Mutant reverse transcriptase
09932567 ยท 2018-04-03
Assignee
Inventors
- Yan Xu (Hamilton, MA, US)
- Jennifer Ong (Salem, MA)
- Shengxi Guan (Stoneham, MA)
- Nicole Nichols (Reading, MA, US)
Cpc classification
C12N9/22
CHEMISTRY; METALLURGY
C12Y207/07049
CHEMISTRY; METALLURGY
C12P19/34
CHEMISTRY; METALLURGY
C12N9/1276
CHEMISTRY; METALLURGY
International classification
C12P19/34
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
C12N9/12
CHEMISTRY; METALLURGY
Abstract
A mutant MMLV reverse transcriptase that may have an improvement in one or more properties is provided. For example, the present reverse transcriptase is believed to be more efficient relative to other commercially available MMLV reverse transcriptase variants, particularly for templates with a higher GC content.
Claims
1. A method comprising: (a) obtaining a reaction mix by combining a primer, an RNA template and a reverse transcriptase, wherein the reverse transcriptase comprises: at least 300 contiguous amino acids of SEQ ID NO: 1; and (b) incubating the reaction mix to produce cDNA copied from the RNA template.
2. The method of claim 1, wherein the reaction mix is incubated at temperature in the range of 4560 C.
3. The method of claim 1, further comprises a template switching oligonucleotide.
4. The method of claim 1, wherein the primer is an oligo-dT primer.
5. The method of claim 1, wherein the primer is a random primer.
6. The method of claim 1, wherein the primer is a gene-specific primer.
7. The method of claim 1, wherein the reverse transcriptase comprises an exogenous sequence-specific DNA binding domain.
8. The method of claim 1, wherein the reverse transcriptase comprises an amino acid sequence that is at least 90% identical to at least 300 contiguous amino acids of SEQ ID NO:2 that is C-terminal to the at least 300 contiguous amino acids of SEQ ID NO:1.
9. The method of claim 1, wherein the reverse transcriptase does not have RNAseH activity.
10. The method of claim 1, wherein the reverse transcriptase has RNAseH activity.
11. The method of claim 1, wherein the method comprises: (c) amplifying the cDNA produced in step (b).
12. The method according to claim 11, wherein the amplification is PCR.
13. The method of claim 1, wherein the method comprises quantifying the cDNA produced in step (b).
14. A method comprising: (a) obtaining a reaction mix by combining a primer, an RNA template and a reverse transcriptase, wherein the reverse transcriptase comprises: (i) amino acids 24-335 of SEQ ID NO: 1 and (ii) an amino acid sequence that is at least 90% identical to amino acids 1-286 of SEQ ID NO: 2 wherein the amino acid sequence of (i) is N-terminal to the amino acid sequence of (ii); and (b) incubating the reaction mix to produce cDNA copied from the RNA template.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1) The skilled artisan will understand that the drawings, described below, are for illustration purposes only. The drawings are not intended to limit the scope of the present teachings in any way.
(2)
(3)
(4)
DETAILED DESCRIPTION OF EMBODIMENTS
(5) Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described.
(6) All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.
(7) Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, nucleic acids are written left to right in 5 to 3 orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
(8) The headings provided herein are not limitations of the various aspects or embodiments of the invention. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.
(9) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 2D ED., John Wiley and Sons, New York (1994), and Hale & Markham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, N.Y. (1991) provide one of skill with the general meaning of many of the terms used herein. Still, certain terms are defined below for the sake of clarity and ease of reference.
(10) As used herein, the term reverse transcriptase refers to any DNA polymerase that can copy first-strand cDNA from an RNA template. Such enzymes are commonly referred to as RNA-directed DNA polymerases and have IUBMB activity EC 2.7.7.49. In some cases, a reverse transcriptase can copy a complementary DNA strand using either single-stranded RNA or DNA as a template. MMLV reverse transcriptase is the reverse transcriptase of the Moloney murine leukemia virus.
(11) As used herein, the term template refers to the substrate RNA for the reverse transcriptase to make cDNA. A template may be complex (e.g., total RNA, polyA+ RNA, mRNA, etc.) or not complex (e.g., an enriched RNA or an in vitro transcribed product).
(12) The term cDNA refers to a strand of DNA copied from an RNA template. cDNA is complementary to the RNA template.
