterobacteria bacteriophage q beta coat protein. The sequence of the tag (SEQ ID NO. 1) is 5 rUUCCUCGUGCUUAGUAACUAAGGAUGAAAUG CAUGUCUAAGACAGCAUCUUCGC 3 d. Sequence for RNA Purification
(44) If necessary, the RNA is designed to include a sequence to assist the purification of the RNA. In some embodiments the sequence forms an RNA aptamer. RNA aptamers can assist in the purification of the RNA through affinity chromatography with RNA binding proteins. In one embodiment a sequence (taken from prior art: Nucleic Acids Research, 2001, VO1.29, No. 2 e4) that assists in the purification of the RNA is located at the opposite end of the RNA polynucleotide to the bacteriophage or viral coat protein recognition tag. The sequence of the RNA tag (SEQ ID NO. 2) is 5 CAGCAAGUUCCGCAACCGUA UCAAAACGUAAAUUACUCGGAC 3 2. Viral Coat Protein
(45) VLP-RNAs include bacteriophage or viral coat proteins. Viral or bacteriophage coat proteins are known in the art and include the enterobacteria bacteriophage Q beta coat protein and the bacteriophage PP7 coat protein. An exemplary nucleotide sequence for genes encoding the bacteriophage Q beta coat protein is
(46) TABLE-US-00001 46 atggcaaaattagag 61 actgttactttaggtaacatcgggaaagatggaaaacaaactctggtcctcaatccgcgt 121 ggggtaaatcccactaacggcgttgcctcgctttcacaagcgggtgcagttcctgcgctg 181 gagaagcgtgttaccgtttcggtatctcagccttctcgcaatcgtaagaactacaaggtc 241 caggttaagatccagaacccgaccgcttgcactgcaaacggttcttgtgacccatccgtt 301 actcgccaggcatatgctgacgtgaccttttcgttcacgcagtatagtaccgatgaggaa 361 cgagcttttgttcgtacagagcttgctgctctgctcgctagtcctctgctgatcgatgct 421 attgatcagctgaacccagcgtattga
(from SEQ ID NO. 3). GenBank: M99039.1.
(47) An exemplary amino acid sequence for the bacteriophage Q beta coat protein gene is
(48) TABLE-US-00002 10203040 MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAG 50607080 AVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGS 90100110120 CDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASP 130 LLIDAIDQLNPAY
(SEQ ID NO. 4).
II. Methods for Making and Using VLPs Containing RNA
(49) Methods for the production of VLPs containing RNA are provided. Methods for the purification and delivery of the VLPs containing RNA are also provided.
(50) A. Production of VLPs Containing RNA
(51) Methods for single-step production of VLPs containing RNA are disclosed. The methods can be used, for example, for the production and packaging of RNA into VLPs. Typically, the expression of RNA is greater in the prokaryotic expression system when the RNA is sequestered and packaged into VLPs than when RNA is produced alone. The RNA and VLPs self-assemble with high specificity into VLP-RNAs when the RNA is fused the appropriate tag (for example, an RNA hairpin sequence). The methods do not impose any limitation on the structure of the RNA that is to be packaged within the VLPs. VLP packaged RNAs can be long or short, single-stranded or double-stranded, and can be of any sequence.
(52) The purification of VLPs containing RNA produced by the disclosed methods is trivial, and is simpler than the purification of unpackaged RNA. VLPs protect the enclosed RNAs from chemical, photo- and enzymatic degradation. The RNA in a VLP is stabilized against degradation by nucleases, hydroxyl radical, UV light, and Mg.sup.2+-mediated inline attack. VLPs eliminate requirements for chemical modification to stabilize and deliver RNA. The high-stability of VLP-RNAs enables storage for long periods of time and allows for a broad range of application methods, including distribution as aerosols, solutions, powders, etc. The VLP-RNAs are readily taken up by many cell types and efficiently deliver RNA to biological targets. Furthermore, production and usage of VLPs containing RNA is water-based and environmentally sound. RNA within VLP is stable indefinitely at room temperature. [We are doing a lot of experiments to characterize RNA stability under extreme conditions (Temp, UV, etc) and can add a subsection on this later] 1. Expression of VLP Genes and RNA
(53) For the expression of VLPs and RNA, the host organism is transformed with plasmids that express genes for the coat protein of a bacteriophage or virus in addition to one or more RNA gene(s).
(54) Typically, the gene(s) encoding RNA and genes encoding bacteriophage or viral coat proteins are cloned into an expression system for the expression of VLPs containing RNA in vivo. Suitable expression systems are known in the art (see, for example, Studier, Protein Expr Purif, 41: 207-234. (2005)). The coat protein is expressed in the pCDF-1b expression vector. The RNA is expressed in either pET-28b or pUC-19.
