VACCINATION WITH ANTI-TICK ANTIGENS TO CONTROL MULTIPLE TICK SPECIES AND DISEASE TRANSMISSION IN WHITE-TAILED DEER AND OTHER HOST ANIMALS

20180085443 ยท 2018-03-29

    Inventors

    Cpc classification

    International classification

    Abstract

    Compositions of either the Rm86Texas protein from a Texas outbreak strain of the southern cattle fever tick, Rhipicephalus microplus, or a nucleic acid construct incorporating a nucleic acid sequence encoding this Rm86Texas protein, are effective for eliciting a protective immune response in non-bovine animals. The Rm86Texas protein is immunogenic and can be administered as a protein vaccine, or in the alternative, the nucleic acid construct can be utilized as a DNA vaccine. Induction of the immune response significantly reduces or eliminates the infestation of treated, non-bovine animals with ticks. Moreover, as ticks are vectors of a variety of pathogens, the reduction in the incidence of tick infestation afforded by the vaccines may concurrently reduce the incidence of diseases caused by these pathogens in susceptible animals.

    Claims

    1. A method of reducing tick infestations in animals comprising administration of a vaccine composition to a non-bovine animal, wherein said vaccine composition comprises an immunogenic Rm86Texas protein and a pharmaceutically acceptable carrier, and wherein said Rm86Texas protein is in an amount effective to stimulate an immune response in said animal to said tick.

    2. The method of claim 1 wherein said Rm86Texas protein comprises amino acids 17-624 of SEQ ID: 1.

    3. The method of claim 1, wherein said animal is selected from the group consisting of canines, felines, equine, and Cervidae.

    4. The method of claim 3, wherein said animal is selected from the group consisting of domestic cats, domestic dogs, and deer.

    5. The method of claim 4, wherein said animal is a deer.

    6. The method of claim 5, wherein said animal is one of a white-tailed deer or a red deer.

    7. The method of claim 1, wherein said tick is Rhipicephalus microplus.

    8. The method of claim 1, wherein said tick is selected from the group consisting of Ixodes scapularis and Amblyomma americanum.

    9. The method of claim 3, wherein said tick is selected from the group consisting of Ixodes scapularis and Amblyomma americanum.

    10. The method of claim 4, wherein said tick is selected from the group consisting of Ixodes scapularis and Amblyomma americanum.

    11. The method of claim 5, wherein said tick is selected from the group consisting of Ixodes scapularis and Amblyomma americanum.

    12. The method of claim 1, wherein said vaccine composition further comprises an adjuvant.

    13. A method of reducing the incidence of tick infestations in animals, comprising administering a vaccine composition to a non-bovine animal, wherein said vaccine composition comprises the nucleic acid construct and a pharmaceutically acceptable carrier, and wherein said nucleic acid construct comprises a nucleic acid sequence encoding an Rm86Texas protein, operatively linked to one or more expression control sequences, and is administered in an amount effective to stimulate an immune response in said animal to said tick.

    14. The method of claim 13, wherein said nucleic acid sequence encodes said Rm86Texas protein comprising amino acids 17-624 of SEQ ID: 1.

    15. The method of claim 13, wherein said animal is selected from the group consisting of canines, felines, equine, and Cervidae.

    16. The method of claim 15, wherein said animal is selected from the group consisting of domestic cats, domestic dogs, and deer.

    17. The method of claim 16, wherein said animal is a deer.

    18. The method of claim 13, wherein said tick is Rhipicephalus microplus.

    19. The method of claim 13, wherein said tick is selected from the group consisting of Ixodes scapularis and Amblyomma americanum.

    20. The method of claim 15, wherein said tick is selected from the group consisting of Ixodes scapularis and Amblyomma americanum.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0014] Advantages of embodiments of the present invention will be apparent from the following detailed description of the exemplary embodiments. The following detailed description should be considered in conjunction with the accompanying figures in which:

    [0015] FIG. 1 shows the amino acid sequence of Rm86Texas compared to BM86, as developed in Australia (Bm86TICK) and Cuba (Bm86GAV).

    [0016] FIG. 2 shows the sequence of Rm86Texas, as used in an exemplary embodiment of the present invention.

    [0017] FIG. 3 shows Western blots of the purification of Rm86Texas as expressed in Pichia pastoris.

    [0018] FIG. 4 shows flow cytometry analysis of changes in T cell subsets, B cells, macrophages, and Rm86Texas-specific B cells of white-tailed deer following vaccination.

    [0019] FIG. 5 shows ELISA titers of Rm86Texas-specific antibodies in vaccinated deer and in a control group.

    [0020] FIG. 6 shows peptide microarrays following incubation with pre- and post-vaccination serum.

    SEQUENCE LISTING

    [0021] The Sequence Listing submitted via EFS-Web as an ASCII compliant text file format (.txt) filed Sep. 18, 2017, named Sequence_Listing-016315 (created on Sep. 12, 2017, 12 kb), is hereby incorporated herein by reference in its entirety. This Sequence Listing serves as paper copy of the Sequence Listing required by 37 C.F.R. 1.821(c) and the Sequence Listing in computer-readable form (CRF) required by 37 C.F.R. 1.821(e). A statement under 37 C.F.R. 1.821(f) is not necessary.

    SEQUENCES

    [0022] The invention can be more fully understood from the following detailed description and the accompanying sequence descriptions, which form a part of this application.

    TABLE-US-00001 SEQIDNO:1 MRGIALFVAAVSLIVECTAESSICSDFGNEFCRNAECEVVPGAED DFVCKCPRDNMYFNAAEKQCEYKDTCKTRECSYGRCVESNPSKGSCVCE ASDDLTLQCKIKNDFATDCRNRGGTAKLRTDGFIGATCDCGEWGAMNKT TRNCVPTTCLRPDLTCKDLCEKNLLQRDSRCCQGWNTANCSAAPPADSY CSPGSPKGPDGQCKNACRTKEAGFVCKHGCRSTDKAYECTCPSGSTVAE DGITCKSISYTVSCTVEQKQTCRPTEDCRVQKGTVLCECPWNQHLVGDT CISDCVDKKCHEEFMDCGVYMNRQSCYCPWKSRKPGPNVNINECLLNEY YYTVSFTPNISFDSDHCKRYEDRVLEAIRTSIGKEVFKVEILNCTQDIK ARLIAEKPLSKYVLRKLQACEHPIGEWCMMYPKLLIKKNSATEIEEENL CDSLLKNQEAAYKGQNKCVKVDNLFWFQCADGYTTTYEMTRGRLRRSVC KAGVSCNENEQLECANKGQICVYENGKANCQCPPDTKPGEIGCIERTTC NPKEIQECQDKKLECVYKNHKAECKCPDDHECSREPAKDSCSEEDNGKC QSSGQRCVMENGNAVCKEKSDATTASTTTTKAKDKDPDPEKSSAAAVSA TGLLLLLAATSVTAASLcomprisestheRm86Texasprotein openreadingframe. SEQIDNO:2 MGGIALFVAAVSLIVECTAESSICSDFGNEFCRNAECEVVPGAED DFVCKCPRDNMYFNAAEKQCEYKDTCKTRECSYGRCVESNPSKGSCVCE ASDDLTLQCKIKNDFATDCRNRGGTAKLRTDGFIGATCDCGEWGAMNKT TRNCVPTTCLRPDLTCKDLCEKNLLQRDSRCCQGWNTANCSAAPPADSY CSPGSPKGPDGQCKNACRTKEAGFVCKHGCRSTDKAYECTCPSGSTVAE DGITCKSISYTVSCTVEQKQTCRPTEDCRVQKGTVLCECPWNQHLVGDT CISDCVDKKCHEEFMDCGVYMNRQSCYCPWKSRKPGPNVNINECLLNEY YYTVSFTPNISFDSDHCKRYEDRVLEAIRTSIGKEVFKVEILNCTQDIK ARLIAEKPLSKYVLRKLQACEHPIGEWCMMYPKLLIKKNSATEIEEENL CDSLLKNQEAAYKGQNKCVKVDNLFWFQCADGYTTTYEMTRGRLRRSVC KAGVSCNENEQLECANKGQICVYENGKANCQCPPDTKPGEIGCIERTTC NPKEIQECQDKKLECVYKNHKAECKCPDDHECSREPAKDSCSEEDNGKC QSSGQRCVMENGNAVCKEKSDATTASTTTTKAKDKDPDPEKSSAAAVSA TGLLLLLAATSVTAASLRPPAYVEQKLISEEDLNSAVDHHHHHHis theRm86Texasproteinoptimizedforexpression inayeastvector.