(13) A mutant or variant protein may have one or more amino acid substitutions, deletions (including truncations) or additions (including deletions) relative to a wild-type. A variant may have less than 100% sequence identity to the amino acid sequence of a naturally occurring protein but may have any amino acid that is at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of the naturally occurring protein. A fusion protein is a type of protein composed of a plurality of polypeptide components that are unjoined in their naturally occurring state. Fusion proteins may be a combination of two, three or even four or more different proteins. The term polypeptide includes fusion proteins, including, but not limited to, a fusion of two or more heterologous amino acid sequences, a fusion of a polypeptide with: a heterologous targeting sequence, a linker, an immunologically tag, a detectable fusion partner, such as a fluorescent protein, -galactosidase, luciferase, etc., and the like. A fusion protein may have one or more heterologous domains added to the N-terminus, C-terminus, and or the middle portion of the protein. If two parts of a fusion protein are heterologous, they are not part of the same protein in its natural state.
(14) The term non-naturally occurring refers to a composition that does not exist in nature. Variant proteins are non-naturally occurring. In some embodiments, non-naturally occurring refers to a protein that has an amino acid sequence and/or a post-translational modification pattern that is different to the protein in its natural state. A non-naturally occurring protein may have one or more amino acid substitutions, deletions or insertions at the N-terminus, the C-terminus and/or between the N- and C-termini of the protein. A non-naturally occurring protein may have an amino acid sequence that is different to a naturally occurring amino acid sequence (i.e., having less than 100% sequence identity to the amino acid sequence of a naturally occurring protein) but that that is at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98% or at least 99% identical to the naturally occurring amino acid sequence. In certain cases, a non-naturally occurring protein may contain an N-terminal methionine or may lack one or more post-translational modifications (e.g., glycosylation, phosphorylation, etc.) if it is produced by a different (e.g., bacterial) cell.
(15) In the context of a nucleic acid, the term non-naturally occurring refers to a nucleic acid that contains: a) a sequence of nucleotides that is different to a nucleic acid in its natural state (i.e. having less than 100% sequence identity to a naturally occurring nucleic acid sequence), b) one or more non-naturally occurring nucleotide monomers (which may result in a non-natural backbone or sugar that is not G, A, T or C) and/or c) may contain one or more other modifications (e.g., an added label or other moiety) to the 5-end, the 3 end, and/or between the 5- and 3-ends of the nucleic acid.
(16) In the context of a preparation, the term non-naturally occurring refers to: a) a combination of components that are not combined by nature, e.g., because they are at different locations, in different cells or different cell compartments; b) a combination of components that have relative concentrations that are not found in nature; c) a combination that lacks something that is usually associated with one of the components in nature; d) a combination that is in a form that is not found in nature, e.g., dried, freeze dried, crystalline, aqueous; and/or e) a combination that contains a component that is not found in nature. For example, a preparation may contain a non-naturally occurring buffering agent (e.g., Tris, HEPES, TAPS, MOPS, tricine or MES), a detergent, a dye, a reaction enhancer or inhibitor, an oxidizing agent, a reducing agent, a solvent or a preservative that is not found in nature.
(17) The term template-switching refers to a reverse transcription reaction in which the reverse transcriptase switches template from an RNA molecule to a synthetic oligonucleotide (which usually contains two or three Gs at its 3 end, thereby copying the sequence of the synthetic oligonucleotide onto the end of the cDNA. Template switching is generally described in Matz et al., Nucl. Acids Res. 1999 27: 1558-1560 and Wu et al., Nat Methods. 2014 11: 41-6. In template switching (and as illustrated in
(18) The term RNAseH activity refers to an activity that hydrolyzes the RNA in RNA/DNA hybrid. Many reverse transcriptases have an RNAseH activity that can be inactivated by truncation or by substitution.
(19) The term primer refers to an oligonucleotide that is capable, upon forming a duplex with a polynucleotide template, of acting as a point of initiation of nucleic acid synthesis and being extended from its 3 end along the template so that an extended duplex is formed. The sequence of nucleotides added during the extension process is determined by the sequence of the template polynucleotide. Primers are of a length compatible with their use in synthesis of primer extension products, and can are in the range of between 8 to 100 nucleotides in length, such as 10 to 75, 15 to 60, 15 to 40, 18 to 30, 20 to 40, 21 to 50, 22 to 45, 25 to 40, and so on, more typically in the range of between 18 to 40, 20 to 35, 21 to 30 nucleotides long, and any length between the stated ranges. Primers are usually single-stranded. Primers have a 3 hydroxyl.