(55) In some embodiments, the in vivo expression of RNA occurs in a prokaryote. Prokaryotes commonly utilized for the expression of RNA include, but are not limited to bacteria such as Escherichia spp., Bacillus spp. and Thermophilus spp. In one embodiment the host organism for in vivo production of VLPs containing RNA is Escherichia coli. Useful Escherichia coli strains for expressing and producing polypeptides are well known in the art. The BL21(DE3) strain of E. coli is used to express the protein and RNA.
(56) Expression cassettes that are designed for the expression of RNA can be easily transferred to a transformation vector for transfer to the host organism and transformation techniques are well known in the art. The one or more genes encoding RNA and the one or more genes encoding the coat protein of a bacteriophage or virus can be encoded within the same expression construct, or may be encoded within two or more different expression constructs. The genes can be under the control of the same or different promoter elements. In some embodiments the expression of the VLPs containing RNA is under the control of an inducible promoter. An exemplary inducible promoter is the Isopropyl--D-thiogalactopyranoside (IPTG) inducible promoter. 2. Assembly of VLPs Containing RNA
(57) The disclosed methods provide one or more RNA genes and viral or bacteriophage coat proteins that spontaneously assemble in vivo into intact VLP-RNAs. The RNA and VLPs self-assemble with high specificity into VLP-RNAs when the RNA is fused to the appropriate tag (for example, an RNA hairpin sequence). In one embodiment, VLPs containing RNA are expressed in high yield in Escherichia coli cells.
(58) In one embodiment the RNA packaged within the VLP is at least 80% pure. In other embodiments the RNA is at least 85% pure, at least 90% pure or at least 95% pure. Typically one VLP vessel contains at least one RNA molecule. In one embodiment the RNA is packaged within the VLPs at an RNA/VLP molar ratio of about 3.6, such that each VLP packs approximately three RNA molecules. 3. Purification of VLPs Containing RNA.
(59) Because of their distinctive size, properties and high stability, VLPs can be easily purified from Escherichia coli cellular lysates. The purification of VLPs containing RNA (VLP-RNAs) produced by the disclosed methods is straightforward, and is simpler than the purification with fast protein liquid chromatography (FPLC), filtration, sedimentation, sucrose-gradient separation, affinity tag chromatography and flow-field fractionation multi-angle light scattering (FFF-MALS). In some embodiments purification of the VLPs containing RNA includes pelleting of the host organism cells. The pelleted cells or isolated VLPs can be frozen or dried for storage or distribution purposes. 4. Delivery of Purified VLPs Containing RNA
(60) VLPs protect the enclosed RNAs from chemical, photo- and enzymatic degradation. The RNA in a VLP is stabilized against degradation by nucleases, hydroxyl radical, UV light, and Mg.sup.2+-mediated inline attack. VLPs eliminate requirements for chemical modification to stabilize and deliver RNA. The high-stability of VLP-RNAs enables storage for long periods of time and allows for a broad range of application methods, including distribution as aerosols, solutions, powders, etc. The VLPs are readily taken up by many cell types and efficiently deliver RNA to biological targets.
(61) In one embodiment purified VLPs containing RNA are introduced into a complex eukaryotic organism by ingestion of doped food. When the VLPs are taken up by target cells, the RNA is released and the biological activity of the enclosed RNA is manifest. VLPs containing RNA can be delivered as crude cell extracts. In other embodiments they can be left within the pelleted Escherichia coli and delivered as intact Escherichia coli cells.
(62) B. Applications of VLPs Containing RNAs 1. Therapeutics
(63) In some embodiments VLPs containing RNA are used for the delivery of RNA for applications in therapeutics. In certain embodiments, the targeting of gene expression by the RNA is an effective therapeutic strategy against infectious disease, cancer, inflammatory disease, etc. In one embodiment, VLPs containing RNAs are used to deliver a RNA-based functional cure for hepatitis B, which infects over 300 million people world-wide. 2. Agriculture.
(64) In some embodiments VLPs containing RNA are used for the protection of plants from weeds and insects and for increasing crop yields. In certain embodiments, the targeting of gene expression by the RNA enables the production of allergy-free peanuts and decaffeinated coffee beans. In one embodiment, VLPs are used to deliver RNA to kill mites that parasitize honeybees. 3. Biofuels
(65) In some embodiments VLPs containing RNAs are used for the delivery of RNA designed to substantially improve solar-driven hydrogen production by microalgae. 4. Research Tools
(66) In some embodiments VLPs containing RNAs are used for research tools. In one embodiment the RNAs are used for the study of loss of function due to silencing of target genes by RNA, for example to assist in elucidating gene function.