    Definitions

    [0023] Aspects of the invention are disclosed in the following description and related drawings directed to specific embodiments of the invention. Alternate embodiments may be devised without departing from the spirit or the scope of the invention. Additionally, well-known elements of exemplary embodiments of the invention will not be described in detail or will be omitted so as not to obscure the relevant details of the invention. Further, to facilitate an understanding of the description discussion of several terms which may be used herein follows.

    [0024] As used herein, the word exemplary means serving as an example, instance or illustration. The embodiments described herein are not limiting, but rather are exemplary only. It should be understood that the described embodiment are not necessarily to be construed as preferred or advantageous over other embodiments. Moreover, the terms embodiments of the invention, embodiments or invention do not require that all embodiments of the invention include the discussed feature, advantage or mode of operation.

    [0025] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention belongs. As used herein, the term about refers to a quantity, level, value, or amount that varies by as much as 30%, preferably by as much as 20%, and more preferably by as much as 10% to a reference quantity, level, value, or amount. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are now described.

    [0026] Cloning. The selection and propagation of (a) genetic material from a single individual, (b) a vector containing one gene or gene fragment, or (c) a single organism containing one such gene or gene fragment.

    [0027] Cloning Vector. A plasmid, virus, retrovirus, bacteriophage or nucleic acid sequence which is able to replicate in a host cell, characterized by one or a small number of restriction endonuclease recognition sites at which the sequence may be cut in a predetermined fashion, and which contains a marker suitable for use in the identification of transformed cells, e.g., uracil utilization, tetracycline resistance, ampicillin resistance. A cloning vector may or may not possess the features necessary for it to operate as an expression vector.

    [0028] Codon. A DNA sequence of three nucleotides (a triplet) which codes (through mRNA) for an amino acid, a translational start signal, or a translational termination signal. For example, the nucleotide triplets TTA, TTG, CTT, CTC, CTA, and CTG encode for the amino acid leucine, while TAG, TAA, and TGA are translational stop signals, and ATG is a translational start signal.

    [0029] Complement or Complementary Sequence. The product of complementary base pairing in which purines bond with pyrimidines, as it occurs in the two polynucleotide chains of DNA (adenine with thymine, guanine with cytosine) and between DNA and messenger RNA nucleotides during transcription.

    [0030] DNA Coding Sequence. A DNA sequence which is transcribed and translated into a polypeptide in vivo when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a start codon at the 5 (amino) terminus and a translation stop codon at the 3 (carboxy) terminus. A coding sequence can include, but is not limited to, prokaryotic sequences and cDNA from eukaryotic mRNA. A polyadenylation signal and transcription termination sequence will usually be located 3 to the coding sequence.

    [0031] DNA Sequence. A linear series of nucleotides connected one to the other by phosphodiester bonds between the 3 and 5 carbons of adjacent pentoses.

    [0032] Effective Amount. Such amount as is capable of performing the function of the compound or property for which an effective amount is expressed. As will be pointed out below, the exact amount required will vary from process to process, depending on recognized variables such as the compounds employed and the processing conditions observed. Thus, it is not possible to specify an exact effective amount. However, an appropriate effective amount may be determined by one of ordinary skill in the art using only routine experimentation. Expression. The process undergone by a structural gene to produce a polypeptide. Expression requires both transcription of DNA and translation of RNA.

    [0033] Expression Vector. A replicon such as a plasmid, virus, retrovirus, bacteriophage, or nucleic acid sequence which is able to replicate in a host cell, characterized by a restriction endonuclease recognition site at which the sequence may be cut in a predetermined fashion for the insertion of a heterologous DNA sequence. An expression vector has a promoter positioned upstream of the site at which the sequence is cut for the insertion of the heterologous DNA sequence, the recognition site being selected so that the promoter will be operatively associated with the heterologous DNA sequence. A heterologous DNA sequence is operatively associated with the promoter in a cell when RNA polymerase, which binds the promoter sequence transcribes the coding sequence into mRNA which is then in turn translated into the protein encoded by the coding sequence.

    [0034] Fusion Protein. A protein produced when two heterologous genes or fragments thereof coding for two different proteins not found fused together in nature are fused together in an expression vector. For the fusion protein to correspond to the separate proteins, the separate DNA sequences must be fused together in the correct translational reading frame.

    [0035] Gene. A segment of DNA which encodes a specific protein or polypeptide, or RNA.

    [0036] Genome. The entire DNA of an organism. It includes, among other things, the structural genes encoding for the polypeptides of the substance, as well as operator, promoter and ribosome binding and interaction sequences.

    [0037] Heterologous DNA. A DNA sequence inserted within or connected to another DNA sequence which codes for polypeptides not coded for in nature by the DNA sequence to which it is joined. Allelic variations or naturally occurring mutational events do not give rise to a heterologous DNA sequence as defined herein.

    [0038] Hybridization. The pairing together or annealing of single stranded regions of nucleic acids to form double-stranded molecules.

    [0039] Nucleotide. A monomeric unit of DNA or RNA consisting of a sugar moiety (pentose), a phosphate, and a nitrogenous heterocyclic base. The base is linked to the sugar moiety via the glycosidic carbon (1 carbon of the pentose) and that combination of base and sugar is a nucleoside. The base characterizes the nucleotide. The four DNA bases are adenine (A), guanine (G), cytosine (C), and thymine (T). The four RNA bases are A, G, C, and uracil (U).

    [0040] Phage or Bacteriophage. Bacterial virus many of which include DNA sequences encapsidated in a protein envelope or coat (capsid). In a unicellular organism, a phage may be introduced by a process called transfection.

    [0041] Plasmid. A non-chromosomal double-stranded DNA sequence comprising an intact replicon such that the plasmid is replicated in a host cell. When the plasmid is placed within a unicellular organism, the characteristics of that organism may be changed or transformed as a result of the DNA of the plasmid. A cell transformed by a plasmid is called a transformant.

    [0042] Polypeptide. A linear series of amino acids connected one to the other by peptide bonds between the alpha-amino and carboxy groups of adjacent amino acids.

    [0043] Promoter. A DNA sequence within a larger DNA sequence defining a site to which RNA polymerase may bind and initiate transcription.

    [0044] Reading Frame. The grouping of codons during translation of mRNA into amino acid sequences. During translation the proper reading frame must be maintained. For example, the DNA sequence may be translated via mRNA into three reading frames, each of which affords a different amino acid sequence.

    [0045] Recombinant DNA Molecule. A hybrid DNA sequence comprising at least two DNA sequences, the first sequence not normally being found together in nature with the second.

    [0046] Ribosomal Binding Site. A nucleotide sequence of mRNA, coded for by a DNA sequence, to which ribosomes bind so that translation may be initiated. A ribosomal binding site is required for efficient translation to occur. The DNA sequence coding for a ribosomal binding site is positioned on a larger DNA sequence downstream of a promoter and upstream from a translational start sequence.

    [0047] Start Codon. Also called the initiation codon, is the first mRNA triplet to be translated during protein or peptide synthesis and immediately precedes the structural gene being translated. The start codon is usually AUG, but may sometimes also be GUG.

    [0048] Stringent Hybridization Conditions. The term stringent conditions or stringent hybridization conditions includes reference to conditions under which a probe will hybridize to its target sequence, to a detectably greater degree than to other sequences (e.g., at least 2-fold over background). Stringent conditions are sequence-dependent and will differ in different circumstances. By controlling the stringency of the hybridization and/or washing conditions, target sequences can be identified which are 100% complementary to the probe (homologous probing). Alternatively, stringency conditions can be adjusted to allow some mismatching in sequences so that lower degrees of similarity are detected (heterologous probing). Generally, a probe is less than about 1000 nucleotides in length, optionally less than 500 nucleotides in length. It is also understood that due to the advances in DNA PCR and sequencing approaches that issues of gene identity and homology may be determined by sequence based rather than hybridization approaches.

