NOVEL METALLOPROTEASES

20180080017 ยท 2018-03-22

    Inventors

    Cpc classification

    International classification

    Abstract

    Aspects of the present compositions and methods relate to novel metalloproteases polynucleotides encoding the novel metalloprotease, compositions and methods for use thereof.

    Claims

    1. A polypeptide comprising an amino acid sequence having at least 60% sequence identity to the amino acid sequence selected from the group consisting of of SEQ ID NOs: 3, 6, 9 and 14.

    2. The polypeptide of claim 1, wherein said polypeptide has at least 80% sequence identity to the amino acid sequence selected from the group consisting of of SEQ ID NOs: 3, 6, 9 and 14.

    3. The polypeptide of of any of claim 1 or 2, wherein said polypeptide has at least 95% sequence identity to the amino acid sequence selected from the group consisting of of SEQ ID NOs: 3, 6, 9 and 14.

    4. The polypeptide of of any of claims 1 to 3, wherein said polypeptide has at least 98% sequence identity to the amino acid sequence selected from the group consisting of of SEQ ID NOs: 3, 6, 9 and 14.

    5. The polypeptide of any of the above claims, wherein said amino acid sequence is the amino acid sequence of of SEQ ID NO: 3.

    6. The polypeptide of any of the above claims, wherein said amino acid sequence is the amino acid sequence of of SEQ ID NO: 6.

    7. The polypeptide of any of the above claims, wherein said amino acid sequence is the amino acid sequence of of SEQ ID NO: 9.

    8. The polypeptide of any of the above claims, wherein said amino acid sequence is the amino acid sequence of of SEQ ID NO: 14.

    9. The polypeptide of any of the above claims, wherein said polypeptide is derived from a member of the order Bacillales.

    10. The polypeptide of any of the above claims, wherein said Bacillales member is a Bacillus, Brevibacillus, Lysinibacillus or Anoxybacillus spp.

    11. The polypeptide of claim 10, wherein said Anoxybacillus, Lysinibacillus or Brevibacillus are Anoxybacillus rupiensis, Lysinibacillus macroides, or Brevibacillus brevis, respectively.

    12. The polypeptide of any of the above claims, wherein said polypeptide has protease activity.

    13. The polypeptide of claim 12, wherein said protease activity comprises casein hydrolysis, collagen hydrolysis, elastin hydrolysis, keratin hydrolysis, soy protein hydrolysis or corn meal protein hydrolysis.

    14. The polypeptide of any of the above claims, wherein said polypeptide retains at least 50% of its maximal activity between pH 5 and 9.5.

    15. The polypeptide of any of the above claims, wherein said polypeptide retains at least 50% of its maximal activity between 30 C. and 80 C.

    16. The polypeptide of any of the above claims, wherein said polypeptide has cleaning activity in a detergent composition.

    17. The polypeptide of claim 16, wherein said detergent composition is an ADW detergent composition.

    18. The polypeptide of claim 19, wherein said detergent composition is a laundry detergent composition.

    19. The polypeptide of claim 21, wherein said detergent composition is a liquid laundry detergent composition.

    20. The polypeptide of claim 21, wherein said detergent composition is a powder laundry detergent composition.

    21. The polypeptide of claim 19, wherein said detergent composition comprises a bleach component.

    22. The polypeptide of any of the above claims, wherein said polypeptide is a recombinant polypeptide.

    23. A composition comprising the polypeptide of any of the above claims.

    24. The composition of claim 23, wherein said composition is a cleaning composition.

    25. The composition of claim 24, wherein said composition is a detergent composition.

    26. The composition of claim 25, wherein said detergent composition is selected from the group consisting of a laundry detergent, a fabric softening detergent, a dishwashing detergent, and a hard-surface cleaning detergent.

    27. The composition of any of claims 23 to 26, wherein said composition further comprising a surfactant.

    28. The composition of claim 27, wherein said surfactant is selected from the group consisting of an anionic surfactant, a cationic surfactant, a zwitterionic surfactant, a ampholytic surfactant, a semi-polar non-ionic surfactant, and a combination thereof.

    29. The composition of claim 27, wherein said surfactant is an ionic surfactant.

    30. The composition of claim 27, wherein said surfactant is a non-ionic surfactant.

    31. The composition of any one of claims 23-30, wherein said composition further comprises at least one calcium ion and/or zinc ion.

    32. The composition of any of claims 23-31, wherein said composition further comprises at least one stabilizer.

    33. The composition of any of claims 23-32, wherein said composition comprises from about 0.001 to about 0.1 weight % of said polypeptide.

    34. The composition of any of claims 23-33, further comprising at least one bleaching agent.

    35. The composition of any of claims 23-34, wherein said cleaning composition is phosphate-free.

    36. The composition of any of claims 23-34, wherein said cleaning composition contains phosphate.

    37. The composition of any of claims 23-36, further comprising at least one adjunct ingredient.

    38. The composition of any of claims 23-37, wherein said composition is a granular, powder, solid, bar, liquid, tablet, gel, or paste composition.

    39. The composition of any of claims 23-38, further comprising one or more additional enzymes or enzyme derivatives selected from the group consisting of acyl transferases, alpha-amylases, beta-amylases, alpha-galactosidases, arabinosidases, aryl esterases, beta-galactosidases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases, lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases, pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases, polygalacturonases, proteases, pullulanases, reductases, rhamnogalacturonases, beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, and xylosidases, additional metallopotease enzymes and combinations thereof.

    40. The composition of any of claims 23-39, wherein said composition is formulated at a pH of from about 5.5 to about 8.5.

    41. A method for the pretreatment of animal feed comprising treating an animal feed pre-product with the polypeptide of any one of claims 1-22.

    42. A method of cleaning, comprising contacting a surface or an item with a cleaning composition comprising the polypeptide of any one of claims 1-22.

    43. A method of cleaning comprising contacting a surface or an item with the composition of any one of claims 23-40.

    44. The method of claim 42 or 43, further comprising rinsing said surface or item after contacting said surface or item, respectively, with said composition.

    45. The method of any one of claims 42-44, wherein said item is dishware.

    46. The method of any one of claims 42-45, wherein said item is fabric.

    47. The method of any one of claims 42-46, further comprising the step of rinsing said surface or item after contacting said surface or item with said composition.

    48. The method of claim 47, further comprising the step of drying said surface or item after said rinsing of said surface or item.

    49. A method of cleaning a surface or item, comprising: providing the composition of any of claims 23-40 and a surface or item in need of cleaning; and contacting said composition with said surface or item in need of cleaning under conditions suitable for the cleansing of said surface of said surface or item, to produce a cleansed surface or item.

    50. The method of claim 49, further comprising the step of rinsing said cleansed surface or item to produce a rinsed surface or item.

    51. The method of claim 49 or 50, further comprising the step of drying said rinsed surface or item.

    52. A method for producing the polypeptide of any of claims 1-22 comprising: a. stably transforming a host cell with an expression vector comprising a polynucleotide encoding the polypeptide of any of claims 1-22; b. cultivating said transformed host cell under conditions suitable for said host cell to produce said protease; and c. recovering said protease.

    53. The method of claim 52, wherein said host cell is a filamentous fungus or bacterial cell.

    54. The method claim 52 or 53, wherein said host cell is selected from Bacillus spp., Streptomyces spp., Escherichia spp., Aspergillus spp., Trichoderma spp., Pseudomonas spp., Corynebacterium spp., Saccharomyces spp., or Pichia spp.

    55. The method of any one of claims 52-54, wherein said expression vector comprises a polynucleotide sequence comprising: a. at least 70% sequence identity to the polynucleotide sequence set forth in SEQ ID NO: 4, 10 or 15 b. being capable of hybridizing to a probe derived from the polynucleotide sequence set forth in SEQ ID NO: 4, 10 or 15 under conditions of intermediate to high stringency, or c. a polynucleotide sequence complementary to a polynucleotide sequence having at least 70% sequence identity to the polynucleotide sequence set forth in SEQ ID NO: 4, 10 or 15.

    56. The method of any one of claims 52-55, wherein said vector comprises a native or non-naturally occurring signal peptide.

    57. The method of any one of claims 52-56, wherein said vector comprises a heterologous promoter and/or signal peptide.

    58. The method of any one of claims 52-57, wherein said vector comprises a homologous promoter and/or signal peptide.

    59. The method of any one of claims 52-58, wherein said host cell is cultivated in a culture media or a fermentation broth.

    60. A nucleic acid sequence comprising a nucleic acid sequence: (i) having at least 70% identity to SEQ ID NO: 4, 10 or 15, or (ii) being capable of hybridizing to a probe derived from the polynucleotide sequence set forth in SEQ ID NO: 4, 10 or 15, under conditions of intermediate to high stringency, or (iii) being complementary to the polynucleotide sequence set forth in SEQ ID NO: 4, 10 or 15.

    61. A vector comprising the nucleic acid sequence of claim 60.

    62. A host cell transformed with the vector of claim 61.

    63. The host cell of claim 62 selected from Bacillus spp., Streptomyces spp., Escherichia spp., Aspergillus spp., Trichoderma spp., Pseudomonas spp., Corynebacterium spp., Saccharomyces spp., or Pichia spp.

    64. The host cell of claim 62 or 63, wherein said Bacillus spp. is Bacillus subtilis.

    65. A textile processing composition comprising the polypeptide of any one of claims 1-22.

    66. An animal feed composition comprising the polypeptide of any one of claims 1-22.

    67. A leather processing composition comprising the polypeptide of any one of claims 1-22.

    68. A feather processing composition comprising the polypeptide or recombinant polypeptide of any one of claims 1-22.

    69. A corn soy protein processing composition comprising the polypeptide or recombinant polypeptide of any one of claims 1-22.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0010] FIG. 1.1 provides a plasmid map of pGX133 (aprE-AruPro1), described in Example 1.2.

    [0011] FIG. 1.2 provides a dose response curve of AruPro1 in the azo-casein assay.

    [0012] FIG. 1.3 provides the pH profile of purified AruPro1.

    [0013] FIG. 1.4 provides the temperature profile of purified AruPro1.

    [0014] FIG. 1.5A shows dose response for cleaning of PA-S-38 microswatches by AruPro1protein in ADW detergent at pH 6 in the absense of bleach. Dashed line shows the cleaning performance of the blank control.

    [0015] FIG. 1.5B shows dose response for cleaning of PA-S-38 microswatches shows by AruPro1protein in ADW detergent at pH 8 in the presence of bleach. Dashed line shows the cleaning performance of the blank control.

    [0016] FIG. 1.6A shows cleaning performance of AruPro1 protein in liquid laundry detergent.

    [0017] FIG. 1.6B shows cleaning performance of AruPro1 protein in powder laundry detergent.

    [0018] FIG. 1.7 shows the keratinolytic activity of purified AruPro1 protein.

    [0019] FIG. 1.8 shows feather degradation activity of AruPro1 protein.

    [0020] FIG. 1.9 (SEQ ID NO: 6, 17, 18, and 19) shows alignment of AruPro1 with other protein homologs.

    [0021] FIG. 1.10 provides the phylogenetic tree for AruPro1 and its homologs.

    [0022] FIG. 2.1 provides a plasmid map of pGX125 (aprE-LmaPro1), described in Example 2.2.

    [0023] FIG. 2.2 provides a dose response curve of LmaPro1 in the azo-casein assay.

    [0024] FIG. 2.3 provides the pH profile of purified LmaPro1.

    [0025] FIG. 2.4 provides the temperature profile of purified LmaPro1.

    [0026] FIG. 2.5A shows dose response for cleaning of PA-S-38 microswatches by LmaPro1 protein in ADW detergent at pH 6 in the presence of bleach.