(20) The term primer extension as used herein refers to both to the synthesis of DNA resulting from the polymerization of individual nucleoside triphosphates using a primer as a point of initiation, and to the joining of additional oligonucleotides to the primer to extend the primer. Primers can incorporate additional features which allow for the detection or immobilization of the primer but do not alter the basic property of the primer, that of acting as a point of initiation of DNA synthesis. For example, primers may contain an additional nucleic acid sequence at the 5 end which does not hybridize to the target nucleic acid, but which facilitates cloning of the amplified product. The region of the primer which is sufficiently complementary to the template to hybridize is referred to herein as the hybridizing region. The terms target region and target nucleic acid refers to a region or subsequence of a nucleic acid which is to be reverse transcribed.
(21) A polypeptide comprising at least 300 contiguous amino acids of SEQ ID NO:1 is provided. The first 23 amino acids can be removed from MMLV reverse transcriptase without altering the polymerase activity of that enzyme (see, e.g., Gu et al., J. Mol. Biol. 305: 341-359, Najmudin et al, J. Mol. Biol. 296 613-632 and Das et al., Protein Sci. 2001 10: 1936-1941). As such, some embodiments, the polypeptide may have a truncated N-terminus relative to SEQ ID NO:1. In some embodiments, the polypeptide may comprises amino acid residues 24-335 of SEQ ID NO:1, e.g., the entire contiguous sequence of SEQ ID NO:1. The present polypeptide may contain 5, 6, or 7 or more amino acid substitutions relative to the corresponding sequence in the wild type MMLV reverse transcriptase.
(22) The polypeptide may additionally comprise an amino acid sequence that is at least 90% (e.g., at least 95%, at least 98%, at least 99% or at least 100%) identical to at least 286 contiguous amino acids (e.g., at least 300 contiguous amino acids, at least 325 contiguous amino acids or at least 336 contiguous amino acids) of SEQ ID NO:2, where SEQ ID NO:2 is the sequence of the C-terminal part of an MMLV reverse transcriptase, shown below: WGPDQQKAYQEIKQALLTAPALGLPDLTKPFELFVDEKQGYAKGVLTQKLGPWRRPVAYLSKKLDP VAAGWPPCLRMVAAIAVLTKDAGKLTMGQPLVILAPHAVEALVKQPPDRWLSNARMTHYQALLL DTDRVQFGPVVALNPATLLPLPEEGLQHNCLDILAEAHGTRPDLTDQPLPDADHTWYTDGSSLLQE GQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRYAFATAHIHGEIY RRRGLLTSEGKEIKNKDEILALLKALFLPKRLSIIHCPGHQKGHSAEARGNRMADQAARKAAITETPDT STLLIENSSPNSRLIN (SEQ ID NO:2)
(23) This additional sequence may be positioned C-terminal to the at least 300 contiguous amino acids of SEQ ID NO: 1. It is known that as many as 62 residues can be removed from the C-terminus of the MMLV reverse transcriptase (see, e.g., U.S. Pat. No. 5,017,492) without significantly altering the polymerase activity. As such, in some embodiments, the additional amino acid sequence may lack the C-terminal 3, 5, 10, 12, 15, 30, 50 or 62 amino acids of SEQ ID NO:2.
(24) The MMLV reverse transcriptase has been crystallized (see, e.g., Das et al., Structure. 2004 12: 819-29), the structure-functional relationships in MMLV reverse transcriptase have been studied (see, e.g., Cote et al., Virus Res. 2008 134: 186-202, Georgiadis et al., Structure. 1995 3: 879-92 and Crowther et al., Proteins 2004 57: 15-26) and many mutations in MMLV reverse transcriptase are known (see, e.g., Yasukawa et al., J. Biotechnol. 2010 150: 299-306, Arezi et al Nucleic Acids Res. 2009 37: 473-81 and Konishi et al., Biochem. Biophys. Res. Commun. 2014 454:269-74, among many others). It is also known that one can truncate the MMLV reverse transcriptase from either ends, and add exogenous sequences to either end (see, e.g., U.S. Pat. No. 5,017,492), without abolishing activity. As such, MMLV reverse transcriptase variants are well known.