    [0049] Structural Gene. A DNA sequence which encodes through its template or messenger RNA (mRNA) a sequence of amino acids characteristic of a specific polypeptide.

    [0050] Substantially Pure. The condition of a compound, such as a protein or a nucleotide, being cell free or being separated from other components that would interfere with or have a substantial qualitative effect on the activity of the compound or on a substrate on which the compound acts.

    [0051] Transform. To change in a heritable manner the characteristics of a host cell in response to DNA foreign to that cell. An exogenous DNA has been introduced inside the cell wall or protoplast. Exogenous DNA may or may not be integrated (covalently linked) to chromosomal DNA making up the genome of the cell. In prokaryotes and some fungi, for example, the exogenous DNA may be maintained on an episomal element such as a plasmid. With respect to most eukaryotic cells, a stably transformed cell is one in which the exogenous DNA has been integrated into a chromosome so that it is inherited by daughter cells through chromosome replication. This stability is demonstrated by the ability of the eukaryotic cell to establish cell lines or clones comprised of a population of daughter cells containing the exogenous DNA.

    [0052] Transcription. The process of producing mRNA from a structural gene.

    [0053] Translation. The process of producing a polypeptide from mRNA.

    [0054] Vaccine. Vaccine is defined herein in its broad sense to refer to any type of biological agent in an administrable form capable of stimulating a protective immune response in an animal inoculated with the vaccine. For purposes of this invention, the vaccine may comprise either one or more of the immunogenic (antigenic) proteins or nucleic acid constructs encoding these proteins.

    [0055] Further, other compounds may be added to the composition provided they do not substantially interfere with the intended activity and efficacy of the composition; whether or not a compound interferes with activity and/or efficacy can be determined, for example, by the procedures utilized below.

    [0056] The amounts, percentages, and ranges disclosed herein are not meant to be limiting, and increments between the recited amounts, percentages, and ranges are specifically envisioned as part of the invention.

    DETAILED DESCRIPTION

    [0057] At least one of the immunogenic proteins which is utilized herein is the recombinant antigen Rm86Texas, derived from the Bm86 sequence variant of a Texas outbreak population of R. microplus, in white-tailed deer. The Bm86 protein is located on the microvilli of the tick gut digestive cells. The recombinant antigen was formulated with an oil-based adjuvant for use in a vaccine trial to compare the immune response of white-tailed deer immunized with the Rm86Texas plus adjuvant to other white-tailed deer injected with adjuvant alone.

    [0058] The Rm86Texas protein fragment of the cattle tick, R. microplus, has been isolated, substantially free from other proteins or cell components which are normally present in the cells of the tick, such that the protein is the only significant immunogen in the sample and may be used effectively as a vaccine. Moreover, the protein has been produced in recombinant form as described herein below. The term isolated encompasses not only proteins which have been recovered from naturally occurring cells, but also recombinant proteins and synthesized proteins. The Rm86Texas protein fragments, including recombinants, are immunogenic, effective for eliciting a protective immune response against ticks including the cattle tick and others, which response is mediated by humoral, i.e., antibodies, and/or cellular processes.

    [0059] It is envisioned that the Rm86Texas protein may be synthesized by any suitable method well known to those skilled in the art of peptide synthesis, such as exclusively solid-phase techniques, partial solid-phase techniques, fragment condensation, or classical solution addition. For example, without being limited thereto, suitable solution phase synthesis methods are described by Finn and Hoffman [in Proteins, Vol. 2, 3rd Ed., H. Neurath and R. L. Hill (eds.), Academic Press, New York, pp. 105-253 (1976)], while solid phase synthesis methods are described by Barany and Merrifield [in The Peptides, Vol. 2, E. Gross and J. Meienhofer (eds.), Academic Press, New York, pp. 3-284 (1979)], and stepwise solid phase synthesis methods are described by Merrifield [in J. Am. Chem. Soc. 85: 2149-2154 (1963)], the contents of each of which are incorporated herein by reference. However, the protein is preferably produced by recombinant DNA techniques which are particularly suitable for large-scale use. Without being limited thereto, nucleotide sequences encoding the protein which are preferred for use in recombinant DNA techniques are described in detail below. The synthetic protein may be obtained by transforming a microorganism using an expression vector including a promoter or operator, or both, together with the Rm86Texas structural gene and causing such transformed microorganisms to express the protein.

    [0060] The gene encoding the Rm86Texas protein has also been isolated and sequenced, as described below. As used herein, isolated nucleic acid sequences refer to sequences which have been substantially separated from other nucleic acids or cell components which are normally present in the cells of the tick, such that the Rm86Texas encoding sequences are the only significant sequences in the sample that can be used to express or produce the protein in a host cell as described below. The term encompasses not only nucleic acid sequences which have been recovered from naturally occurring cells, but also recombinant or cloned nucleic acid sequences, and synthesized nucleic acid sequences. The nucleic acid sequences may be recovered from cells of R. microplus, for example, by constructing a genomic DNA or cDNA library and screening for the Rm86Texas protein nucleic acid using the disclosed sequences as probes. However, in a preferred embodiment, the sequences are synthesized using techniques established in the art for automated DNA synthesis or amplification. As used herein, the nucleic acid sequences of the Rm86Texas protein encompass either or both of the coding strand or its complement.

    [0061] As noted herein, the amino acid sequence of the Rm86Texas protein may be modified to assist cloning in the selected vector, and may further include optional, additional terminal amino acid sequences from the vector (not of tick origin). Thus, the nucleic acid sequence may be modified to reflect these changes.

    [0062] In addition, because of the degeneracy of the genetic code, there exists a finite set of nucleotide sequences which can code for a given amino acid sequence. Consequently, nucleic acids may be identical in sequence to the sequence which is naturally occurring or they may include alternative codons which encode the same amino acid as that which is found in the naturally occurring sequence. Furthermore, nucleic acids may include codons which represent conservative substitutions of amino acids as are well known in the art. Moreover, because of the degeneracy of the genetic code, different species can preferentially use different codons to code for the same amino acid and significant differences in tRNA abundance can exist. Translation of recombinant proteins can often be enhanced by optimizing codon usage to the preferred codons used by the expression species. For example, in the yeast P. pastoris the amino acid arginine is encoded by the nucleotide triplet of AGA approximately 10 times more frequently than by the nucleotide triplet of CGG. Substitution of CGG triplets with AGA in a R. microplus protein coding region used in a recombinant P. pastoris expression system would be expected to enhance recombinant protein expression levels. It is understood that all such equivalent sequences are operable variants of the disclosed sequences, since all give rise to the same Rm86Texas protein (i.e., the same amino acid sequence) during in vivo transcription and translation, and are hence encompassed herein. Without being limited thereto, an example of a codon-optimized sequence which would be suitable for enhancing translation of the Rm86Texas protein fragment in P. pastoris are shown in FIG. 2(B). The sequence of FIG. 2(B), known as SEQ ID NO: 2 corresponds to the sequence of FIG. 2(A), known as SEQ ID NO: 1, which has been optimized to enhance translation in P. pastoris. DNA sequences which contain significant sequence similarity to the coding regions of the nucleotide sequence of SEQ ID NO: 2 are also encompassed by the invention. As defined herein, two DNA sequences contain significant sequence similarity when at least 85% (preferably at least 90% and most preferably 95%) of the nucleotides match over the defined length of the sequence. Sequences that are significantly similar can be identified in a Southern hybridization experiment under stringent hybridization conditions as is known in the art.

    [0063] Any one or combinations of the isolated cDNA nucleic acid sequences encoding the Rm86Texas protein may be cloned into any suitable vector for subsequent use as either a DNA vaccine or for the production of recombinant Rm86Texas protein. For use as a DNA vaccine, the nucleic acid constructs comprising the nucleic acid sequences encoding the Rm86Texas protein are administered to a subject animal such that the protein is expressed in vivo within the cells of the vaccinated animal. Similarly, where the object is the production of recombinant protein, the nucleic acid constructs are used for the transformation of a microorganism and causing such transformed microorganism to express the protein in vitro.