    [0027] FIG. 2.5B shows dose response for cleaning of PA-S-38 microswatches shows by LmaPro1 protein in ADW detergent at pH 8 in the presence of bleach.

    [0028] FIG. 2.6A shows cleaning performance of LmaPro1 protein in liquid laundry detergent.

    [0029] FIG. 2.6B shows cleaning performance of LmaPro1 protein in powder laundry detergent.

    [0030] FIG. 2.7 (SEQ ID NOS: 20, 21, and 9) shows alignment of LmaPro1 with other protein homologs.

    [0031] FIG. 2.8 provides the phylogenetic tree for LmaPro1 and its homologs.

    [0032] FIG. 3.1 provides a plasmid map of pGX140 (aprE-BbrPro1), described in Example 3.2.

    [0033] FIG. 3.2 provides a dose response curve of BbrPro1 in the azo-casein assay.

    [0034] FIG. 3.3 provides the pH profile of purified BbrPro1.

    [0035] FIG. 3.4 provides the temperature profile of purified BbrPro1.

    [0036] FIG. 3.5A shows dose response for cleaning performance of BbrPro1 at pH 6 in AT dish detergent with bleach.

    [0037] FIG. 3.5B shows dose response for cleaning performance of purified BbrPro1 at pH 8 in AT detergent with bleach.

    [0038] FIG. 3.6 shows dose response curve of BbrPro1 protease in the keratin azure assay.

    [0039] FIG. 3.7 shows activity of BbrPro1 in the degradation of natural chicken feather.

    [0040] FIG. 3.8 (SEQ ID NOS: 14, 22, 23 and 24) shows alignment of BbrPro1 with other protein homologs.

    [0041] FIG. 3.9 provides the phylogenetic tree for BbrPro1 and its homologs.

    DETAILED DESCRIPTION

    [0042] The present invention provides novel metalloprotease enzymes, especially enzymes useful for detergent compositions, such as the novel protease AruPro1, cloned from Anoxybacillus rupiensis, LmaPro1, cloned from Lysinibacillus macroides, and BbrPro1, cloned from Brevibacillus brevis. The compositions and methods are based, in part, on the observation that the novel metalloproteases of the present invention have proteolytic activity in the presence of detergent compositions. This feature makes metalloproteases of the present invention particularly well suited to and useful in a variety of cleaning applications where the enzyme can hydrolyze polypeptides in the presence of surfactants and other components found in detergent compositions. The invention includes compositions comprising at least one of the novel metalloprotease enzymes set forth herein. Some such compositions comprise detergent compositions. The metalloprotease enzymes of the present invention can be combined with other enzymes useful in detergent compositions. The invention also provides methods of cleaning using metalloprotease enzymes of the present invention.

    Definitions and Abbreviations

    [0043] Unless otherwise indicated, the practice of the present invention involves conventional techniques commonly used in molecular biology, protein engineering, microbiology, and recombinant DNA technology, which are within the skill of the art. Such techniques are known to those of skill in the art and are described in numerous texts and reference works well known to those of skill in the art. All patents, patent applications, articles and publications mentioned herein, both supra and infra, are hereby expressly incorporated herein by reference.

    [0044] Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Many technical dictionaries are known to those of skill in the art. Although any methods and materials similar or equivalent to those described herein find use in the practice of the present invention, some suitable methods and materials are described herein. Accordingly, the terms defined immediately below are more fully described by reference to the Specification as a whole. Also, as used herein, the singular a, an and the includes the plural reference unless the context clearly indicates otherwise. Unless otherwise indicated, nucleic acids are written left to right in 5 to 3 orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively. It is to be understood that this invention is not limited to the particular methodology, protocols, and reagents described, as these may vary, depending upon the context they are used by those of skill in the art.

    [0045] Furthermore, the headings provided herein are not limitations of the various aspects or embodiments of the invention.

    [0046] It is intended that every maximum numerical limitation given throughout this specification includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.

    [0047] As used herein, the terms protease and proteinase refer to an enzyme that has the ability to break down proteins and peptides. A protease has the ability to conduct proteolysis, by hydrolysis of peptide bonds that link amino acids together in a peptide or polypeptide chain forming the protein. This activity of a protease as a protein-digesting enzyme is referred to as proteolytic activity. Many well known procedures exist for measuring proteolytic activity (See e.g., Kalisz, Microbial Proteinases, In: Fiechter (ed.), Advances in Biochemical Engineering/Biotechnology, (1988)). For example, proteolytic activity may be ascertained by comparative assays which analyze the respective protease's ability to hydrolyze a suitable substrate. Exemplary substrates useful in the analysis of protease or proteolytic activity, include, but are not limited to, di-methyl casein (Sigma C-9801), bovine collagen (Sigma C-9879), bovine elastin (Sigma E-1625), and bovine keratin (ICN Biomedical 902111). Colorimetric assays utilizing these substrates are well known in the art (See e.g., WO 99/34011 and U.S. Pat. No. 6,376,450, both of which are incorporated herein by reference). The pNA peptidyl assay (See e.g., Del Mar et al., Anal. Biochem. 99:316-320 [1979]) also finds use in determining the active enzyme concentration. This assay measures the rate at which p-nitroaniline is released as the enzyme hydrolyzes a soluble synthetic substrate, such as succinyl-alanine-alanine-proline-phenylalanine-p-nitroanilide (suc-AAPF-pNA). The rate of production of yellow color from the hydrolysis reaction is measured at 410 nm on a spectrophotometer and is proportional to the active enzyme concentration. In addition, absorbance measurements at 280 nanometers (nm) can be used to determine the total protein concentration in a sample of purified protein. The activity on substrate/protein concentration gives the enzyme specific activity.

    [0048] As used herein, the term variant polypeptide refers to a polypeptide comprising an amino acid sequence that differs in at least one amino acid residue from the amino acid sequence of a parent or reference polypeptide (including but not limited to wild-type polypeptides).

    [0049] As used herein, the genus Bacillus includes all species within the genus Bacillus, as known to those of skill in the art, including but not limited to B. subtilis, B. licheniformis, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B. amyloliquefaciens, B. clausii, B. halodurans, B. megaterium, B. coagulans, B. circulans, B. lautus, and B. thuringiensis. It is recognized that the genus Bacillus continues to undergo taxonomical reorganization. Thus, it is intended that the genus include species that have been reclassified, including but not limited to such organisms as B. stearothermophilus, which is now named Geobacillus stearothermophilus. The production of resistant endospores under stressful environmental conditions is considered the defining feature of the genus Bacillus, although this characteristic also applies to the recently named Alicyclobacillus, Amphibacillus, Aneurinibacillus, Anoxybacillus, Brevibacillus, Filobacillus, Gracilibacillus, Halobacillus, Paenibacillus, Salibacillus, Thermobacillus, Ureibacillus, and Virgibacillus.

    [0050] The terms polynucleotide and nucleic acid, which are used interchangeably herein, refer to a polymer of any length of nucleotide monomers covalently bonded in a chain. DNA (deoxyribonucleic acid), a polynucleotide comprising deoxyribonucleotides, and RNA (ribonucleic acid), a polymer of ribonucleotides, are examples of polynucleotides or nucleic acids having distinct biological function. Polynucleotides or nucleic acids include, but are not limited to, a single-, double- or triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, or a polymer comprising purine and pyrimidine bases, or other natural, chemically, biochemically modified, non-natural or derivatized nucleotide bases. The following are non-limiting examples of polynucleotides: genes, gene fragments, chromosomal fragments, expressed sequence tag(s) (EST(s)), exons, introns, messenger RNA (mRNA), transfer RNA (tRNA), ribosomal RNA (rRNA), ribozymes, complementary DNA (cDNA), recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.

    [0051] As used herein, the term mutation refers to changes made to a reference amino acid or nucleic acid sequence. It is intended that the term encompass substitutions, insertions and deletions.

    [0052] As used herein, the term vector refers to a nucleic acid construct used to introduce or transfer nucleic acid(s) into a target cell or tissue. A vector is typically used to introduce foreign DNA into a cell or tissue. Vectors include plasmids, cloning vectors, bacteriophages, viruses (e.g., viral vector), cosmids, expression vectors, shuttle vectors, and the like. A vector typically includes an origin of replication, a multicloning site, and a selectable marker. The process of inserting a vector into a target cell is typically referred to as transformation. The present invention includes, in some embodiments, a vector that comprises a DNA sequence encoding a metalloprotease polypeptide (e.g., precursor or mature metalloprotease polypeptide) that is operably linked to a suitable prosequence (e.g., secretory, signal peptide sequence, etc.) capable of effecting the expression of the DNA sequence in a suitable host, and the folding and translocation of the recombinant polypeptide chain.

    [0053] As used herein, the term expression cassette, expression plasmid or expression vector refers to a nucleic acid construct or vector generated recombinantly or synthetically for the expression of a nucleic acid of interest in a target cell. An expression vector or expression cassette typically comprises a promoter nucleotide sequence that drives expression of the foreign nucleic acid. The expression vector or cassette also typically includes any other specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell. A recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Many prokaryotic and eukaryotic expression vectors are commercially available.

    [0054] In some embodiments, the ends of the sequence are closed such that the DNA construct forms a closed circle. The nucleic acid sequence of interest, which is incorporated into the DNA construct, using techniques well known in the art, may be a wild-type, mutant, or modified nucleic acid. In some embodiments, the DNA construct comprises one or more nucleic acid sequences homologous to the host cell chromosome. In other embodiments, the DNA construct comprises one or more non-homologous nucleotide sequences. Once the DNA construct is assembled in vitro, it may be used, for example, to: 1) insert heterologous sequences into a desired target sequence of a host cell; and/or 2) mutagenize a region of the host cell chromosome (i.e., replace an endogenous sequence with a heterologous sequence); 3) delete target genes; and/or 4) introduce a replicating plasmid into the host. DNA construct is used interchangeably herein with expression cassette.

    [0055] As used herein, a plasmid refers to an extrachromosomal DNA molecule which is capable of replicating independently from the chromosomal DNA. A plasmid is double stranded (ds) and may be circular and is typically used as a cloning vector.

    [0056] As used herein in the context of introducing a nucleic acid sequence into a cell, the term introduced refers to any method suitable for transferring the nucleic acid sequence into the cell. Such methods for introduction include but are not limited to protoplast fusion, transfection, transformation, electroporation, conjugation, and transduction (See e.g., Ferrari et al., Genetics, in Hardwood et al. (eds.), Bacillus, Plenum Publishing Corp., pp. 57-72 [1989]).

    [0057] Transformation refers to the genetic alteration of a cell which results from the uptake, optional genomic incorporation, and expression of genetic material (e.g., DNA).

    [0058] As used herein, a nucleic acid is operably linked with another nucleic acid sequence when it is placed into a functional relationship with another nucleic acid sequence. For example, a promoter or enhancer is operably linked to a nucleotide coding sequence if the promoter affects the transcription of the coding sequence. A ribosome binding site may be operably linked to a coding sequence if it is positioned so as to facilitate translation of the coding sequence. Typically, operably linked DNA sequences are contiguous. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors or linkers may be used in accordance with conventional practice.

    [0059] As used herein the term gene refers to a polynucleotide (e.g., a DNA segment), that encodes a polypeptide and includes regions preceding and following the coding regions as well as intervening sequences (introns) between individual coding segments (exons).