(25) In some embodiments, the polypeptide may additionally comprises an exogenous domain and/or a purification tag (e.g., a His tag or the like) at either terminus. In some embodiments, the polypeptide may comprise a sequence-specific DNA binding protein domain, which domain has been shown to increase the processivity of other polymerases (see, e.g., US 2016/0160193). In some embodiments the sequence-specific DNA binding protein domain may be a DNA binding protein domain listed in the following table (as found in US 2016/0160193).
(26) TABLE-US-00001 DNA-binding protein Tfx BD-51 gi|499321160 AbrB/MazE/MraZ-like BD-52 gi|499321199 Winged helix DNA-binding domain BD-54 gi|499322061 Ribbon-helix-helix protein, copG family BD-62 gi|499321149 lambda repressor-like BD-63 gi|499322443 DNA-binding domains Resolvase-like BD-67 gi|499322676 Winged helix DNA-binding domain BD-71 gi|499322676 Winged helix DNA-binding domain BD-74 gi|499322255 Winged helix DNA-binding domain BD-75 gi|499322388 Winged helix DNA-binding domain BD-81 gi|499322131 Winged helix DNA-binding domain BD-82 gi|499321342 Winged helix DNA-binding domain BD-85 gi|499321130 Winged helix DNA-binding domain BD-86 gi|499322705 Winged helix DNA-binding domain BD-88 gi|499320855 Winged helix DNA-binding domain BD-89 gi|499322250 Winged helix DNA-binding domain BD-91 gi|499321633 Winged helix DNA-binding domain BD-92 gi|490170077 Winged helix DNA-binding domain BD-93 gi|499321272 Winged helix DNA-binding domain BD-94 gi|499320919 Winged helix DNA-binding domain BD-97 gi|499320853 Winged helix DNA-binding domain BD-98 gi|499321734 Winged helix DNA-binding domain BD-100 gi|499322439 Winged helix DNA-binding domain BD-102 gi|499322707 Winged helix DNA-binding domain BD-109 gi|499321112 HCP-like BD-02 gi|351675391 Helix-turn-helix domain, rpiR family BD-03 gi|500479591 Helix-turn-helix domain, rpiR family BD-04 gi|15643984 Bacterial regulatory proteins, lacl family BD-07 gi|15643711 Bacterial regulatory proteins, lacl family BD-08 gi|15643974 Bacterial regulatory proteins, lacl family BD-09 gi|15643956 Bacterial regulatory proteins, lacl family BD-11 gi|500480095 lambda repressor-like DNA-binding BD-12 gi|15643421 domains Winged helix DNA-binding domain BD-14 gi|15644350 Winged helix DNA-binding domain BD-16 gi|24159093 Winged helix DNA-binding domain BD-18 gi|15643139 Winged helix DNA-binding domain BD-23 gi|15642807 Winged helix DNA-binding domain BD-24 gi|15643159 Winged helix DNA-binding domain BD-30 gi|15643333 Winged helix DNA-binding domain BD-32 gi|15643055 Winged helix DNA-binding domain BD-37 gi|15643827 Winged helix DNA-binding domain BD-43 gi|15643699 Homeodomain-like BD-45 gi|15643788
(27) In some embodiments, the polypeptide may have reverse transcriptase activity. In these embodiments, the polypeptide may or may not have an RNAseH activity in addition to the reverse transcriptase activity. Examples of MMLV reverse transcriptase that lack the RNAseH activity are known (see, e.g., Kotewicz et al., Nucleic Acids Res. 1988 16: 265-77 and Schultz et al., J. Virol. 1996 70: 8630-8).