EXAMPLES
Example 1
Construction of a VLP Containing RNA
(67) Materials and Methods
(68) RNA Design and Expression
(69) Using Known methods, one or more genes are built by recursive PCR or are cloned from a cDNA or genomic library. The genes, along with promoters and terminators, are DNA sequences designed to express the desired RNAs. The genes can be of any desired sequence and can encode either double-stranded or single-stranded RNAs. RNAs of essentially any length and sequence can be produced in high yield in Escherichia coli. The RNA gene(s) are cloned into an inducible expression system.
(70) Assembly and Purification of VLPs Containing RNA.
(71) The RNA is designed to contain a recognition tag that confers high affinity for a bacteriophage or virus coat protein along with a known aptamer for RNA purification, if necessary. The recognition tag facilitates efficient packaging of the RNA into the VLP.
(72) In this process, Escherichia coli are transformed with plasmids that express the RNA gene(s) in addition to genes for the coat protein of a bacteriophage or virus. The expressed coat protein spontaneously assembles in vivo into intact VLPs that contain RNAs (VLP-RNAs). Because of their distinctive size, properties and high stability, VLPs can be easily purified from Escherichia coli cellular lysates.
(73) Delivery.
(74) Purified VLP-RNAs can be introduced into a complex eukaryotic organism by ingestion of doped food. When the VLP-RNAs are taken up by target cells, the RNA is released and the biological activity of the RNA is manifest. VLP-RNAs can be delivered as crude cell extracts. In addition they can be left within the pelleted Escherichia coli and delivered as intact Escherichia coli cells.
(75) Results
(76) A simple, robust, general and adaptable in vivo system in Escherichia coli that produces and packages RNA into VLPs was built. An integrated process for (i) Simultaneous over-production of RNA and a bacteriophage coat protein, (ii) in vivo self-assembly of VLP-RNAs, was designed, constructed and successfully tested.
(77) RNA was packaged into a VLP by co-expression of the capsid protein and the RNA in vivo. The RNA, which was obtained by disruption of purified VLPs, contains a capsid binding tag along with a secondary affinity tag at a terminus for optional purification. The RNA, including the duo tags, is 751 nucleotides in length, corresponding to the brightest band in the lane on the LH side. Integration of the band intensities on the gel suggests that the RNA is 80% pure. Comparison of quantity of VLP capsid protein with encapsulated RNA indicates an RNA/VLP molar ratio of 3.6. This ratio suggests that, on average, one VLP packs about three RNA molecules (see
(78) These data demonstrate that VLP-RNAs assemble and are efficiently packaged with the tagged-RNA when both coat protein and RNA are over produced in Escherichia coli. VLP-RNAs, the protein and RNA components of VLP-RNAs were purified and characterized (see
(79) TABLE-US-00003 5' rGUCCGAGUAAUUUACGUUUUGAUACGGUUGCGGAACUUGCGGGGUG CCUAUUGAAGCAUGAGCCGGCGACUCAGCCGUAAGGCUGGACCCGAAACC GGGCGAGCUAGCCCUGGCCAGCCGUAAGGCGAACCGGUGGGGGAUGCAAA CCCCUCGGAUGAGCUGGGGCUAGGAGUGAAAAGCUAACCGAGCCCGGAGA UAGCUGGUUCUGCCGUAAGGCAGCGUUGCCGUAAGGCAAGUGCGAAUGCC GGCAUGAGUAACGAGCGGGAGAACCCUCGCCAAGGAACUCUGCAAGCCGU AAGGCCUCUGGCGACUGUUUACCAAAAACACAGCGCCGUAAGGCGCGAGC CGUAAGGCUAACGACCGGAGCGCUGUCUCGGCGAGGGACCCGGUGAAAUU GAACUGGCCGUGAAGAUGCGGCCUACCCGUGGCAGGACGAAAAGACCCCG UGGAGCUUUACUGCCGUAAGGCAGUUUGACUGGGGCGGUCGGCCGUAAGG CUAAAAGUUACCCCGGGGAUAACAGGCUGAUCGCCGUAAGGCGGUUUGGC ACCUCGAUGUCGGCUCGUCGCGCCGUAAGGCUUGGGCUGUUCGCCCAUUA AAGCGGCACGCGAGCUGGGUUCAGAACGUCGUGAGACAGUUCGGUCUCUA UCCGCCACGGGCUUCCUCGUGCUUAGUAACUAAGGAUGAAAUGCAUGUCU AAGACAGCAUCUUCGC3'
Example 2
VLPs Containing RNA Selectively Target and Kill Target Insects
(80) Materials and Methods
(81) Strategy
(82) Delivery of RNA to a biological target using VLPs containing RNA (VLP-RNAs) and efficacy of the VLP-RNAs was demonstrated with the eastern subterranean termite Reticulitermes flavipes workers, an insect that causes economically significant damage to buildings and crops system in which RNA interference feeding approaches were previously shown to silence genes.