    [0060] As used herein, recombinant when used with reference to a cell typically indicates that the cell has been modified by the introduction of a foreign nucleic acid sequence or that the cell is derived from a cell so modified. For example, a recombinant cell may comprise a gene not found in identical form within the native (non-recombinant) form of the cell, or a recombinant cell may comprise a native gene (found in the native form of the cell) but which has been modified and re-introduced into the cell. A recombinant cell may comprise a nucleic acid endogenous to the cell that has been modified without removing the nucleic acid from the cell; such modifications include those obtained by gene replacement, site-specific mutation, and related techniques known to those of ordinary skill in the art. Recombinant DNA technology includes techniques for the production of recombinant DNA in vitro and transfer of the recombinant DNA into cells where it may be expressed or propagated, thereby producing a recombinant polypeptide. Recombination, recombining, and recombined of polynucleotides or nucleic acids refer generally to the assembly or combining of two or more nucleic acid or polynucleotide strands or fragments to generate a new polynucleotide or nucleic acid. The recombinant polynucleotide or nucleic acid is sometimes referred to as a chimera. A nucleic acid or polypeptide is recombinant when it is artificial or engineered.

    [0061] A nucleic acid or polynucleotide is said to encode a polypeptide if, in its native state or when manipulated by methods known to those of skill in the art, it can be transcribed and/or translated to produce the polypeptide or a fragment thereof. The anti-sense strand of such a nucleic acid is also said to encode the sequence.

    [0062] Host strain or host cell refers to a suitable host for an expression vector comprising a DNA sequence of interest.

    [0063] A protein or polypeptide comprises a polymeric sequence of amino acid residues. The terms protein and polypeptide are used interchangeably herein. The single and 3-letter code for amino acids as defined in conformity with the IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN) is used through out this disclosure. The single letter X refers to any of the twenty amino acids. It is also understood that a polypeptide may be coded for by more than one nucleotide sequence due to the degeneracy of the genetic code. Mutations can be named by the one letter code for the parent amino acid, followed by a position number and then the one letter code for the variant amino acid. For example, mutating glycine (G) at position 87 to serine (S) is represented as G087S or G87S. Mutations can also be named by using the three letter code for an amino acid followed by its position in the polypeptide chain as counted from the N-terminus; for example, Ala10 for alanine at position 10. Multiple mutations are indicated by inserting a - between the mutations. Mutations at positions 87 and 90 are represented as either G087S-A090Y or G87S-A90Y or G87S+A90Y or G087S+A090Y. For deletions, the one letter code Z is used. For an insertion relative to the parent sequence, the one letter code Z is on the left side of the position number. For a deletion, the one letter code Z is on the right side of the position number. For insertions, the position number is the position number before the inserted amino acid(s), plus 0.01 for each amino acid. For example, an insertion of three amino acids alanine (A), serine (S) and tyrosine (Y) between position 87 and 88 is shown as Z087.01A-Z087.02S-Z087.03Y. Thus, combining all the mutations above plus a deletion at position 100 is: G087S-Z087.01A-Z087.02S-Z087.03Y-A090Y-A100Z. When describing modifications, a position followed by amino acids listed in parentheses indicates a list of substitutions at that position by any of the listed amino acids. For example, 6(L,I) means position 6 can be substituted with a leucine or isoleucine.

    [0064] A prosequence or propeptide sequence refers to an amino acid sequence between the signal peptide sequence and mature protease sequence that is necessary for the proper folding and secretion of the protease; they are sometimes referred to as intramolecular chaperones. Cleavage of the prosequence or propeptide sequence results in a mature active protease. Bacterial metalloproteases are often expressed as pro-enzymes.

    [0065] The term signal sequence or signal peptide refers to a sequence of amino acid residues that may participate in the secretion or direct transport of the mature or precursor form of a protein. The signal sequence is typically located N-terminal to the precursor or mature protein sequence. The signal sequence may be endogenous or exogenous. A signal sequence is normally absent from the mature protein. A signal sequence is typically cleaved from the protein by a signal peptidase after the protein is transported.

    [0066] The term mature form of a protein, polypeptide, or peptide refers to the functional form of the protein, polypeptide, or peptide without the signal peptide sequence and propeptide sequence.

    [0067] The term precursor form of a protein or peptide refers to a mature form of the protein having a prosequence operably linked to the amino or carbonyl terminus of the protein. The precursor may also have a signal sequence operably linked to the amino terminus of the prosequence. The precursor may also have additional polypeptides that are involved in post-translational activity (e.g., polypeptides cleaved therefrom to leave the mature form of a protein or peptide).

    [0068] The term wild-type in reference to an amino acid sequence or nucleic acid sequence indicates that the amino acid sequence or nucleic acid sequence is native or naturally occurring sequence. As used herein, the term naturally-occurring refers to anything (e.g., proteins, amino acids, or nucleic acid sequences) that are found in nature.

    [0069] As used herein, the term non-naturally occurring refers to anything that is not found in nature (e.g., recombinant nucleic acids and protein sequences produced in the laboratory), as modification of the wild-type sequence.

    [0070] As used herein with regard to amino acid residue positions, corresponding to or corresponds to or corresponds refers to an amino acid residue at the enumerated position in a protein or peptide, or an amino acid residue that is analogous, homologous, or equivalent to an enumerated residue in a protein or peptide. As used herein, corresponding region generally refers to an analogous position in a related proteins or a reference protein.

    [0071] The terms derived from and obtained from refer to not only a protein produced or producible by a strain of the organism in question, but also a protein encoded by a DNA sequence isolated from such strain and produced in a host organism containing such DNA sequence. Additionally, the term refers to a protein which is encoded by a DNA sequence of synthetic and/or cDNA origin and which has the identifying characteristics of the protein in question. To exemplify, proteases derived from Bacillus refers to those enzymes having proteolytic activity which are naturally produced by Bacillus, as well as to serine proteases like those produced by Bacillus sources but which through the use of genetic engineering techniques are produced by non-Bacillus organisms transformed with a nucleic acid encoding the serine proteases.

    [0072] The term identical in the context of two nucleic acids or polypeptidesequences refers to the residues in the two sequences that are the same when aligned for maximum correspondence, as measured using one of the following sequence comparison or analysis algorithms.

    [0073] As used herein, homologous genes refers to a pair of genes from different, but usually related species, which correspond to each other and which are identical or very similar to each other. The term encompasses genes that are separated by speciation (i.e., the development of new species) (e.g., orthologous genes), as well as genes that have been separated by genetic duplication (e.g., paralogous genes).

    [0074] As used herein, % identity or percent identity refers to sequence similarity. Percent identity may be determined using standard techniques known in the art (See e.g., Smith and Waterman, Adv. Appl. Math. 2:482 [1981]; Needleman and Wunsch, J. Mol. Biol. 48:443 [1970]; Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 [1988]; software programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, Wis.); and Devereux et al., Nucl. Acid Res. 12:387-395 [1984]). One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (See, Feng and Doolittle, J. Mol. Evol. 35:351-360 [1987]). The method is similar to that described by Higgins and Sharp (See, Higgins and Sharp, CABIOS 5:151-153 [1989]). Useful PILEUP parameters include a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps. Other useful algorithm is the BLAST algorithms described by Altschul et al., (See, Altschul et al., J. Mol. Biol. 215:403-410 [1990]; and Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787 [1993]). The BLAST program uses several search parameters, most of which are set to the default values.

    [0075] The NCBI BLAST algorithm finds the most relevant sequences in terms of biological similarity but is not recommended for query sequences of less than 20 residues (Altschul, S F et al. (1997) Nucleic Acids Res. 25:3389-3402 and Schaffer, A A et al. (2001) Nucleic Acids Res. 29:2994-3005). Example default BLAST parameters for a nucleic acid sequence searches are: [0076] Neighboring words threshold: 11 [0077] E-value cutoff: 10 [0078] Scoring Matrix: NUC.3.1 (match=1, mismatch=3) [0079] Gap Opening: 5 [0080] Gap Extension: 2
    and the following parameters for amino acid sequence searches: [0081] Word size: 3 [0082] E-value cutoff: 10 [0083] Scoring Matrix: BLOSUM62 [0084] Gap Opening: 11 [0085] Gap extension: 1

    [0086] A percent (%) amino acid sequence identity value is determined by the number of matching identical residues divided by the total number of residues of the reference sequence including any gaps created by the program for optimal/maximum alignment. If a sequence is 90% identical to SEQ ID NO: A, SEQ ID NO: A is is the reference sequence. BLAST algorithms refer the reference sequence as query sequence.

    [0087] The CLUSTAL W algorithm is another example of a sequence alignment algorithm. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are: [0088] Gap opening penalty: 10.0 [0089] Gap extension penalty: 0.05 [0090] Protein weight matrix: BLOSUM series [0091] DNA weight matrix: IUB [0092] Delay divergent sequences %: 40 [0093] Gap separation distance: 8 [0094] DNA transitions weight: 0.50 [0095] List hydrophilic residues: GPSNDQEKR [0096] Use negative matrix: OFF [0097] Toggle Residue specific penalties: ON [0098] Toggle hydrophilic penalties: ON [0099] Toggle end gap separation penalty OFF.

    [0100] In CLUSTAL algorithms, deletions occurring at either terminus are included. For example, a variant with five amino acid deletion at either terminus (or within the polypeptide) of a polypeptide of 500 amino acids would have a percent sequence identity of 99% (495/500 identical residues100) relative to the reference polypeptide. Such a variant would be encompassed by a variant having at least 99% sequence identity to the polypeptide.

    [0101] A polypeptide of interest may be said to be substantially identical to a reference polypeptide if the polypeptide of interest comprises an amino acid sequence having at least about 60%, least about 65%, least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.5% sequence identity to the amino acid sequence of the reference polypeptide. The percent identity between two such polypeptides can be determined manually by inspection of the two optimally aligned polypeptide sequences or by using software programs or algorithms (e.g., BLAST, ALIGN, CLUSTAL) using standard parameters. One indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the second polypeptide. Typically, polypeptides that differ by conservative amino acid substitutions are immunologically cross-reactive. Thus, a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative amino acid substitution or one or more conservative amino acid substitutions.

    [0102] A nucleic acid of interest may be said to be substantially identical to a reference nucleic acid if the nucleic acid of interest comprises a nucleotide sequence having least about 60%, least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.5% sequence identity to the nucleotide sequence of the reference nucleic acid. The percent identity between two such nucleic acids can be determined manually by inspection of the two optimally aligned nucleic acid sequences or by using software programs or algorithms (e.g., BLAST, ALIGN, CLUSTAL) using standard parameters. One indication that two nucleic acid sequences are substantially identical is that the two nucleic acid molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).

    [0103] A nucleic acid or polynucleotide is isolated when it is at least partially or completely separated from other components, including but not limited to for example, other proteins, nucleic acids, cells, etc. Similarly, a polypeptide, protein or peptide is isolated when it is at least partially or completely separated from other components, including but not limited to for example, other proteins, nucleic acids, cells, etc. On a molar basis, an isolated species is more abundant than are other species in a composition. For example, an isolated species may comprise at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% (on a molar basis) of all macromolecular species present. Preferably, the species of interest is purified to essential homogeneity (i.e., contaminant species cannot be detected in the composition by conventional detection methods). Purity and homogeneity can be determined using a number of techniques well known in the art, such as agarose or polyacrylamide gel electrophoresis of a nucleic acid or a protein sample, respectively, followed by visualization upon staining. If desired, a high-resolution technique, such as high performance liquid chromatography (HPLC) or a similar means can be utilized for purification of the material.