    [0064] A variety of vectors are suitable for use herein, and are selected to be operable as cloning vectors or expression vectors in the selected host cell, although expression vectors are preferred. Numerous vectors are known to practitioners skilled in the art, and selection of an appropriate vector and host cell is a matter of choice. The vectors may, for example, be bacteriophage, plasmids (including linearized or circular plasmids), viruses or hybrids thereof, such as those described in Ausubel et al. (Current Protocols in Molecular Biology, John Wiley & Sons, Inc, 1995), the contents of which are herein incorporated by reference. Further, the vectors may be non-fusion vectors (i.e., those producing the proteins of the invention not fused to any heterologous polypeptide), or alternatively, fusion vectors (i.e., those producing the proteins fused to a vector encoded polypeptide). The fusion proteins would of course vary with the particular vector chosen. In accordance with a preferred embodiment, and particularly for applications as DNA vaccines, the vectors are eukaryotic expression vectors, most preferably plasmids. Particularly preferred plasmids for use herein include plasmids commercially available from Invitrogen Inc., Carlsbad, Calif. for both the DNA vaccine and recombinant protein vaccine protocols. The pcDNA 4/myc 5.1 kb vectors are designed for overproduction of recombinant proteins in mammalian cells. This plasmid contains a human cytomegalovirus immediate-early (CMV) promoter for high-level expression, a c-myc epitope and 6His metal-binding peptide tag for facilitating protein purification and verification, and a Zeocin antibiotic resistance marker gene coding region for selection purposes. The preferred plasmids used to produce recombinant protein may be the pPICZ and pPICZ from Invitrogen Inc. Both plasmids contain the AOX1 gene promoter for methanol-inducible high-level expression in Pichia pastoris, a c-myc epitope and 6His metal-binding peptide tag for facilitating protein purification and verification, and a Zeocin antibiotic resistance marker gene coding region for selection purposes. The pPICZ also contains a native Saccharomyces cerevisiae -factor secretion signal.

    [0065] Regardless of the specific vector utilized, various sites may be selected for insertion of the isolated nucleotide sequences. These sites are usually designated by the restriction enzyme or endonuclease that cuts them.

    [0066] The particular site chosen for insertion of the selected nucleotide sequences into the vector to form a recombinant vector is determined by a variety of factors. These include size and structure of the protein to be expressed, susceptibility of the desired protein to enzymatic degradation by the host cell components and contamination by its proteins, expression characteristics such as the location of start and stop codons, and other factors recognized by those skilled in the art. None of these factors alone absolutely controls the choice of insertion site for a particular polypeptide. Rather, the site chosen reflects a balance of these factors, and not all sites may be equally effective for a given protein.

    [0067] The nucleotide sequences comprising the Rm86Texas protein encoding gene may be inserted into the desired vector by known techniques. If, however, the vector is to serve as an expression vector, the vector should have a promoter effective for expression in the selected host cell, and the DNA sequences should be inserted in the vector downstream of the promoter and operationally associated therewith (that is, the promoter should be recognized by the RNA polymerase of the host cell). In addition, the vector should have a region which codes for a ribosome binding site positioned between the promoter and the site at which the DNA sequence is inserted so as to be operatively associated with the DNA sequence of the invention once inserted (in correct translational reading frame therewith). Preferably, the vector should be selected to provide a region which codes for a ribosomal binding site recognized by the ribosomes of the host cell into which the vector is to be inserted. The vector should contain a terminator with necessary 3 untranslated sequences for RNA termination, stability, and/or poly(A) tail addition (if eukaryotic). Alternatively, any or all of the above control sequences may be ligated to the coding sequence prior to insertion into the vector.

    [0068] For use in animal vaccinations, the isolated Rm86Texas protein, or the nucleic acid constructs comprising the nucleic acid sequences encoding this protein, will typically be formulated in conjunction with a suitable pharmaceutically acceptable carrier or diluent as is known in the art, including, but not limited to, physiological saline, mineral oil, vegetable oils, aqueous carboxymethyl cellulose or polyvinylpyrrolidone. The skilled practitioner will recognize that such carriers should of course be compatible with the protein or nucleic acid constructs. Because Rm86Texas may precipitate in the presence of aqueous buffers such as Phosphate-Buffered Saline (PBS), in a preferred embodiment the Rm86Texas is stored in a non-polar solvent or oil. A variety of non-polar solvents are suitable for use herein. The concentration and amount of the protein or nucleic acid constructs in the final composition may vary depending upon the desired use and type of response needed, and the host animal. In any event, the protein or nucleic acid constructs should be provided in an amount effective to induce the preferred response as determined by routine testing.

    [0069] Appropriate adjuvants as known in the art may also be included in the formulation. As described herein, adjuvants include agents (a compound or combination of compounds) capable of enhancing either or both of a humoral (antibody) immunity response or a cell-mediated immunity response in the treated animal against the target tick. Without being limited thereto, suitable adjuvants include but are not limited to one or more of mineral oil, vegetable oils, aluminum salts such as alum, water-in-oil adjuvants such as Freund's incomplete adjuvant, oil-in-water emulsions such as MF59 (Novartis, Switzerland), liposomes, virosomes, microparticles or nanoparticles or beads of biocompatible matrix materials such as (although not limited to) agar or polyacrylate, saponin-based adjuvants (such as QA-21 or QS-21 marketed by Antigenics, Lexington, Mass.), toll-like receptor (TLR) agonists such as 3-O-desacyl-4-monophosphoryl lipid A (MPL) and immunostimulatory sequences (ISS) of microbial DNA, imidazoquinolines, immune stimulating complexes (ISCOMs and ISCOMATRIXs), and other agents such as described by Leroux-Roels (2010. Vaccine. 285:C25-C36, the contents of which are incorporated by reference herein). In accordance with an optional embodiment, other known immunogenic agents used in conventional vaccines for the animal of interest may also be included in the formulation. For example, additional immunogenic agents may be an attenuated or inactivated form of a pathogen, or subunits thereof. Without being limited thereto, these pathogens include, for example, one or more of the rabies virus, Borrelia burgdorferi, canine distemper virus, canine parvovirus, canine adenovirus, canine corona virus, canine herpesvirus, Giardia spp., Leptospira interrogans, Babesia canis, Hepatozoon canis, Dipylidium caninum, Isospora spp, and other proteins of R. microplus.

    [0070] The immunogenic Rm86Texas protein or the nucleic acid constructs comprising the nucleic acid sequences encoding this protein may be administered in an amount effective to reduce or eliminate the incidence of infestation of the treated animal with a specific target tick. As noted hereinabove, the administration of the Rm86Texas protein, or the nucleic acid constructs comprising the nucleic acid sequences encoding this protein (such that the nucleic acid sequences are expressed and the encoded protein is produced in vivo in the cells of the vaccinated animal), stimulates an immune response in the animal. Thus, as used herein, an effective amount of Rm86Texas protein or the nucleic acid constructs comprising the nucleic acid sequences encoding this protein, is preferably defined as that amount which will elicit a protective immune response against the target tick, which may be either or both of antibody production against the protein or a cell-mediated immune response against the tick, in a treated animal in comparison to an untreated control animal. In a preferred embodiment, an immune response may be demonstrated by production of antibodies against the Rm86Texas protein, by a significant reduction in the percentage of animals infested with the target tick, by a significant reduction in the average number of target ticks on animals, or by a significant reduction in the number of viable eggs or offspring produced by the target ticks present on animals, all in vaccinated animals as compared to an unvaccinated control group (measured at a confidence level of at least 70%, preferably measured at a confidence level of 90%). The actual effective amount will of course vary with the specific vaccine component (protein vaccine or DNA vaccine), the particular animal of interest and its age and size, and the route of administration, and may be readily determined empirically by the practitioner skilled in the art using an antigen dose response assay. By way of example and without being limited thereto, for vaccines administered to small animals (such as dogs and cats) by subcutaneous or intramuscular injection, or with a needle-less device, it is envisioned that typical doses of protein vaccine, may be greater than 0.3 g protein/animal/dose, preferably between about 0.3 to 1.75 g protein/animal/dose, while typical doses of DNA vaccine (nucleic acid constructs) may be greater than 100 g of DNA construct/animal/dose, preferably between about 300 to 800 g DNA construct/animal/dose. For vaccines administered to large animals (such as deer and horses) by subcutaneous or intramuscular injection, or with a needle-less device, it is envisioned that typical doses of protein vaccine, may be greater than 10 g protein/animal/dose, preferably between about 50 to 150 g protein/animal/dose, while typical doses of DNA vaccine (nucleic acid constructs) may be greater than 100 g of DNA construct/animal/dose, preferably between about 300 to 800 g DNA construct/animal/dose.