(83) Delivery and Assay for Efficacy of VLPs Containing RNA
(84) An active VLP-RNA was designed to selectively target the cellulose gene, a critical digestive gene of Reticulitermes flavipes (VLP-RNA-cellulase). A solution containing 600 g of VLP-RNA-cellulase was added each day to filter paper and the survival of Reticulitermes flavipes workers consuming the VLP-RNA-cellulase doped paper was monitored throughout 14 days. A control group of termites consumed filter paper treated with buffer alone.
(85) Results
(86) RNA is protected by VLPs in unfavorable environments. Denaturing polyacrylamide gel analysis of naked RNA and VLP-packaged RNA for different time intervals shown on left column (
(87)
(88)
(89) The in vivo VLP-packaged pre-miRNA knocks down the GFP gene expression in HeLa cells. The pre-miRNA designed to knock down the GFP gene expression is packed by the production of VLP simultaneously in vivo. Prior to the incubation of the in vivo VLP-packaged pre-miRNA with HeLa cells, the GFP gene was first chemically transfected into HeLa cells. The GFP gene expression level was then observed by using fluorescence microscopic techniques. The HeLa cells are treated with (
(90)
(91)
(92) VLPs function as controlled release capsules to release pre-miRNA steadily and continuously over time. This unique feature could extend the time course of the suppression of target gene expression compared with conventional RNAi technology.
REFERENCES
(93) 1. Zeltins A (2013) Construction and characterization of virus-like particles: A review. Mol Biotechnol 53: 92-107. 2. Smith M T, Hawes A K, Bundy B C (2013) Reengineering viruses and virus-like particles through chemical functionalization strategies. Curr Opin Biotechnol. 3. Rhee J K, Hovlid M, Fiedler J D, Brown S D, Manzenrieder F, Kitagishi H, Nycholat C, Paulson J C, Finn M G (2011) Colorful virus-like particles: Fluorescent protein packaging by the q beta capsid. Biomacromolecules 12: 3977-3981. 4. Pan Y, Zhang Y, Jia T, Zhang K, Li J, Wang L (2012) Development of a microrna delivery system based on bacteriophage ms2 virus-like particles. FEBS J 279:1198-1208. 5. Lau J L, Baksh M M, Fiedler J D, Brown S D, Kussrow A, Bomhop D J, Ordoukhanian P, Finn M G (2011) Evolution and protein packaging of small molecule RNA aptamers. ACS Nano 5: 7722-7729. 6. Zhou X, Wheeler M M, Oi F M, Scharf M E (2008) RNA interference in the termite Reticulitermes flavipes through ingestion of double-stranded RNA. Insect Biochem Mol Biol 38: 805-815. 7. Bowman J C, Azizi B, Lenz T K, Roy P, Williams L D (2012) Preparation of long templates for RNA in vitro transcription by recursive PCR. In: Conn G L, editor. Recombinant and in vitro RNA synthesis: Methods and protocols, methods in molecular biology: Springer Science, LLC. pp. 19-41. 8. Studier F W (2005) Protein production by auto-induction in high density shaking cultures. Protein Expr Purif 41: 207-234. 9. Witherell G W, Uhlenbeck O C (1989) Specific RNA binding by q beta coat protein. Biochemistry 28: 71-76. 11. Milhavet O, Gary D S, Mattson M P (2003) RNA interference in biology and medicine. Pharmacol Rev 55: 629-648. 12. Whitehead K A, Langer R, Anderson D G (2009) Knocking down barriers: Advances in sirna delivery. Nat Rev Drug Discov 8: 129-138. 13. Oey M, Ross I L, Stephens E, Steinbeck J, Wolf J, Radzun K A, Kugler J, Ringsmuth A K, Kruse O, Hankamer B (2013) Rnai knock-down of lhcbm1, 2 and 3 increases photosynthetic h2 production efficiency of the green alga Chlamydomonas reinhardtii. PLoS One 8: e61375. 14. Huvenne H, Smagghe G (2010) Mechanisms of dsrna uptake in insects and potential of rnai for pest control: A review. J Insect Physiol 56: 227-235. 15. Lant B, Derry W B (2013) Methods for detection and analysis of apoptosis signaling in the C. Elegans germline. Methods (San Diego, Calif.) 61: 174-182. 16. Sledz and Williams, RNA interference in biology and disease, Blood, 106(3):787-794 (2005). 17. Zeng, Y, Rui, Y. and Cullen R., MicroRNAs and small interfering RNAs can inhibit mRNA expression by similar mechanisms, PNAS, 100:9779-9784 (2003)). 18. Neema Agrawal, P. V. N. Dasaradhi, Asif Mohmmed, Pawan Malhotra, Raj K. Bhatnagar, and Sunil K. Mukherjee, Microbiology and molecular biology reviews, pp. 657-685 (2003).