    [0104] Hybridization refers to the process by which one strand of nucleic acid forms a duplex with, i.e., base pairs with, a complementary strand. A nucleic acid sequence is considered to be selectively hybridizable to a reference nucleic acid sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions. Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe. For example, maximum stringency typically occurs at about Tm5 C. (5 below the Tm of the probe); high stringency at about 5-10 C. below the Tm; intermediate stringency at about 10-20 C. below the Tm of the probe; and low stringency at about 20-25 C. below the Tm. Functionally, maximum stringency conditions can be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while intermediate or low stringency hybridization can be used to identify or detect polynucleotide sequence homologs.

    [0105] Moderate and high stringency hybridization conditions are well known in the art. Stringent hybridization conditions are exemplified by hybridization under the following conditions: 65 C. and 0.1SSC (where 1SSC=0.15 M NaCl, 0.015 M Na.sub.3 citrate, pH 7.0). Hybridized, duplex nucleic acids are characterized by a melting temperature (Tm), where one half of the hybridized nucleic acids are unpaired with the complementary strand. Mismatched nucleic acids within the duplex lower the Tm. Very stringent hybridization conditions involve 68 C. and 0.1SSC. A nucleic acid encoding a variant metalloprotease can have a Tm reduced by 1 C.-3 C. or more compared to a duplex formed between the nucleic acid of wild type metalloprotease and its identical complement.

    [0106] Another example of high stringency conditions includes hybridization at about 42 C. in 50% formamide, 5SSC, 5Denhardt's solution, 0.5% SDS and 100 g/ml denatured carrier DNA followed by washing two times in 2SSC and 0.5% SDS at room temperature and two additional times in 0.1SSC and 0.5% SDS at 42 C. An example of moderate stringent conditions include an overnight incubation at 37 C. in a solution comprising 20% formamide, 5SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5Denhardt's solution, 10% dextran sulfate and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in 1SSC at about 37-50 C. Those of skill in the art know how to adjust the temperature, ionic strength, etc. to accommodate factors such as probe length and the like.

    [0107] The term purified as applied to nucleic acids or polypeptides generally denotes a nucleic acid or polypeptide that is essentially free from other components as determined by analytical techniques well known in the art (e.g., a purified polypeptide or polynucleotide forms a discrete band in an electrophoretic gel, chromatographic eluate, and/or a media subjected to density gradient centrifugation). For example, a nucleic acid or polypeptide that gives rise to essentially one band in an electrophoretic gel is purified. A purified nucleic acid or polypeptide is at least about 50% pure, usually at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, about 99.5%, about 99.6%, about 99.7%, about 99.8% or more pure (e.g., percent by weight on a molar basis). In a related sense, the invention provides methods of enriching compositions for one or more molecules of the invention, such as one or more polypeptides or polynucleotides of the invention. A composition is enriched for a molecule when there is a substantial increase in the concentration of the molecule after application of a purification or enrichment technique. A substantially pure polypeptide or polynucleotide of the invention (e.g., substantially pure metalloprotease polypeptide or polynucleotide encoding a metalloprotease polypeptide of the invention, respectively) will typically comprise at least about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98, about 99%, about 99.5% or more by weight (on a molar basis) of all macromolecular species in a particular composition.

    [0108] The term enriched refers to a compound, polypeptide, cell, nucleic acid, amino acid, or other specified material or component that is present in a composition at a relative or absolute concentration that is higher than a starting composition.

    [0109] In a related sense, the invention provides methods of enriching compositions for one or more molecules of the invention, such as one or more polypeptides of the invention (e.g., one or more metalloprotease polypeptides of the invention) or one or more nucleic acids of the invention (e.g., one or more nucleic acids encoding one or more metalloprotease polypeptides of the invention). A composition is enriched for a molecule when there is a substantial increase in the concentration of the molecule after application of a purification or enrichment technique. A substantially pure polypeptide or polynucleotide will typically comprise at least about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98, about 99%, about 99.5% or more by weight (on a molar basis) of all macromolecular species in a particular composition.

    [0110] As used herein, the term functional assay refers to an assay that provides an indication of a protein's activity. In some embodiments, the term refers to assay systems in which a protein is analyzed for its ability to function in its usual capacity. For example, in the case of a protease, a functional assay involves determining the effectiveness of the protease to hydrolyze a proteinaceous substrate.

    [0111] The terms modified nucleic acid sequence and modified gene are used interchangeably herein to refer to a nucleic acid sequence that includes a deletion, insertion or interruption of naturally occurring (i.e., wild-type) nucleic acid sequence. In some embodiments, the expression product of the modified nucleic acid sequence is a truncated protein (e.g., if the modification is a deletion or interruption of the sequence). In some embodiments, the truncated protein retains biological activity. In alternative embodiments, the expression product of the modified nucleic acid sequence is an elongated protein (e.g., modifications comprising an insertion into the nucleic acid sequence). In some embodiments, a nucleotide insertion in the nucleic acid sequence leads to a truncated protein (e.g., when the insertion results in the formation of a stop codon). Thus, an insertion may result in either a truncated protein or an elongated protein as an expression product.

    [0112] A mutant nucleic acid sequence typically refers to a nucleic acid sequence that has an alteration in at least one codon occurring in a host cell's wild-type sequence such that the expression product of the mutant nucleic acid sequence is a protein with an altered amino acid sequence relative to the wild-type protein. The expression product may have an altered functional capacity (e.g., enhanced enzymatic activity).

    [0113] As used herein, the phrase alteration in substrate specificity refers to changes in the substrate specificity of an enzyme. In some embodiments, a change in substrate specificity is defined as a change in k.sub.cat and/or K.sub.m for a particular substrate, resulting from mutations of the enzyme or alteration of reaction conditions. The substrate specificity of an enzyme is determined by comparing the catalytic efficiencies it exhibits with different substrates. These determinations find particular use in assessing the efficiency of mutant enzymes, as it is generally desired to produce variant enzymes that exhibit greater ratios of k.sub.cat/K.sub.m for substrates of interest. However, it is not intended that the present invention be limited to any particular substrate composition or substrate specificity.

    [0114] As used herein, surface property is used in reference to electrostatic charge, as well as properties such as the hydrophobicity and hydrophilicity exhibited by the surface of a protein.

    [0115] As used herein, the term net charge is defined as the sum of all charges present in a molecule. Net charge changes are made to a parent protein molecule to provide a variant that has a net charge that differs from that of the parent molecule (i.e., the variant has a net charge that is not the same as that of the parent molecule). For example, substitution of a neutral amino acid with a negatively charged amino acid or a positively charged amino acid with a neutral amino acid results in net charge of 1 with respect to the parent molecule. Substitution of a positively charged amino acid with a negatively charged amino acid results in a net charge of 2 with respect to the parent. Substitution of a neutral amino acid with a positively charged amino acid or a negatively charged amino acid with a neutral amino acid results in net charge of +1 with respect to the parent. Substitution of a negatively charged amino acid with a positively charged amino acid results in a net charge of +2 with respect to the parent. The net charge of a parent protein can also be altered by deletion and/or insertion of charged amino acids. A net change change applies to changes in charge of a variant versus a parent when measured at the same pH conditions.

    [0116] The terms thermally stable and thermostable and thermostability refer to proteases that retain a specified amount of enzymatic activity after exposure to identified temperatures over a given period of time under conditions prevailing during the proteolytic, hydrolyzing, cleaning or other process of the invention, while being exposed to altered temperatures. Altered temperatures encompass increased or decreased temperatures. In some embodiments, the proteases retain at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 96%, about 97%, about 98%, or about 99% proteolytic activity after exposure to altered temperatures over a given time period, for example, at least about 60 minutes, about 120 minutes, about 180 minutes, about 240 minutes, about 300 minutes, etc.

    [0117] The term enhanced stability in the context of an oxidation, chelator, thermal, chemical, autolytic and/or pH stable protease refers to a higher retained proteolytic activity over time as compared to other proteases (e.g., thermolysin proteases) and/or wild-type enzymes.

    [0118] The term diminished stability in the context of an oxidation, chelator, thermal and/or pH stable protease refers to a lower retained proteolytic activity over time as compared to other proteases (e.g., thermolysin proteases) and/or wild-type enzymes.

    [0119] The term cleaning activity refers to a cleaning performance achieved by a metalloprotease polypeptide or reference protease under conditions prevailing during the proteolytic, hydrolyzing, cleaning, or other process of the invention. In some embodiments, cleaning performance of a metalloprotease polypeptide or reference protease may be determined by using various assays for cleaning one or more various enzyme sensitive stains on an item or surface (e.g., a stain resulting from food, grass, blood, ink, milk, oil, and/or egg protein). Cleaning performance of a variant or reference protease can be determined by subjecting the stain on the item or surface to standard wash condition(s) and assessing the degree to which the stain is removed by using various chromatographic, spectrophotometric, or other quantitative methodologies. Exemplary cleaning assays and methods are known in the art and include, but are not limited to those described in WO 99/34011 and U.S. Pat. No. 6,605,458, both of which are herein incorporated by reference, as well as those cleaning assays and methods included in the Examples provided below.

    [0120] The term cleaning effective amount of a metalloprotease polypeptide or reference protease refers to the amount of protease that achieves a desired level of enzymatic activity in a specific cleaning composition. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular protease used, the cleaning application, the specific composition of the cleaning composition, and whether a liquid or dry (e.g., granular, tablet, bar) composition is required, etc.

    [0121] The term cleaning adjunct material refers to any liquid, solid, or gaseous material included in cleaning composition other than a metalloprotease polypeptide of the invention. In some embodiments, the cleaning compositions of the present invention include one or more cleaning adjunct materials. Each cleaning adjunct material is typically selected depending on the particular type and form of cleaning composition (e.g., liquid, granule, powder, bar, paste, spray, tablet, gel, foam, or other composition). Preferably, each cleaning adjunct material is compatible with the protease enzyme used in the composition.

    [0122] The term enhanced performance in the context of cleaning activity refers to an increased or greater cleaning activity by an enzyme with respect to a parent or reference protein as measured on certain enzyme sensitive stains such as egg, milk, grass, ink, oil, and/or blood, as determined by usual evaluation after a standard wash cycle and/or multiple wash cycles.

    [0123] The term diminished performance in the context of cleaning activity refers to a decreased or lesser cleaning activity by an enzyme on certain enzyme sensitive stains such as egg, milk, grass or blood, as determined by usual evaluation after a standard wash cycle and/or multiple wash cycles.

    [0124] Cleaning compositions and cleaning formulations include any composition that is suited for cleaning, bleaching, disinfecting, and/or sterilizing any object, item, and/or surface. Such compositions and formulations include, but are not limited to for example, liquid and/or solid compositions, including cleaning or detergent compositions (e.g., liquid, tablet, gel, bar, granule, and/or solid laundry cleaning or detergent compositions and fine fabric detergent compositions; hard surface cleaning compositions and formulations, such as for glass, wood, ceramic and metal counter tops and windows; carpet cleaners; oven cleaners; fabric fresheners; fabric softeners; and textile, laundry booster cleaning or detergent compositions, laundry additive cleaning compositions, and laundry pre-spotter cleaning compositions; dishwashing compositions, including hand or manual dishwash compositions (e.g., hand or manual dishwashing detergents) and automatic dishwashing compositions (e.g., automatic dishwashing detergents).