    [0071] The vaccines (Rm86Texas protein or the nucleic acid constructs comprising the nucleic acid sequences encoding this protein) may be used for the treatment of a broad spectrum of wild or domesticated animals, ranging from pets and companion animals to livestock and large domestic or wild animals. Without being limited thereto, the vaccines are preferably used for the treatment of Cervidae, equine, canines and felines, rodents, and particularly deer (including white-tailed deer and red deer), horses, domestic dogs and cats, and the white-footed mouse. The vaccines may be effectively administered any time after the animal attains immunocompetence. The vaccines may be administered to the subject animal by any convenient route which enables an immune response. However, parenteral injection (e.g., subcutaneous, intravenous, or intramuscular) may be preferred, with intradermal injection being particularly preferred for administration of the DNA vaccines and subcutaneous or intramuscular injection being particularly preferred for administration of the protein vaccines. The vaccine products could also be administered using a needle-less device. In some preferred embodiments, the vaccine may also be administered orally. The vaccine may be administered in a single dose or in a plurality of doses. Dependent upon rearing conditions, the vaccine may be administered in multiple doses, the timing of which may be readily determined by the skilled artisan.

    [0072] Where the nucleic acid constructs are to be employed for the production of recombinant Rm86Texas protein, a variety of vector-host cell expression systems may be employed. Strains of yeast, particularly Pichia pastoris, are preferred. However, the novel invention described here can be applied with numerous host cells that would desirable. Host strains may be of bacterial, fungal, insect cell line, plant, or yeast origin. Ascertaining the most appropriate host-vector system is within the skill of the person in the art.

    [0073] DNA constructs may be introduced into the appropriate host cell by numerous methods described in the technical and scientific literature. Transformation of bacteria, yeast, or filamentous fungi may be performed using standard techniques. In general, linear or circular DNA constructs may be introduced into the host cell by techniques utilizing protoplast fusion, polyethylene glycol, liposomes, lithium acetate, electroporation, physical damage, biolistic bombardment, or Agrobacterium mediated transformation.

    [0074] Successful transformants may be isolated by using markers, contained on the expression vectors, which confer a selectable trait to the transformed host cell. These may include nutritional selection related to substrate utilization (such as, growth on acetamide containing medium) or prototrophy of a required growth product (such as, arginine, leucine, or uracil). Dominant selectable markers [such as, resistance to ampicillin, G418, hygromycin, and phleomycin, and Zeocin (a composition of bleomycin and phleomycin, Invitrogen, Grand Island, N.Y.)] are also useful in selecting transformants that have taken up the introduced DNA construct.

    [0075] The DNA construct may be replicated autonomously or integrated into the genome of the host cell. Integration typically occurs by homologous recombination (for example, arginine selectable marker integrating in the chromosomal arginine gene) or at a chromosomal site unrelated to any genes on the DNA construct. Integration may occur by either a single or double cross-over event. It is also possible to have any number of these integration and replication types occurring in the same transformant.

    [0076] The following exemplary method is intended only to further illustrate the invention and is not intended to limit the scope of the invention which is defined by the claims.

    Exemplary Method for Producing Rm86Texas Antigen

    [0077] The Rm86Texas antigen-encoding sequence was discovered, cloned, and expressed as a recombinant protein in the yeast Pichia pastoris using protocols as described in Guerrero et al. (Guerrero F D, Andreotti R, Bendele K G, Cunha R C, Miller R J, Yeater, K et al. Rhipicephalus (Boophilus) microplus aquaporin as an effective vaccine antigen to protect against cattle tick infestations. Parasites Vect 2014; 7:475), the entirety of which is incorporated herein by reference. One hundred larvae from the f37 generation of the Deutsch R. microplus strain laboratory colony were collected, frozen while alive, and stored in cold RNAlater-ICE (Ambion, Austin, Tex., USA). The Deutsch strain was started from a few individual engorged females collected from a 2001 R. microplus outbreak in Webb County, Tex., USA. Total RNA was isolated from 100 larvae using the ToTALLY RNA kit (Ambion) per the manufacturer's protocol. One microgram of total RNA was used to make single stranded cDNA with the SuperScript III First-Strand Synthesis System kit (Life Technologies, Grand Island, N.Y., USA), designing primers from the complete coding sequence of Bm86 (GenBank Accession No. M29321.1) using Primer3Plus. The Advantage 2 PCR kit (Clontech Laboratories Inc.) was used to amplify the target region using a two-step PCR protocol, which was 95 C. for 1 min, followed by 30 cycles of 95 C. for 30 sec and 68 C. for 2 min, and a final extension time of 3 min at 68 C. The cDNA was diluted to 1:100 for a 50 l PCR reaction using Bm86 forward 5-ATGCGTGGCATCGCTTTGTT-3 and Bm86 reverse 5-GGTGTTCGATGTAAGCGTGATG-3 primers (Sigma-Aldrich, The Woodlands, Tex., USA). PCR products were fractionated by agarose gel electrophoresis and post-stained using GelStar Nucleic Acid Gel Stain (Lonza Rockland, Inc.). The expected 965 bp DNA amplicon was excised from the gel and extracted and purified using the QIAquick Gel Extraction Kit (Qiagen, Valencia, Calif., USA) according to the manufacturer's protocol. The DNA was concentrated using Pellet Paint Co-Precipitant (Novagen/EMD Chemicals Inc., Gibbstown, N.J., USA), polished, ligated and transformed into XL10 Gold Kan Ultracompetent Escherichia coli cells using the PCR Script Amp Cloning Kit (Stratagene/Agilent Technologies Inc., Santa Clara, Calif., USA). Individual clones were screened via PCR using internal vector primers and clones producing the expected sized product were used for plasmid DNA preparations with the QIAprep Spin Miniprep Kit (Qiagen) according to manufacturer's instructions. Plasmid DNAs were sequenced on a 3130xl Genetic Analyzer (Applied Biosystems, Foster City, Calif., USA), using vector and internal sequencing primers such that identities of each nucleotide could be verified on both strands to produce a high quality sequence. Sequences were assembled and analyzed using MacVector with Assembler version 10.0.2 (MacVector Inc., Cary, N.C., USA).