(28) A method for reverse transcribing an RNA template is also provided. In some embodiments, this method may comprise: (a) combining a primer, an RNA template, a reverse transcriptase comprising: i. at least 300 contiguous amino acids of SEQ ID NO:1, as described above, and ii. an amino acid sequence that is at least 90% identical to at least 286 contiguous amino acids of SEQ ID NO:2 (as described above) that is C-terminal to the at least 300 contiguous amino acids of SEQ ID NO:1, as well as any other components that may be necessary or desirable to perform a reverse transcription (e.g., salt, nucleotides, RNAse inhibitor, buffer, etc.), to produce a reaction mix; and (b) incubating the reaction mix to produce cDNA copied from the RNA template. The RNA template may be any type of RNA template, e.g., total RNA, polyA.sup.+ RNA, capped RNA, enriched RNA etc., and the RNA can be from any source, e.g., bacteria, mammals, an in vitro transcription reaction, etc., methods for the making of which are known. The RNA template may contain RNA molecules that are at least 1 kb in length, e.g., at least 2 kb, at least 3 kb or at least 5 kb and, in some embodiments, at least some of the molecules in the RNA template may have a GC content of at least 50%, at least 60%, at least 70%, or at least 80%. The primer in the reaction mix may be any type of primer, e.g., an oligo-dT primer, a random primer or a gene-specific primer, for example, which primers are commonly used to make cDNA. In some embodiments, the reaction mix may comprise a template switching oligonucleotide, as described above.
(29) In some embodiments, the reaction mix may be incubated at temperature that is higher than 42 C., e.g., at a temperature in the range of 45 C. to 60 C. In some embodiments, the reaction mix may be incubated at a temperature in the range of 42 C. to 45 C., 48 C. to 51 C., 51 C. to 54 C., 54 C. to 57 C., 57 C. to 60 C. or 60 C. to 65 C. In some embodiments, the population of cDNA molecules produced by the method may be at least 20%, at least 40%, at least 60%, or at least 80% full length. The polymerase can reverse transcribe GC rich template molecules with increased efficiency compared with previously available reverse transcriptases where the template molecules may have at least 20%, 30%, 40%, 50%, 60%, 70% or 80% GC content (see for example,
(30) If an oligo-dT or a random primer is used in the method, then the may be used to make a cDNA library that can be sequenced or used for gene expression analysis. Alternatively, if a gene-specific primer is used, then method may be used for RT-PCR (e.g., quantitative RT-PCR) and other similar analyses.
(31) All references cited herein are incorporated by reference.
EXAMPLES
(32) Aspects of the present teachings can be further understood in light of the following examples, which should not be construed as limiting the scope of the present teachings in any way.
(33) Superscript IV, Protoscript II and a variant MMLV reverse transcriptase referred to as M19H were tested in a template switching assay to determine the efficiency of reverse transcription of templates that have different GC contents (14% to 88.6%). The M19H mutant comprises the following N-terminal sequence:
(34) TABLE-US-00002 (SEQIDNO:1) TLNIEDEYRLHETSKEPDVSLGSTWLSDFPQAWAETGGMGLAVRQAPLIIP LKATATPVSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVK KPGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKD AFFCLRLHPTSQPLFAFEWRDPEMGISGQLTWTRLPQGFKNSPTLFDEALH RDLADFRIQHPDLILLQYVDDLLLAATSELDCQQGTRALLQELGDLGYRAS AKKAQICQKQVKYLGYLLKEGQRWLTEARKETVMGIPTPKTPRQLREFLGT AGFCRLWIPGFAELAAPLYPLTKEGTLFN
(35) A template switching assay was performed. 0.5 l of 2 M RNA transcript (200 to 330 nucleotides in length) of varying GC content (from 14% to 88.6%), 0.3 l of 1 M FAM primer, 1 l of 10 mM dNTP, 0.25 l of RNase Inhibitor, 1 l of 10 M template switching oligonucleotide (oligo) and 0.5 l of reverse transcriptase were combined in a 10 l reaction volume (using a buffer: 50 mM Tris-HCl, 75 mM KCl, 3 mM MgCl.sub.2, pH 8.3). The reaction was incubated at a designated temperature (e.g., 50 C.) for 90 minutes followed by inactivation step at 72 C. for 10 minutes. After the reaction, incomplete products, full length products, and template switched products were quantified by a capillary electrophoresis assay (see Beckman Coulter (Indianapolis, Ind.) Introduction to Capillary Electrophoresis). The areas under the peak of incompletion, elongation and template switching products were measured. The transcription efficiency equals to the sum of elongation and template switching divided by the sum of incompletion, elongation and template switching. The relationships between the components used in the assay are shown in
(36) Based on the results shown in