    [0125] Cleaning composition or cleaning formulations, as used herein, include, unless otherwise indicated, granular or powder-form all-purpose or heavy-duty washing agents, especially cleaning detergents; liquid, granular, gel, solid, tablet, or paste-form all-purpose washing agents, especially the so-called heavy-duty liquid (HDL) detergent or heavy-duty powder detergent (HDD) types; liquid fine-fabric detergents; hand or manual dishwashing agents, including those of the high-foaming type; hand or manual dishwashing, automatic dishwashing, or dishware or tableware washing agents, including the various tablet, powder, solid, granular, liquid, gel, and rinse-aid types for household and institutional use; liquid cleaning and disinfecting agents, including antibacterial hand-wash types, cleaning bars, mouthwashes, denture cleaners, car shampoos, carpet shampoos, bathroom cleaners; hair shampoos and/or hair-rinses for humans and other animals; shower gels and foam baths and metal cleaners; as well as cleaning auxiliaries, such as bleach additives and stain-stick or pre-treat types. In some embodiments, granular compositions are in compact form; in some embodiments, liquid compositions are in a concentrated form.

    [0126] As used herein, fabric cleaning compositions include hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the soaking and/or pretreatment of stained fabrics (e.g., clothes, linens, and other textile materials).

    [0127] As used herein, non-fabric cleaning compositions include non-textile (i.e., non-fabric) surface cleaning compositions, including, but not limited to for example, hand or manual or automatic dishwashing detergent compositions, oral cleaning compositions, denture cleaning compositions, and personal cleansing compositions.

    [0128] As used herein, the term fabric and/or hard surface cleaning and/or treatment composition is a subset of cleaning and treatment compositions that includes, unless otherwise indicated, granular or powder-form all-purpose or heavy-duty washing agents, especially cleaning detergents; liquid, gel or paste-form all-purpose washing agents, especially the so-called heavy-duty liquid types; liquid fine-fabric detergents; hand dishwashing agents or light duty dishwashing agents, especially those of the high-foaming type; machine dishwashing agents, including the various tablet, granular, liquid and rinse-aid types for household and institutional use; liquid cleaning and disinfecting agents, car or carpet shampoos, bathroom cleaners including toilet bowl cleaners; fabric conditioning products including softening and/or freshening that may be in liquid, solid and/or dryer sheet form; as well as cleaning auxiliaries such as bleach additives and stain-stick or pre-treat types, substrate-laden products such as dryer added sheets. All of such products which are applicable may be in standard, concentrated or even highly concentrated form even to the extent that such products may in certain aspect be non-aqueous.

    [0129] As used herein, the term detergent composition or detergent formulation is used in reference to a composition intended for use in a wash medium for the cleaning of soiled or dirty objects, including particular fabric and/or non-fabric objects or items. Such compositions of the present invention are not limited to any particular detergent composition or formulation. Indeed, in some embodiments, the detergents of the invention comprise at least one metalloprotease polypeptide of the invention and, in addition, one or more surfactants, transferase(s), hydrolytic enzymes, oxido reductases, builders (e.g., a builder salt), bleaching agents, bleach activators, bluing agents, fluorescent dyes, caking inhibitors, masking agents, enzyme activators, antioxidants, and/or solubilizers. In some instances, a builder salt is a mixture of a silicate salt and a phosphate salt, preferably with more silicate (e.g., sodium metasilicate) than phosphate (e.g., sodium tripolyphosphate). Some compositions of the invention, such as, but not limited to, cleaning compositions or detergent compositions, do not contain any phosphate (e.g., phosphate salt or phosphate builder).

    [0130] As used herein, the term bleaching refers to the treatment of a material (e.g., fabric, laundry, pulp, etc.) or surface for a sufficient length of time and/or under appropriate pH and/or temperature conditions to effect a brightening (i.e., whitening) and/or cleaning of the material. Examples of chemicals suitable for bleaching include, but are not limited to, for example, ClO.sub.2, H.sub.2O.sub.2, peracids, NO.sub.2, etc.

    [0131] As used herein, wash performance of a protease (e.g., a metalloprotease polypeptide of the invention) refers to the contribution of a metalloprotease polypeptide to washing that provides additional cleaning performance to the detergent as compared to the detergent without the addition of the metalloprotease polypeptide to the composition. Wash performance is compared under relevant washing conditions. In some test systems, other relevant factors, such as detergent composition, sud concentration, water hardness, washing mechanics, time, pH, and/or temperature, can be controlled in such a way that condition(s) typical for household application in a certain market segment (e.g., hand or manual dishwashing, automatic dishwashing, dishware cleaning, tableware cleaning, fabric cleaning, etc.) are imitated.

    [0132] The term relevant washing conditions is used herein to indicate the conditions, particularly washing temperature, time, washing mechanics, sud concentration, type of detergent and water hardness, actually used in households in a hand dishwashing, automatic dishwashing, or laundry detergent market segment.

    [0133] The term improved wash performance is used to indicate that a better end result is obtained in stain removal under relevant washing conditions, or that less metalloprotease polypeptide, on weight basis, is needed to obtain the same end result relative to the corresponding wild-type or starting parent protease.

    [0134] As used herein, the term disinfecting refers to the removal of contaminants from the surfaces, as well as the inhibition or killing of microbes on the surfaces of items. It is not intended that the present invention be limited to any particular surface, item, or contaminant(s) or microbes to be removed.

    [0135] The compact form of the cleaning compositions herein is best reflected by density and, in terms of composition, by the amount of inorganic filler salt. Inorganic filler salts are conventional ingredients of detergent compositions in powder form. In conventional detergent compositions, the filler salts are present in substantial amounts, typically about 17 to about 35% by weight of the total composition. In contrast, in compact compositions, the filler salt is present in amounts not exceeding about 15% of the total composition. In some embodiments, the filler salt is present in amounts that do not exceed about 10%, or more preferably, about 5%, by weight of the composition. In some embodiments, the inorganic filler salts are selected from the alkali and alkaline-earth-metal salts of sulfates and chlorides. In some embodiments, the filler salt is sodium sulfate.

    [0136] As used herein in connection with a numerical value, the term about refers to a range of +/0.5 of the numerical value, unless the term is otherwise specifically defined in context. For instance, the phrase a pH value of about 6 refers to pH values of from 5.5 to 6.5, unless the pH value is specifically defined otherwise.

    [0137] The position of an amino acid residue in a given amino acid sequence is typically numbered herein using the numbering of the position of the corresponding amino acid residue of the wild type metalloprotease amino acid sequence. The wild type amino acid sequence thus serves as a reference parent sequence. A given amino acid sequence, such as a metalloprotease enzyme amino acid sequence and variants thereof described herein, can be aligned with the corresponding wild type metalloprotease using an alignment algorithm as described herein, and an amino acid residue in the given amino acid sequence that aligns (preferably optimally aligns) with an amino acid residue in the wild type sequence can be conveniently numbered by reference to the corresponding amino acid residue in the wild type metalloprotease sequence.

    [0138] Oligonucleotide synthesis and purification steps are typically performed according to specifications. Techniques and procedures are generally performed according to conventional methods well known in the art and various general references that are provided throughout this document. Procedures therein are believed to be well known to those of ordinary skill in the art and are provided for the convenience of the reader.

    Metalloprotease Polypeptides of the Present Invention

    [0139] The present invention provides novel metalloprotease enzyme polypeptides, which may be collectively referred to as enzymes of the invention or polypeptides of the invention. Polypeptides of the invention include isolated, recombinant, substantially pure, or non-naturally occurring polypeptides. In some embodiments, polypeptides of the invention are useful in cleaning applications and can be incorporated into cleaning compositions that are useful in methods of cleaning an item or a surface in need of cleaning.

    [0140] In some embodiments, the enzyme of the present invention has 50, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to SEQ ID NO: 3. In some embodiments, the enzyme of the present invention has 50, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to SEQ ID NO: 6. In some embodiments, the enzyme of the present invention has 50, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to SEQ ID NO: 9. In some embodiments, the enzyme of the present invention has 50, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to SEQ ID NO: 14. In various embodiments, the enzyme of the present invention has 50, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to a metalloprotease enzyme from any genus in Table 1.2, 2.2 and 3.2.

    [0141] In some embodiments, the enzyme of the present invention, including all embodiments supra, can be derived from a member of the order Bacillales or family Bacillaceae, Paenibacillaceae, or Thermoactinomycetaceae. In some embodiments, the enzyme of the present invention, including all embodiments supra, can be derived from a Bacillus, Brevibacillus, Geobacillus, Paenibacillus, or Anoxybacillus, Lysinibacillus species. In some embodiments, the enzyme of the present invention, including all embodiments supra, can be derived from a member of the Thermoactinomycetaceae family. Various enzyme metalloproteases have been found that have a high identity to each other and to the Anoxybacillus enzyme from Anoxybacillus rupiensis as shown in SEQ ID NO: 3 or 6, or to the Lysinibacillus enzyme from Lysinibacillus macroides as shown in SEQ ID NO: 9, or to the Brevibacillus enzyme from Brevibacillus brevis as shown in SEQ ID NO: 14. See, for example, Tables 1.2, 2.2 and 3.2.

    [0142] In a particular embodiment, the invention is an enzyme derived from the genus Anoxybacillus. In a particular embodiment, the invention is an enzyme derived from the genus Anoxybacillus and from the species Anoxybacillus rupiensis. In a particular embodiment, the invention is an enzyme derived from the genus Lysinibacillus. In a particular embodiment, the invention is an enzyme derived from the genus Lysinibacillus and from the species Lysinibacillus macroides. In a particular embodiment, the invention is an enzyme derived from the genus Brevibacillus. In a particular embodiment, the invention is an enzyme derived from the genus Brevibacillus and from the species Brevibacillus brevis.

    [0143] Described are compositions and methods relating to these enzymes. The compositions and methods are based, in part, on the observation that cloned and expressed enzymes of the present invention have proteolytic activity in the presence of a detergent composition. Enzymes of the present invention also demonstrate excellent stability in detergent compositions. These features makes enzymes of the present invention well suited for use in a variety of cleaning applications, where the enzyme can hydrolyze proteins in the presence of surfactants and other components found in detergent compositions.

    [0144] In some embodiments, the invention includes an isolated, recombinant, substantially pure, or non-naturally occurring enzyme having protease activity, which polypeptide comprises a polypeptide sequence having at least about 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a parent enzyme as provided herein.

    [0145] In some embodiments, the polypeptide of the present invention, is a polypeptide having a specified degree of amino acid sequence homology to the exemplified polypeptides, e.g., at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99% sequence homology to the amino acid sequences of SEQ ID NOs: 3, 6, 9 or 14. Homology can be determined by amino acid sequence alignment, e.g., using a program such as BLAST, ALIGN, or CLUSTAL, as described herein.

    [0146] Also provided is a polypeptide enzyme of the present invention, having protease activity, said enzyme comprising an amino acid sequence which differs from the amino acid sequences of SEQ ID NO:3, 6, 9 or 14 by no more than 50, no more than 40, no more than 30, no more than 35, no more than 25, no more than 20, no more than 19, no more than 18, no more than 17, no more than 16, no more than 15, no more than 14, no more than 13, no more than 12, no more than 11, no more than 10, no more than 9, no more than 8, no more than 7, no more than 6, no more than 5, no more than 4, no more than 3, no more than 2, or no more than 1 amino acid residue(s), when aligned using any of the previously described alignment methods.

    [0147] As noted above, the variant enzyme polypeptides of the invention have enzymatic activities (e.g., protease activities) and thus are useful in cleaning applications, including but not limited to, methods for cleaning dishware items, tableware items, fabrics, and items having hard surfaces (e.g., the hard surface of a table, table top, wall, furniture item, floor, ceiling, etc.). Exemplary cleaning compositions comprising one or more variant metalloprotease enzyme polypeptides of the invention are described infra. The enzymatic activity (e.g., protease enzyme activity) of an enzyme polypeptide of the invention can be determined readily using procedures well known to those of ordinary skill in the art. The Examples presented infra describe methods for evaluating the enzymatic activity and cleaning performance. The performance of polypeptide enzymes of the invention in removing stains (e.g., a protein stain such as blood/milk/ink or egg yolk), cleaning hard surfaces, or cleaning laundry, dishware or tableware item(s) can be readily determined using procedures well known in the art and/or by using procedures set forth in the Examples.