    [0078] DNA was then prepared for ligation into the Pichia pastoris expression vector by restriction enzyme digestion reactions with EcoRI and NotI (Life Technologies) per manufacturer's protocol. The EasySelect Pichia Expression Kit vector pPICZ C (Life Technologies), digested with EcoRI and NotI and purified, was ligated onto the Rm86Texas DNA using T4 DNA Ligase (Life Technologies) using the manufacturer's protocol and 70 ng Rm86Texas insert, 45 ng pPICZ C EcoRI/NotI digested vector, and 2.5 unit T4 DNA ligase incubated for 15 hr at 14 C. Five additional units of T4 DNA Ligase were added and the reaction incubated 1 hr at 14 C. OneShot TOP10 competent cells (Life Technologies) were transformed with ligation reaction and plated on low salt LB agar (1% tryptone, 0.5% yeast extract, 0.5% sodium chloride, 1.5% agar) with 25 g/mL Zeocin (Life Technologies). DNA was isolated from resulting colonies using the QIAprep Spin Miniprep Kit (Qiagen). The sequence of both strands of putative positive clone plasmid DNA was verified by DNA sequencing, followed by analysis with MacVector with Assembler version 10.0.2. Five g of DNA was linearized with SstI (Life Technologies) and used for transformation of freshly prepared electrocompetent P. pastoris GS115 strain according to the EasySelect Pichia Expression Kit instructions. The Bio-Rad Gene Pulser and Pulse Controller was used with 2 mm cuvettes and pulse settings of 1.5 kV, 200 and 25FD. Transformation mixtures were plated on YPDS (1% yeast extract, 2% peptone, 2% dextrose, 1 M sorbitol, 2% agar) plates containing 100 g/mL Zeocin and incubated at 30 C. for 4 days to allow colonies to develop. Selected colonies were Mut phenotyped and small-scale expression experiments used to determine the optimal method and conditions for the expression of the recombinant proteins using BMGH (100 mM potassium phosphate pH=6.0, 1.34% yeast nitrogen base with ammonium sulfate without amino acids, 410.sup.5% biotin, 1% glycerol) and BMMH media (BMGH but substituting 0.5% methanol for the 1% glycerol). BMMH cultures were replenished to 0.5% final methanol concentration every 24 hr. Samples were collected at various time points and centrifuged to separate the yeast cells from the culture media supernatant. Recombinant Rm86Texas was localized in the cell pellet sample with maximal expression seen after 12-19 hr of induction growth in BMMH. Intracellular proteins were purified by a protocol similar to that described in the EasySelect Pichia Expression Kit manual. Briefly, 100 l of breaking buffer (50 mM sodium phosphate pH7.4, 1 mM EDTA, 5% glycerol)+1 FOCUS ProteaseArrest (GBioscience, St. Louis, Mo.) was used per cell pellet from a 1 ml culture sample. An equal volume of 0.5 mm acid-washed glass beads was added and the sample vortexed for 30 sec and set on ice for 30 sec. A total of 8 vortex/ice cycles were used, the sample frozen at 80 C., thawed, and 8 more vortex/ice cycles used before a final short centrifugation to clarify the sample. Samples were concentrated in Amicon Ultracel units (Millipore, Billerica, Mass.) and analyzed by denaturing gel electrophoresis under reducing conditions using the NuPAGE Electrophoresis System and NuPAGE 4-12% Bis-Tris gels in the XCell SureLock Mini-Cell with 1 NuPAGE MOPS SDS Running Buffer (Life Technologies) according to manufacturer's instructions. Proteins were visualized by staining with Coomassie Brilliant Blue R-250 using a modified Fairbank's method. At this stage, protein identity was verified by Western blotting, taking advantage of the c-myc and 6-His tag epitopes on the recombinant protein that are provided by the expression vector sequence. The WesternBreeze Chromogenic Kit and Anti-myc-HRP and Anti-His(C-term)-HRP antibodies (Life Technologies) were utilized with standard protocols provided by the supplier. The supplier-provided alkaline phosphatase-conjugated secondary antibody was utilized to enhance sensitivity.

    [0079] After the optimal clone and growth conditions were determined, a large scale culture of the clone producing the highest amount of recombinant Rm86Texas protein was grown in 25 mL BMGH media in 250 ml baffled flasks in a shaking incubator at 30 C. to an OD.sub.600=2-6. Cells were harvested by centrifugation and resuspended in BMMH to an OD.sub.600=1 and returned to the incubator to induce expression. After 19 hr, cells were harvested by centrifugation and the cell pellet frozen at 80 C. Total yeast intracellular protein was extracted similarly as described above for the small-scale expression cell pellet protocol with the exception of using 50 mL Breaking Buffer with 1 Protease Arrest and 10 cycles of 30 sec vortexing followed by 30 sec on ice. The cell pellet lysates were then frozen at 80 C. overnight and thawed followed by 10 vortex/ice cycles. The protein solution was clarified by centrifugation and the resulting solution concentrated using Centricon Plus-70 Centrifugal Filter Devices (Millipore).

    [0080] Recombinant protein was then purified by native affinity chromatography over a nickel column, making use of the 6-Histidine tag supplied by the vector sequence and the ProBond Purification System (Life Technologies), using ProBond nickel-chelating resin under native conditions according to manufacturer's instructions. The recombinant protein antigen was eluted using 50 mM NaH.sub.2PO.sub.4, 0.5 M NaCl, 0.25 M Imidazole, pH=8.0. Following elution, glycerol was added to the protein solution to a final concentration of 50% (v/v), protein concentration quantified by the BioRad Protein Assay Kit I with bovine plasma gamma globulin protein standards, purity of the protein solution verified by polyacrylamide gel electrophoresis as described above, and the sample stored at 20 C. SDS-polyacrylamide gel electrophoresis showed the protein to be 70-90% pure and the stock concentration was 5 mg/ml. Protein identity was confirmed by Western blotting as described above and mass spectrometry analysis performed by Protea Bioscience Group (Morgantown, W. Va.). Prior to the mass spectrometry analysis, the recombinant protein (in 50% glycerol solution described above) was purified by 1-D acrylamide gel electrophoresis, extracted from the gel matrix, and digested with trypsin. The resulting peptides were analyzed by LC-MS/MS using an ABSciex5500 Series QTRAP for tandem MS data acquisition followed by a search for peptide matches to the expected sequence of purified antigen.

    [0081] A 2022 bp cDNA clone was isolated (GenBank Accession Number KX786647) with the identical sequence as HQ014387 reported by Freeman et al. (Freeman J M, Davey R B, Kappmeyer L S, Kammlah D M, Olafson P U. Bm86 midgut protein sequence variation in South Texas cattle fever ticks. Parasites Vect 2010; 3:101.), the entirety of which is incorporated herein by reference, as Webb1, which was isolated from the f29 generation of a laboratory colony started from an outbreak in Webb County in 2001. Although they did not provide a colony name, it is likely that their colony was the same colony as that currently named as the Deutsch strain, the source for the ticks in our study. The present results indicate that the colony rearing protocols have not introduced any nucleotide changes in the 8 generations since the Webb1 sequence was reported. FIG. 1 shows the amino acids encoded by the translated Rm86Texas sequence and comparisons to the protein coding regions from the Bm86 coding regions that served as the active antigen in the anti-tick vaccines TickGARD (Bm86TICK) and Gavac (Bm86GAV). In FIG. 1, colons are used to indicate identity with the Rm86Texas sequence. The shaded amino acids in the Bm86GAV sequence lines correspond with peptides that Rodriguez et al. (Rodriguez M, Rubiera R., Penichet M, Montesinos R, Cremata J, Falcn V, Snchez G, Bringas R, Cordovs C, Valds M, Lleonart R, Herrera L, De la Fuente J. High level expression of the B. microplus Bm86 antigen in the yeast Pichia pastoris forming highly immunogenic particles for cattle. J Biotech 1994; 33:135-146), the entirety of which is incorporated herein by reference, used for antibody production in their studies and the peptides used in the synthetic peptide anti-tick vaccine reported by Peconick et al. (Peconick A P, Sossai S, Fifo F A, Rodrigues MQRB, Souza e Silva C H, Guzman F, Patarroyo A M, Vargas M I, Patarroyo J H. Synthetic vaccine (SBm7462) against the cattle tick Rhipicephalus (Boophilus) microplus: Preservation of immunogenic determinants in different strains from South America. Exp Parasitol 2008; 119:37-43), the entirety of which is incorporated herein by reference. The underlined amino acids in the Rm86Texas sequence correspond to peptides on the peptide microarrays that reacted with post-vaccination serum from one of the deer in the following study while the bold font indicates reaction with post-vaccination serum from another deer in the aforementioned study. The 2 amino acid regions that are in bold font are the two peptides from the peptide microarray that reacted with serum from both deer. The double underlined amino acids indicate where overlap occurred between reacting peptides to post-vaccination serum from the first deer. There are 23 amino acid differences between the Rm86Texas sequence and the coding region for the Australian Bm86TICK and the Cuban Gavac vaccine antigens. When these two vaccines were discovered and developed, both the Australian cattle tick and those from the Americas were classified as Boophilus microplus. Since then, Boophilus microplus was reclassified as Rhipicephalus (Boophilus) microplus and more recently the Australian populations were reinstated as a separate species, Rhipicephalus australis. The full sequence listing of Rm86Texas, and the sequence used in P. pastoris, are given in FIG. 2.