    [0148] The metalloprotease polypeptides of the invention have protease activity such that they are useful in casein hydrolysis, collagen hydrolysis, elastin hydrolysis, keratin hydrolysis, soy protein hydrolysis or corn meal protein hydrolysis. Thus, the polypeptides of the invention find use in other applications such as pretreatments for food, feed, or protein degradation.

    [0149] The polypeptides of the invention are also useful in pretreatment of animal feed products, such as soy protein, corn meal, and other protein rich components. Pretreatment of these animal feed products with a polypeptide of the invention may help in the breakdown of complex proteins into their hydrolysates which are easily digestible by animals.

    [0150] In yet other embodiments, the disclosed metalloprotease polypeptides find use in hydrolysis of corn soy protein. The disclosed metalloprotease polypeptides may be used alone or in combination with other proteases, amylases or lipases to produce peptides and free amino acids from the corn or soy protein. In some embodiments, the recovered proteins, peptides or amino acids can be subsequently used in animal feed or human food products.

    [0151] The polypeptides of the invention are also useful in treatment of wounds, particularly in wound debridement. Wound debridement is the removal of dead, damaged or infected tissue to improve the healing potential of the remaining healthy tissue. Debridement is an important part of the healing process for burns and other serious wounds. The wounds or burns may be treated with a composition comprising a polypeptide of the invention which would result in removal of unwanted damaged tissue and improving the healthy tissue.

    [0152] The metalloprotease polypeptides of the present invention can have protease activity over a broad range of pH conditions. In some embodiments, the metalloprotease polypeptides have protease activity on azo-casein as a substrate, as demonstrated in Example 3. In some embodiments, the metalloprotease polypeptides have protease activity at a pH of from about 3.0 to about 12.0. In some embodiments, the metalloprotease polypeptides have protease activity at a pH of from about 4.0 to about 10.5. In some embodiments, the metalloprotease polypeptides have at least 70% of maximal protease activity at a pH of from about 5.5 to about 8.5. In some embodiments, the metalloprotease polypeptides have at least 80% of maximal protease activity at a pH of from about 6.0 to about 8.0. In some embodiments, the metalloprotease polypeptides have maximal protease activity at a pH of about 7.0.

    [0153] In some embodiments, the metalloprotease polypeptides of the present invention have protease activity at a temperature range of from about 10 C. to about 100 C. In some embodiments, the metalloprotease polypeptides of the present invention have protease activity at a temperature range of from about 20 C. to about 90 C. In some embodiments, the metalloprotease polypeptides have at least 70% of maximal protease activity at a temperature of from about 50 C. to about 75 C. In some embodiments, the metalloprotease polypeptides have maximal protease activity at a temperature of 60 C.

    [0154] In some embodiments, the metalloprotease polypeptides of the present invention demonstrate cleaning performance in a cleaning composition. Cleaning compositions often include ingredients harmful to the stability and performance of enzymes, making cleaning compositions a harsh environment for enzymes, e.g. metalloproteases, to retain function. Thus, it is not trivial for an enzyme to be put in a cleaning composition and expect enzymatic function (e.g. metalloprotease activity, such as demonstrated by cleaning performance). In some embodiments, the metalloprotease polypeptides of the present invention demonstrate cleaning performance in automatic dishwashing (ADW) detergent compositions. In some embodiments, the cleaning performance in automatic dishwashing (ADW) detergent compositions includes cleaning of egg yolk stains. In some embodiments, the metalloprotease polypeptides of the present invention demonstrate cleaning performance in laundry detergent compositions. In some embodiments, the cleaning performance in laundry detergent compositions includes cleaning of blood/milk/ink stains. In each of the cleaning compositions, the metalloprotease polypeptides of the present invention demonstrate cleaning performance with or without a bleach component.

    [0155] A polypeptide of the invention can be subject to various changes, such as one or more amino acid insertions, deletions, and/or substitutions, either conservative or non-conservative, including where such changes do not substantially alter the enzymatic activity of the polypeptide. Similarly, a nucleic acid of the invention can also be subject to various changes, such as one or more substitutions of one or more nucleotides in one or more codons such that a particular codon encodes the same or a different amino acid, resulting in either a silent variation (e.g., when the encoded amino acid is not altered by the nucleotide mutation) or non-silent variation, one or more deletions of one or more nucleic acids (or codons) in the sequence, one or more additions or insertions of one or more nucleic acids (or codons) in the sequence, and/or cleavage of or one or more truncations of one or more nucleic acids (or codons) in the sequence. Many such changes in the nucleic acid sequence may not substantially alter the enzymatic activity of the resulting encoded polypeptide enzyme compared to the polypeptide enzyme encoded by the original nucleic acid sequence. A nucleic acid sequence of the invention can also be modified to include one or more codons that provide for optimum expression in an expression system (e.g., bacterial expression system), while, if desired, said one or more codons still encode the same amino acid(s).

    [0156] In some embodiments, the present invention provides a genus of enzyme polypeptides having the desired enzymatic activity (e.g., protease enzyme activity or cleaning performance activity) which comprise sequences having the amino acid substitutions described herein and also which comprise one or more additional amino acid substitutions, such as conservative and non-conservative substitutions, wherein the polypeptide exhibits, maintains, or approximately maintains the desired enzymatic activity (e.g., proteolytic activity, as reflected in the cleaning activity or performance of the polypeptide enzyme). Amino acid substitutions in accordance with the invention may include, but are not limited to, one or more non-conservative substitutions and/or one or more conservative amino acid substitutions. A conservative amino acid residue substitution typically involves exchanging a member within one functional class of amino acid residues for a residue that belongs to the same functional class (conservative amino acid residues are considered functionally homologous or conserved in calculating percent functional homology). A conservative amino acid substitution typically involves the substitution of an amino acid in an amino acid sequence with a functionally similar amino acid. For example, alanine, glycine, serine, and threonine are functionally similar and thus may serve as conservative amino acid substitutions for one another. Aspartic acid and glutamic acid may serve as conservative substitutions for one another. Asparagine and glutamine may serve as conservative substitutions for one another. Arginine, lysine, and histidine may serve as conservative substitutions for one another. Isoleucine, leucine, methionine, and valine may serve as conservative substitutions for one another. Phenylalanine, tyrosine, and tryptophan may serve as conservative substitutions for one another.

    [0157] Other conservative amino acid substitution groups can be envisioned. For example, amino acids can be grouped by similar function or chemical structure or composition (e.g., acidic, basic, aliphatic, aromatic, sulfur-containing). For instance, an aliphatic grouping may comprise: Glycine (G), Alanine (A), Valine (V), Leucine (L), Isoleucine (I). Other groups containing amino acids that are considered conservative substitutions for one another include: aromatic: Phenylalanine (F), Tyrosine (Y), Tryptophan (W); sulfur-containing: Methionine (M), Cysteine (C); Basic: Arginine (R), Lysine (K), Histidine (H); Acidic: Aspartic acid (D), Glutamic acid (E); non-polar uncharged residues, Cysteine (C), Methionine (M), and Proline (P); hydrophilic uncharged residues: Serine (S), Threonine (T), Asparagine (N), and Glutamine (Q). Additional groupings of amino acids are well-known to those of skill in the art and described in various standard textbooks. Listing of a polypeptide sequence herein, in conjunction with the above substitution groups, provides an express listing of all conservatively substituted polypeptide sequences.

    [0158] More conservative substitutions exist within the amino acid residue classes described above, which also or alternatively can be suitable. Conservation groups for substitutions that are more conservative include: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.

    [0159] Conservatively substituted variations of a polypeptide sequence of the invention (e.g., variant metalloproteases of the invention) include substitutions of a small percentage, sometimes less than 25%, 20%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, or 6% of the amino acids of the polypeptide sequence, or less than 5%, 4%, 3%, 2%, or 1%, or less than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid substitution of the amino acids of the polypeptide sequence, with a conservatively selected amino acid of the same conservative substitution group.

    [0160] As described elsewhere herein in greater detail and in the Examples provided herein, polypeptides of the invention may have cleaning abilities that may be compared to known proteases, including known metalloproteases.

    Nucleic Acids of the Invention

    [0161] The invention provides isolated, non-naturally occurring, or recombinant nucleic acids which may be collectively referred to as nucleic acids of the invention or polynucleotides of the invention, which encode polypeptides of the invention. Nucleic acids of the invention, including all described below, are useful in recombinant production (e.g., expression) of polypeptides of the invention, typically through expression of a plasmid expression vector comprising a sequence encoding the polypeptide of interest or fragment thereof. As discussed above, polypeptides include metalloprotease polypeptides having enzymatic activity (e.g., proteolytic activity) which are useful in cleaning applications and cleaning compositions for cleaning an item or a surface (e.g., surface of an item) in need of cleaning.

    [0162] In some embodiments, the invention provides an isolated, recombinant, substantially pure, or non-naturally occurring nucleic acid comprising a nucleotide sequence encoding any polypeptide (including any fusion protein, etc.) of the invention described above in the section entitled Polypeptides of the Invention and elsewhere herein. The invention also provides an isolated, recombinant, substantially pure, or non-naturally-occurring nucleic acid comprising a nucleotide sequence encoding a combination of two or more of any polypeptides of the invention described above and elsewhere herein. In some embodiments, the nucleic acids of the present invention has 50, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to SEQ ID NO: 4, 10 or 15.

    [0163] The present invention provides nucleic acids encoding a metalloprotease polypeptide of the present invention, wherein the metalloprotease polypeptide is a mature form having proteolytic activity, wherein the amino acid positions of the thermolysin variant are numbered by correspondence with the amino acid sequences of metalloprotease polypeptides set forth as SEQ ID NO: 6, 9 or 14.

    [0164] Nucleic acids of the invention can be generated by using any suitable synthesis, manipulation, and/or isolation techniques, or combinations thereof. For example, a polynucleotide of the invention may be produced using standard nucleic acid synthesis techniques, such as solid-phase synthesis techniques that are well-known to those skilled in the art. In such techniques, fragments of up to 50 or more nucleotide bases are typically synthesized, then joined (e.g., by enzymatic or chemical ligation methods) to form essentially any desired continuous nucleic acid sequence. The synthesis of the nucleic acids of the invention can be also facilitated by any suitable method known in the art, including but not limited to chemical synthesis using the classical phosphoramidite method (See e.g., Beaucage et al. Tetrahedron Letters 22:1859-69 [1981]); or the method described by Matthes et al. (See, Matthes et al., EMBO J. 3:801-805 [1984], as is typically practiced in automated synthetic methods. Nucleic acids of the invention also can be produced by using an automatic DNA synthesizer. Customized nucleic acids can be ordered from a variety of commercial sources (e.g., The Midland Certified Reagent Company, the Great American Gene Company, Operon Technologies Inc., and DNA2.0). Other techniques for synthesizing nucleic acids and related principles are known in the art (See e.g., Itakura et al., Ann. Rev. Biochem. 53:323 [1984]; and Itakura et al., Science 198:1056 [1984]).

    [0165] As indicated above, recombinant DNA techniques useful in modification of nucleic acids are well known in the art. For example, techniques such as restriction endonuclease digestion, ligation, reverse transcription and cDNA production, and polymerase chain reaction (e.g., PCR) are known and readily employed by those of skill in the art. Nucleotides of the invention may also be obtained by screening cDNA libraries using one or more oligonucleotide probes that can hybridize to or PCR-amplify polynucleotides which encode a metalloprotease polypeptide polypeptide(s) of the invention. Procedures for screening and isolating cDNA clones and PCR amplification procedures are well known to those of skill in the art and described in standard references known to those skilled in the art. Some nucleic acids of the invention can be obtained by altering a naturally occurring polynucleotide backbone (e.g., that encodes an enzyme or parent protease) by, for example, a known mutagenesis procedure (e.g., site-directed mutagenesis, site saturation mutagenesis, and in vitro recombination).

    Methods for Making Modified Metalloprotease Polypeptides of the Invention

    [0166] A variety of methods are known in the art that are suitable for generating modified polynucleotides of the invention that encode metalloprotease polypeptides of the invention, including, but not limited to, for example, site-saturation mutagenesis, scanning mutagenesis, insertional mutagenesis, deletion mutagenesis, random mutagenesis, site-directed mutagenesis, and directed-evolution, as well as various other recombinatorial approaches. Methods for making modified polynucleotides and proteins (e.g., metalloprotease polypeptides) include DNA shuffling methodologies, methods based on non-homologous recombination of genes, such as ITCHY (See, Ostermeier et al., 7:2139-44 [1999]), SCRACHY (See, Lutz et al. 98:11248-53 [2001]), SHIPREC (See, Sieber et al., 19:456-60 [2001]), and NRR (See, Bittker et al., 20:1024-9 [2001]; Bittker et al., 101:7011-6 [2004]), and methods that rely on the use of oligonucleotides to insert random and targeted mutations, deletions and/or insertions (See, Ness et al., 20:1251-5 [2002]; Coco et al., 20:1246-50 [2002]; Zha et al., 4:34-9 [2003]; Glaser et al., 149:3903-13 [1992]).

    Vectors, Cells, and Methods for Producing Metalloprotease Polypeptides of the Invention

    [0167] The present invention provides vectors comprising at least one metalloprotease polynucleotide of the invention described herein (e.g., a polynucleotide encoding a metalloprotease polypeptide of the invention described herein), expression vectors or expression cassettes comprising at least one nucleic acid or polynucleotide of the invention, isolated, substantially pure, or recombinant DNA constructs comprising at least one nucleic acid or polynucleotide of the invention, isolated or recombinant cells comprising at least one polynucleotide of the invention, and compositions comprising one or more such vectors, nucleic acids, expression vectors, expression cassettes, DNA constructs, cells, cell cultures, or any combination or mixtures thereof.

    [0168] In some embodiments, the invention provides recombinant cells comprising at least one vector (e.g., expression vector or DNA construct) of the invention which comprises at least one nucleic acid or polynucleotide of the invention. Some such recombinant cells are transformed or transfected with such at least one vector. Such cells are typically referred to as host cells. Some such cells comprise bacterial cells, including, but are not limited to Bacillus sp. cells, such as B. subtilis cells. The invention also provides recombinant cells (e.g., recombinant host cells) comprising at least one metalloprotease polypeptide of the invention.

    [0169] In some embodiments, the invention provides a vector comprising a nucleic acid or polynucleotide of the invention. In some embodiments, the vector is an expression vector or expression cassette in which a polynucleotide sequence of the invention which encodes a metalloprotease polypeptide of the invention is operably linked to one or additional nucleic acid segments required for efficient gene expression (e.g., a promoter operably linked to the polynucleotide of the invention which encodes a metalloprotease polypeptide of the invention). A vector may include a transcription terminator and/or a selection gene, such as an antibiotic resistance gene, that enables continuous cultural maintenance of plasmid-infected host cells by growth in antimicrobial-containing media.

    [0170] An expression vector may be derived from plasmid or viral DNA, or in alternative embodiments, contains elements of both. Exemplary vectors include, but are not limited to pC194, pJH101, pE194, pHP13 (See, Harwood and Cutting [eds.], Chapter 3, Molecular Biological Methods for Bacillus, John Wiley & Sons [1990]; suitable replicating plasmids for B. subtilis include those listed on p. 92) See also, Perego, Integrational Vectors for Genetic Manipulations in Bacillus subtilis, in Sonenshein et al., [eds.] Bacillus subtilis and Other Gram-Positive Bacteria: Biochemistry, Physiology and Molecular Genetics, American Society for Microbiology, Washington, D.C. [1993], pp. 615-624), and p2JM103BBI.

    [0171] For expression and production of a protein of interest (e.g., metalloprotease polypeptide) in a cell, at least one expression vector comprising at least one copy of a polynucleotide encoding the metalloprotease polypeptide, and in some instances comprising multiple copies, is transformed into the cell under conditions suitable for expression of the metalloprotease. In some embodiments of the present invention, a polynucleotide sequence encoding the metalloprotease polypeptide (as well as other sequences included in the vector) is integrated into the genome of the host cell, while in other embodiments, a plasmid vector comprising a polynucleotide sequence encoding the metalloprotease polypeptide remains as autonomous extra-chromosomal element within the cell. The invention provides both extrachromosomal nucleic acid elements as well as incoming nucleotide sequences that are integrated into the host cell genome. The vectors described herein are useful for production of the metalloprotease polypeptides of the invention. In some embodiments, a polynucleotide construct encoding the metalloprotease polypeptide is present on an integrating vector that enables the integration and optionally the amplification of the polynucleotide encoding the metalloprotease polypeptide into the host chromosome. Examples of sites for integration are well known to those skilled in the art. In some embodiments, transcription of a polynucleotide encoding a metalloprotease polypeptide of the invention is effectuated by a promoter that is the wild-type promoter for the selected precursor protease. In some other embodiments, the promoter is heterologous to the precursor protease, but is functional in the host cell. Specifically, examples of suitable promoters for use in bacterial host cells include, but are not limited to, for example, the amyE, amyQ, amyL, pstS, sacB, pSPAC, pAprE, pVeg, pHpaII promoters, the promoter of the B. stearothermophilus maltogenic amylase gene, the B. amyloliquefaciens (BAN) amylase gene, the B. subtilis alkaline protease gene, the B. clausii alkaline protease gene the B. pumilis xylosidase gene, the B. thuringiensis cryIIIA, and the B. licheniformis alpha-amylase gene. Additional promoters include, but are not limited to the A4 promoter, as well as phage Lambda PR or PL promoters, and the E. coli lac, trp or tac promoters.

    [0172] Metalloprotease polypeptides of the present invention can be produced in host cells of any suitable microorganism, including bacteria and fungi. In some embodiments, metalloprotease polypeptides of the present invention can be produced in Gram-positive bacteria. In some embodiments, the host cells are Bacillus spp., Streptomyces spp., Escherichia spp., Aspergillus spp., Trichoderma spp., Pseudomonas spp., Corynebacterium spp., Saccharomyces spp., or Pichia spp. In some embodiments, the metalloprotease polypeptides are produced by Bacillus sp. host cells. Examples of Bacillus sp. host cells that find use in the production of the metalloprotease polypeptides of the invention include, but are not limited to B. licheniformis, B. lentus, B. subtilis, B. amyloliquefaciens, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B. coagulans, B. circulans, B. pumilis, B. thuringiensis, B. clausii, and B. megaterium, as well as other organisms within the genus Bacillus. In some embodiments, B. subtilis host cells are used for production of metalloprotease polypeptides. U.S. Pat. Nos. 5,264,366 and 4,760,025 (RE 34,606) describe various Bacillus host strains that can be used for producing metalloprotease polypeptide of the invention, although other suitable strains can be used.

    [0173] Several bacterial strains that can be used to produce metalloprotease polypeptides of the invention include non-recombinant (i.e., wild-type) Bacillus sp. strains, as well as variants of naturally-occurring strains and/or recombinant strains. In some embodiments, the host strain is a recombinant strain, wherein a polynucleotide encoding a polypeptide of interest has been introduced into the host. In some embodiments, the host strain is a B. subtilis host strain and particularly a recombinant Bacillus subtilis host strain. Numerous B. subtilis strains are known, including, but not limited to for example, 1A6 (ATCC 39085), 168 (1A01), SB19, W23, Ts85, B637, PB1753 through PB1758, PB3360, JH642, 1A243 (ATCC 39,087), ATCC 21332, ATCC 6051, MI113, DE100 (ATCC 39,094), GX4931, PBT 110, and PEP 211strain (See e.g., Hoch et al., Genetics 73:215-228 [1973]; See also, U.S. Pat. Nos. 4,450,235 and 4,302,544, and EP 0134048, each of which is incorporated by reference in its entirety). The use of B. subtilis as an expression host cells is well known in the art (See e.g., Palva et al., Gene 19:81-87 [1982]; Fahnestock and Fischer, J. Bacteriol., 165:796-804 [1986]; and Wang et al., Gene 69:39-47 [1988]).

    [0174] In some embodiments, the Bacillus host cell is a Bacillus sp. that includes a mutation or deletion in at least one of the following genes, degU, degS, degR and degQ. In some embodiments, the mutation is in a degU gene, and in some embodiments the mutation is degU(Hy)32 (See e.g., Msadek et al., J. Bacteriol. 172:824-834 [1990]; and Olmos et al., Mol. Gen. Genet. 253:562-567 [1997]). In some embodiments, the Bacillus host comprises a mutation or deletion in scoC4 (See e.g., Caldwell et al., J. Bacteriol. 183:7329-7340 [2001]); spoIIE (See e.g., Arigoni et al., Mol. Microbiol. 31:1407-1415 [1999]); and/or oppA or other genes of the opp operon (See e.g., Perego et al., Mol. Microbiol. 5:173-185 [1991]). Indeed, it is contemplated that any mutation in the opp operon that causes the same phenotype as a mutation in the oppA gene will find use in some embodiments of the altered Bacillus strain of the invention. In some embodiments, these mutations occur alone, while in other embodiments, combinations of mutations are present. In some embodiments, an altered Bacillus host cell strain that can be used to produce a metalloprotease polypeptide of the invention is a Bacillus host strain that already includes a mutation in one or more of the above-mentioned genes. In addition, Bacillus sp. host cells that comprise mutation(s) and/or deletions of endogenous protease genes find use. In some embodiments, the Bacillus host cell comprises a deletion of the aprE and the nprE genes. In other embodiments, the Bacillus sp. host cell comprises a deletion of 5 protease genes, while in other embodiments, the Bacillus sp. host cell comprises a deletion of 9 protease genes (See e.g., U.S. Pat. Appln. Pub. No. 2005/0202535, incorporated herein by reference).

    [0175] Host cells are transformed with at least one nucleic acid encoding at least one metalloprotease polypeptide of the invention using any suitable method known in the art. Methods for introducing a nucleic acid (e.g., DNA) into Bacillus cells or E. coli cells utilizing plasmid DNA constructs or vectors and transforming such plasmid DNA constructs or vectors into such cells are well known. In some embodiments, the plasmids are subsequently isolated from E. coli cells and transformed into Bacillus cells. However, it is not essential to use intervening microorganisms such as E. coli, and in some embodiments, a DNA construct or vector is directly introduced into a Bacillus host.