    [0082] For antigen production purposes in P. pastoris, the Rm86Texas coding region was altered slightly. The second amino acid was changed from R to G to improve the translation initiation sequence surrounding the initiator methionine. Also, the c-myc epitope and a 6-histidine tag was directly added to the C-terminus of the Rm86Texas coding region. This added the sequence RPPAYVEQKLISEEDLNSAVDHHHHHH to the C-terminus. The selected clone for antigen production purposes was a Mutt phenotype and yielded 46 mg/l of Rm86Texas following the affinity chromatography. FIG. 3 shows gel and Western blot analysis results for Rm86Texas. FIG. 3(A) shows proteins extracted from P. pastoris cells prior to (Lane 2; 16 g cell protein extract) and after (Lane 3; 10 g eluted protein) nickel affinity chromatography. The polyacrylamide minigel gel was stained by Coomassie Blue and also contains prestained protein molecular weight standards (Lane 1). The arrow indicates the location of a 119 kDa -galactosidase fusion protein that contains the polyhistidine C-terminus tag and is spiked into the molecular weight standards lane as a positive control for Western blots. FIG. 3(B) shows a Western blot of purified Rm86Texas with Lane 1 containing protein molecular weight standards fused with a polyhistidine tag and Lane 2 containing the same sample as Lane 3 of part A, 10 g eluted nickel-purified Rm86Texas protein, transferred to nitrocellulose, and probed with anti-His antibody. The arrows indicate the LacZ positive control band in Lane 1 and the Rm86Texas in Lane 2 as detected by the anti-His tag antibody. Note that the image brightness of the photographed nitrocellulose blot was altered in order to facilitate viewing these bands as a Figure. The bands were readily visible on the actual blot. The numbers in both A and B indicate the size of each protein standard in kDa. The calculated molecular weight of Rm86Texas as expressed by the pPICZ expression vector was 74.9 kDa and the observed molecular weight in FIG. 2 was 75 kDa.

    Exemplary Method for Vaccine Formulation and Immunization

    [0083] For vaccines, a formulation of 100 g of protein antigen per dose in 2 ml volume of antigen plus adjuvant was used. Other antigen concentrations are also envisioned, as would be recognized by one of ordinary skill in the art. The concentration and dosage amounts given herein are meant to be exemplary, and are not limiting. The adjuvant used was Montanide 71 (Seppic, Fairfield, N.J., USA) and the vaccine was formulated by mixing antigen in the purification buffer and using a syringe mixing technique recommended by the adjuvant supplier to prepare a stable water in oil emulsion. Though a particular adjuvant is used, it is envisioned that any suitable adjuvant could be used to formulate the vaccine, as recognized by one of ordinary skill in the art. The deer were vaccinated intramuscularly into the neck with a 1 inch needle at the start of weeks 1, 4 and 7 with adjuvant alone (group 1, control) and Rm86Texas in adjuvant (group 2). Blood samples were drawn from each deer prior to each vaccination and every four weeks following the third vaccination for 24 weeks. Thirty ml of blood was collected from each deer in three 10 ml aliquots, using a 12.5 ml serum separator tube for serum collection along with two other tubes containing EDTA for flow cytometry analysis. Serum was collected after centrifugation and stored at 80 C. Serum antibody titers were determined using an antigen-specific ELISA developed as described below.

    Determination of T-Cell and B-Cell Response

    [0084] The whole blood samples were lysed and leukocytes labeled with antibody to determine the relative proportions of certain cell subsets and the proportion of antigen-specific B cells via flow cytometry analysis. To obtain leukocytes for staining, 10 ml of whole blood was added to 40 ml lysis solution (1.6 M Ammonium Chloride/0.16 M Tris-C1, pH=7.2) in a 50 ml centrifuge tube and mixed thoroughly until the red blood cells lysed. Tubes were centrifuged at 1700 rpm for 7 min. Supernatant was decanted and cells were resuspended in 50 ml Phosphate-Buffered Saline (PBS) containing 1% Fetal Bovine Serum (FBS). Tubes were centrifuged again at 1700 rpm for 7 min. This cell washing was repeated once more. The final cell pellet was resuspended in an appropriate volume of PBS-1% FBS so there was sufficient volume of cells to add 50 l per well to a 96-well round-bottomed plate. Fifty l of PBS-1% FBS was added to appropriate wells as a negative control. The following primary antibodies were added to appropriate wells at 50 l per well: 1) 2-104, 2) 17D, 3) 2-104, 3C10 and Rm86Texas antigen, and 4) ST8, F10-197 and 17D. Table 1 indicates leukocyte subset specificity for each antibody.

    TABLE-US-00002 TABLE 1 Proportions of leukocyte subsets in white-tailed deer prior to vaccination. 1 antibody Reactivity Cell Type Detected Mean FACS %.sup.a 17D CD4 Th 21 3.4 ST8 CD8 Tc 28 2.8 10-197 T19 -T 6.1 1.6 2-104 CD72 B 18.3 4.5 3C10 CD14 Macrophages 13.6 3.5 .sup.aData represents the mean percentage of cells positive for each antibody std. deviation, pooling data from all eight deer sampled prior to vaccination.

    [0085] After cell addition, the plate was incubated for 10 min at 4 C. and then centrifuged at 1200 rpm for 1-2 min. Supernatant was carefully aspirated from each well and the cells resuspended in 175 l of PBS-1% FBS and centrifuged at 1200 rpm for 1-2 min. Two more washes and centrifugations were performed before addition of diluted fluorescent antigens and secondary antibodies. Fifty l of diluted fluorescent Rm86Texas antigen were added to appropriate wells followed by 50 l of secondary antibodies (GAM-IgG2B-Cy5, GAM-IgM-PE, GAM-IgG1-FITC). Cells were resuspended by use of a plate shaker and then incubated for 10 min at 4 C. Seventy-five l of PBS-1% FBS were added to each well and the plate centrifuged at 1200 rpm for 1-2 min. Supernatant was aspirated and cells washed with 175 l PBS-1% FBS and centrifuged at 1200 rpm for 1-2 min. Supernatant was aspirated and cells were resuspended in 100 l PBS-1% paraformaldehyde and analyzed via flow cytometry to determine the relative proportions of certain cell subsets and the proportion of antigen-specific B cells. One flow cytometry run was performed for each blood sample and the results from all individuals within the same treatment group combined to calculate the treatment group mean and standard deviation.

    [0086] FIG. 4 shows the changes in CD4.sup.+, gamma delta T, CD14.sup.+, CD8.sup.+, and B cells prior to and following vaccination with the anti-tick vaccine candidate antigen Rm86Texas. Temporal changes in peripheral blood mononuclear cells (PBMC) proportions of (A) CD4.sup.+ T-cells, (B) gamma delta T cells, (C) CD14.sup.+ monocytes, (D) CD8.sup.+ T cells, (E) B cells, and (F) Rm86Texas-specific B cells following vaccination of white-tailed deer with adjuvant only (blue) and Rm86Texas in adjuvant (purple). Data points are shown as mean percentage of cells positive for each diagnostic antibodystandard deviation. Each treatment group consisted of four animals and vaccination occurred on the first day of weeks 1, 4, and 7. There were wide variations among the individual animals, particularly among the control deer, and this is reflected in the standard deviation bars in FIG. 3. There appeared to be greatest overall fluctuations among CD4.sup.+ T (FIG. 3A), gamma delta T cells (FIG. 4B), and B cells (FIG. 4E). FIG. 4F shows how Rm86Texas-specific B cell populations fluctuated during the trial. There was a clear increase in Rm86Texas-specific B cells in the week 7 sample, which was taken immediately prior to the third vaccination. Following the week 7 sample, there were very little differences between the control and Rm86Texas vaccinated animals. The clear exception was in the week 15 sample where the control group exhibited the largest reading in the trial. It is noteworthy that the week 11 blood tests revealed that 2 of the control deer had become seropositive for Epizootic Hemorrhagic Disease Virus (EHDV) and 1 had become seropositive for Bluetongue Virus. This was in addition to the other individual in the control group that was found weakly seropositive for Bluetongue Virus at the start of the trial and remained so throughout. One of the EHDV positive control deer eventually died in week 12.

    Determination of Antibody Levels

    [0087] Serum antibody titers were determined using an antigen-specific ELISA. Antigen was diluted in 0.05 M carbonate-bicarbonate buffer, pH=9.6 at a concentration of 10 g/ml. Fifty l of this coating antigen mixture were added to each well of a micro-ELISA plate, covered with an acetate lid and incubated overnight at 4 C. The coating antigen mixture was removed and 100 l of Blotto blocking solution added and incubated at room temperature for 1 hr. The blocking solution was removed and the plate washed 5 times with 200 l per well of Tris-Buffered Saline (TBS) pH 7.5, 0.05% Tween-20 containing 10% blocking solution. One hundred l of test sera was added to the plate at 1:50, 1:100, 1:200, 1:400, 1:800, 1:1600, 1:3200, and 1:6400 dilutions and incubated 2-3 hr at room temperature. The plate was washed 5 times with 200 l per well of TBS-Tween-Blotto. One hundred l of peroxidase-labeled rabbit anti-deer IgG (KPL, Gaithersburg Md.), diluted 1:5000 in TBS-Tween-Blotto, was added to each well and incubated one hr at room temperature. The plate was washed five times with 200 l per well of TBS-Tween-Blotto. One hundred l of substrate solution was added to each well and incubated for 15 min in the dark. Finally, 50 l of stop solution (2 N Sulfuric Acid) were added to each well and absorbance measured at 450 nm. Endpoint titer was determined using the statistical method described by Frey et al. (Frey A, Di Canzio J, Zurakowski D. A statistically defined endpoint titer determination method for immunoassays. J Immunolog Meth 1998; 221:35-41), the entirety of which is incorporated herein by reference. The cutoff absorbance value was determined by calculating the absorbance value mean from readings taken from serum from all 8 animals prior to the first vaccination. For the remaining serum sample time points, each serum was tested individually and the results from all individuals within the same treatment group combined to calculate the treatment group mean and standard deviation.

    [0088] Following the third vaccination, the Rm86Texas-vaccinated deer had mounted a robust antibody response, as shown in FIG. 5. Reciprocal mean titers of Rm86Texas-specific antibodies following vaccination of white-tailed deer with adjuvant only (blue) and Rm86Texas in adjuvant (purple) are shown. Each data point represents the mean of 4 animals standard deviation. Peak antibody titer against Rm86 was noted at week 11, 4 weeks after the third vaccination, which indicates a boost in immunity was achieved with the third vaccination. A drop in antibody titer was found at week 15 and continued as a gradual decrease until week 23. At week 27, the antibody titer of the Rm86Texas vaccinated group showed a slight increase which continued in the week 31 sample. Deer vaccinated with adjuvant alone showed no significant antibody response to Rm86Texas antigen. Carreon et al. (Carreon D, Perez de la Lastra J M, Almazan C, Canales M, Ruiz-Fons F, Boadella M, et al. Vaccination with BM86, subolesin and akirin protective antigens for the control of tick infestations in white tailed deer and red deer. Vaccine 2012; 30:273-279.), the entirety of which is incorporated herein by reference, reported trials in which white-tailed deer were vaccinated three times with a Bm86-based vaccine and then artificially infested with R. microplus. These deer produced a significant antibody response that persisted for at least 6 weeks following the final vaccination and a vaccine efficacy of 76% resulted. In the present invention, the deer immune response with vaccination to Rm86Texas persisted for at least 9 weeks beyond the final vaccination (FIG. 5).

    Epitope Mapping

    [0089] Epitope mapping was conducted by PEPperPRINT GmbH (Heidelberg, Germany) using proprietary protocols. Briefly, the entire Rm86Texas protein coding sequence was translated into 15 aa peptides with a peptide-peptide overlap of 14 aa. The total of 648 different synthesized peptides were spotted in duplicate onto microarrays surrounded by 88 spots each of FLAG (DYKDDDDKGG) and human influenza hemaglutinin A (YPYDVPDYAG) as control epitope tag peptides. Arrays were tested for background interactions by a 10 min incubation with incubation buffer (PBS, pH 7.4 with 0.05% Tween 20, 10% Rockland blocking buffer) followed by 60 min of blocking with 10% Rockland buffer, and 60 min incubation with secondary rabbit anti-deer IgG (H+L) labelled with IRDye680 at 1:5000 dilution. Sera from 2 deer from the Rm86Texas-vaccinated group, deer #88 and #91, were used for epitope mapping with each serum tested with a set of 4 arrays. Serum was collected just prior to vaccination and at Week 11 of the study, which was 4 weeks after the 3rd vaccination. The peptide microarrays with the antigen-derived peptides were blocked for 1 hr with Rockland blocking buffer, then incubated for 16 hr at 4 C. and shaking at 500 rpm with the pre-vaccination or the post-vaccination serum at dilutions of both 1:1000 and 1:100 with each dilution done on separate arrays. This entire experiment was done for each of the two deer sera and also replicated once. Following staining with the IRDye680-labelled secondary rabbit anti-deer IgG antibody, arrays were read with a LI-COR Odyssey Imaging System (LI-COR Biotechnology-GmbH, Hornburg, Germany) and quantified with PepSlide Analyzer (SICASYS Software GmbH, Heidelberg, Germany).

    [0090] Peptide microarrays following incubation with pre- and post-vaccination serum are shown in FIG. 6. Blood serum was collected from one deer immediately prior to the first vaccination and 4 weeks after the third vaccination with Rm86Texas antigen. Washed and blocked peptide microarrays were incubated with either pre-vaccination serum or post-vaccination serum at a dilution of 1:1000. Following incubation with labelled secondary antibody, the array dye signals were developed and analyzed to identify peptide that bound to antibody from the deer serum.

    [0091] The results of the epitope mapping indicated that an antibody response specific to Rm86Texas was detected.

    Immunization Against Amblyomma americanum

    [0092] The Rm86Texas antigen may be used as a vaccine against other non-related species of tick. For example, Rm86Texas may be effective to control ticks of the species Amblyomma americanum. In an exemplary embodiment, ticks were fed blood serum taken from vaccinated deer according to the following protocol:

    [0093] Groups of adult female lone star ticks (A. americanum) were placed upside-down on a strip of sticky tape secured on a standard glass slide. The glass slide was then secured to the lid of a Petri dish (14 cm diameter). A strip of utility wax was placed on the Petri dish lid at a distance of 4 cm from the ticks to help secure capillary tubes. A Fisher brand capillary tube (inner diameter 1.1 mm) filled with serum was placed over the mouthparts of each tick. The Petri dish lid was then placed in a mini digital incubator, where the temperature was maintained at 37 C. and relative humidity was maintained at 75-80%. Each group was fed a serum from one of (a) a pre-vaccinated deer, (b) deer injected with adjuvant only, (c) deer immunized with Rm86Texas, and (d) cattle blood (commercially obtained). The deer were treated according to the above-described methods, and the sera were taken immediately prior to a third vaccination. Ticks were fed for 5 days and examined for mortality at 3, 5, and 7 days post feeding. The mean, standard deviation, and standard error were calculated for each group.

    [0094] Results of the above study are given in Table 2 below:

    TABLE-US-00003 TABLE 2 Mortality rates of the Lone Star Tick fed by immunized serum % Mortality after % Mortality after % Mortality after 3 days 5 days 7 days Serum Mean Stdev Stderr Mean Stdev Stderr Mean Stdev Stderr Pre-vaccination 33.3 5.8 3.3 43.3 11.5 6.7 43.3 11.5 6.7 Adjuvant only 30.0 17.3 10.0 40.0 17.3 10.0 46.7 15.3 8.8 Rm86Texas 60.0 10.0 5.8 83.3 15.3 8.8 93.3 5.8 3.3 Cattle blood 6.7 5.8 3.3 16.7 15.3 8.8 20.0 17.3 10.0

    [0095] As is clear from the data in Table 2, deer serum from deer vaccinated with Rm86Texas was effective at killing ticks compared to the control groups.

    Further Embodiments

    [0096] It is envisioned that a vaccine formulated with Rm86Texas, as disclosed herein, may be modified for one or more purposes. For example, a vaccine may include only Rm86Texas as the sole antigen, or a combination of Rm86Texas and another antigen. Further, it is envisioned that a vaccine containing Rm86Texas may be effective against not only R. microplus, but also other tick species, such as, for example, Ixodes scapularis (also known as the deer tick), and Amblyomma americanum (also known as the lone star tick), as provided for the in the example given herein. For example, Rm86Texas may be combined with RmAQP1, or aquaporin 1, to achieve this result.

    [0097] The foregoing description and accompanying figures illustrate the principles, preferred embodiments and modes of operation of the invention. However, the invention should not be construed as being limited to the particular embodiments discussed above. Additional variations of the embodiments discussed above will be appreciated by those skilled in the art.

    [0098] Therefore, the above-described embodiments should be regarded as illustrative rather than restrictive. Accordingly, it should be appreciated that variations to those embodiments can be made by those skilled in the art without departing from the scope of the invention as defined by the following claims.