    [0176] Those of skill in the art are well aware of suitable methods for introducing nucleic acid sequences of the invention into Bacillus cells (See e.g., Ferrari et al., Genetics, in Harwood et al. [eds.], Bacillus, Plenum Publishing Corp. [1989], pp. 57-72; Saunders et al., J. Bacteriol. 157:718-726 [1984]; Hoch et al., J. Bacteriol. 93:1925-1937 [1967]; Mann et al., Current Microbiol. 13:131-135 [1986]; Holubova, Folia Microbiol. 30:97 [1985]; Chang et al., Mol. Gen. Genet. 168:11-115 [1979]; Vorobjeva et al., FEMS Microbiol. Lett. 7:261-263 [1980]; Smith et al., Appl. Env. Microbiol. 51:634 [1986]; Fisher et al., Arch. Microbiol. 139:213-217 [1981]; and McDonald, J. Gen. Microbiol. 130:203 [1984]). Indeed, such methods as transformation, including protoplast transformation and transfection, transduction, and protoplast fusion are well known and suited for use in the present invention. Methods known in the art to transform Bacillus cells include such methods as plasmid marker rescue transformation, which involves the uptake of a donor plasmid by competent cells carrying a partially homologous resident plasmid (See, Contente et al., Plasmid 2:555-571 [1979]; Haima et al., Mol. Gen. Genet. 223:185-191 [1990]; Weinrauch et al., J. Bacteriol. 154:1077-1087 [1983]; and Weinrauch et al., J. Bacteriol. 169:1205-1211 [1987]). In this method, the incoming donor plasmid recombines with the homologous region of the resident helper plasmid in a process that mimics chromosomal transformation.

    [0177] In addition to commonly used methods, in some embodiments, host cells are directly transformed with a DNA construct or vector comprising a nucleic acid encoding a metalloprotease polypeptide of the invention (i.e., an intermediate cell is not used to amplify, or otherwise process, the DNA construct or vector prior to introduction into the host cell). Introduction of the DNA construct or vector of the invention into the host cell includes those physical and chemical methods known in the art to introduce a nucleic acid sequence (e.g., DNA sequence) into a host cell without insertion into the host genome. Such methods include, but are not limited to calcium chloride precipitation, electroporation, naked DNA, liposomes and the like. In additional embodiments, DNA constructs or vector are co-transformed with a plasmid, without being inserted into the plasmid. In further embodiments, a selective marker is deleted from the altered Bacillus strain by methods known in the art (See, Stahl et al., J. Bacteriol. 158:411-418 [1984]; and Palmeros et al., Gene 247:255-264 [2000]).

    [0178] In some embodiments, the transformed cells of the present invention are cultured in conventional nutrient media. The suitable specific culture conditions, such as temperature, pH and the like are known to those skilled in the art and are well described in the scientific literature. In some embodiments, the invention provides a culture (e.g., cell culture) comprising at least one metalloprotease polypeptide or at least one nucleic acid of the invention.

    [0179] In some embodiments, host cells transformed with at least one polynucleotide sequence encoding at least one metalloprotease polypeptide of the invention are cultured in a suitable nutrient medium under conditions permitting the expression of the present protease, after which the resulting protease is recovered from the culture. In some embodiments, the protease produced by the cells is recovered from the culture medium by conventional procedures, including, but not limited to for example, separating the host cells from the medium by centrifugation or filtration, precipitating the proteinaceous components of the supernatant or filtrate by means of a salt (e.g., ammonium sulfate), chromatographic purification (e.g., ion exchange, gel filtration, affinity, etc.).

    [0180] In some embodiments, a metalloprotease polypeptide produced by a recombinant host cell is secreted into the culture medium. A nucleic acid sequence that encodes a purification facilitating domain may be used to facilitate purification of proteins. A vector or DNA construct comprising a polynucleotide sequence encoding a metalloprotease polypeptide may further comprise a nucleic acid sequence encoding a purification facilitating domain to facilitate purification of the metalloprotease polypeptide (See e.g., Kroll et al., DNA Cell Biol. 12:441-53 [1993]). Such purification facilitating domains include, but are not limited to, for example, metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilized metals (See, Porath, Protein Expr. Purif. 3:263-281 [1992]), protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system. The inclusion of a cleavable linker sequence such as Factor XA or enterokinase (e.g., sequences available from Invitrogen, San Diego, Calif.) between the purification domain and the heterologous protein also find use to facilitate purification.

    [0181] Assays for detecting and measuring the enzymatic activity of an enzyme, such as a metalloprotease polypeptide of the invention, are well known. Various assays for detecting and measuring activity of proteases (e.g., metalloprotease polypeptides of the invention), are also known to those of ordinary skill in the art. In particular, assays are available for measuring protease activity that are based on the release of acid-soluble peptides from casein or hemoglobin, measured as absorbance at 280 nm or colorimetrically using the Folin method. Other exemplary assays involve the solubilization of chromogenic substrates (See e.g., Ward, Proteinases, in Fogarty (ed.), Microbial Enzymes and Biotechnology, Applied Science, London, [1983], pp. 251-317). Other exemplary assays include, but are not limited to succinyl-Ala-Ala-Pro-Phe-para nitroanilide assay (suc-AAPF-pNA)(SEQ ID NO: 27) and the 2,4,6-trinitrobenzene sulfonate sodium salt assay (TNBS assay). Numerous additional references known to those in the art provide suitable methods (See e.g., Wells et al., Nucleic Acids Res. 11:7911-7925 [1983]; Christianson et al., Anal. Biochem. 223:119-129 [1994]; and Hsia et al., Anal Biochem. 242:221-227 [1999]).

    [0182] A variety of methods can be used to determine the level of production of a mature protease (e.g., mature metalloprotease polypeptides of the present invention) in a host cell. Such methods include, but are not limited to, for example, methods that utilize either polyclonal or monoclonal antibodies specific for the protease. Exemplary methods include, but are not limited to enzyme-linked immunosorbent assays (ELISA), radioimmunoassays (MA), fluorescent immunoassays (FIA), and fluorescent activated cell sorting (FACS). These and other assays are well known in the art (See e.g., Maddox et al., J. Exp. Med. 158:1211 [1983]).

    [0183] In some other embodiments, the invention provides methods for making or producing a mature metalloprotease polypeptide of the invention. A mature metalloprotease polypeptide does not include a signal peptide or a propeptide sequence. Some methods comprise making or producing a metalloprotease polypeptide of the invention in a recombinant bacterial host cell, such as for example, a Bacillus sp. cell (e.g., a B. subtilis cell). In some embodiments, the invention provides a method of producing a metalloprotease polypeptide of the invention, the method comprising cultivating a recombinant host cell comprising a recombinant expression vector comprising a nucleic acid encoding a metalloprotease polypeptide of the invention under conditions conducive to the production of the metalloprotease polypeptide. Some such methods further comprise recovering the metalloprotease polypeptide from the culture.

    [0184] In some embodiments the invention provides methods of producing a metalloprotease polypeptide of the invention, the methods comprising: (a) introducing a recombinant expression vector comprising a nucleic acid encoding a metalloprotease polypeptide of the invention into a population of cells (e.g., bacterial cells, such as B. subtilis cells); and (b) culturing the cells in a culture medium under conditions conducive to produce the metalloprotease polypeptide encoded by the expression vector. Some such methods further comprise: (c) isolating the metalloprotease polypeptide from the cells or from the culture medium.

    Fabric and Home Care Products

    [0185] In some embodiments, the metalloprotease polypeptides of the present invention can be used in compositions comprising an adjunct material and a metalloprotease polypeptide, wherein the composition is a fabric and home care product.

    [0186] In some embodiments, the fabric and home care product compositions comprising at least one metalloprotease polypeptide comprise one or more of the following ingredients (based on total composition weight): from about 0.0005 wt % to about 0.1 wt %, from about 0.001 wt % to about 0.05 wt %, or even from about 0.002 wt % to about 0.03 wt % of said metalloprotease polypeptide; and one or more of the following: from about 0.00003 wt % to about 0.1 wt % fabric hueing agent; from about 0.001 wt % to about 5 wt %, perfume capsules; from about 0.001 wt % to about 1 wt %, cold-water soluble brighteners; from about 0.00003 wt % to about 0.1 wt % bleach catalysts; from about 0.00003 wt % to about 0.1 wt % first wash lipases; from about 0.00003 wt % to about 0.1 wt % bacterial cleaning cellulases; and/or from about 0.05 wt % to about 20 wt % Guerbet nonionic surfactants.

    [0187] In some embodiments, the fabric and home care product composition is a liquid laundry detergent or a dishwashing detergent, such as an automatic dishwashing (ADW) detergent or hand dishwashing detergent.

    [0188] It is intended that the fabric and home care product is provided in any suitable form, including a fluid or solid, or granular, powder, solid, bar, liquid, tablet, gel, or paste form. The fabric and home care product may be in the form of a unit dose pouch, especially when in the form of a liquid, and typically the fabric and home care product is at least partially, or even completely, enclosed by a water-soluble pouch. In addition, in some embodiments of the fabric and home care products comprising at least one metalloprotease polypeptide, the fabric and home care product may have any combination of parameters and/or characteristics detailed above.

    Compositions Having the Metalloprotease Polypeptide of the Present Invention

    [0189] Unless otherwise noted, all component or composition levels provided herein are made in reference to the active level of that component or composition, and are exclusive of impurities, for example, residual solvents or by-products, which may be present in commercially available sources. Enzyme components weights are based on total active protein. All percentages and ratios are calculated by weight unless otherwise indicated. All percentages and ratios are calculated based on the total composition unless otherwise indicated. Compositions of the invention include cleaning compositions, such as detergent compositions. In the exemplified detergent compositions, the enzymes levels are expressed by pure enzyme by weight of the total composition and unless otherwise specified, the detergent ingredients are expressed by weight of the total compositions.

    [0190] As indicated herein, in some embodiments, the cleaning compositions of the present invention further comprise adjunct materials including, but not limited to, surfactants, builders, bleaches, bleach activators, bleach catalysts, other enzymes, enzyme stabilizing systems, chelants, optical brighteners, soil release polymers, dye transfer agents, dispersants, suds suppressors, dyes, perfumes, colorants, filler salts, hydrotropes, photoactivators, fluorescers, fabric conditioners, hydrolyzable surfactants, preservatives, anti-oxidants, anti-shrinkage agents, anti-wrinkle agents, germicides, fungicides, color speckles, silvercare, anti-tarnish and/or anti-corrosion agents, alkalinity sources, solubilizing agents, carriers, processing aids, pigments, and pH control agents (See e.g., U.S. Pat. Nos. 6,610,642, 6,605,458, 5,705,464, 5,710,115, 5,698,504, 5,695,679, 5,686,014 and 5,646,101, all of which are incorporated herein by reference). Embodiments of specific cleaning composition materials are exemplified in detail below. In embodiments in which the cleaning adjunct materials are not compatible with the metalloprotease polypeptides of the present invention in the cleaning compositions, then suitable methods of keeping the cleaning adjunct materials and the protease(s) separated (i.e., not in contact with each other) until combination of the two components is appropriate are used. Such separation methods include any suitable method known in the art (e.g., gelcaps, encapsulation, tablets, physical separation, etc.).

    [0191] The cleaning compositions of the present invention are advantageously employed for example, in laundry applications, hard surface cleaning, dishwashing applications, including automatic dishwashing and hand dishwashing, as well as cosmetic applications such as dentures, teeth, hair and skin. In addition, due to the unique advantages of increased effectiveness in lower temperature solutions, the enzymes of the present invention are ideally suited for laundry applications. Furthermore, the enzymes of the present invention find use in granular and liquid compositions.

    [0192] The metalloprotease polypeptides of the present invention also find use in cleaning additive products. In some embodiments, low temperature solution cleaning applications find use. In some embodiments, the present invention provides cleaning additive products including at least one enzyme of the present invention is ideally suited for inclusion in a wash process when additional bleaching effectiveness is desired. Such instances include, but are not limited to low temperature solution cleaning applications. In some embodiments, the additive product is in its simplest form, one or more proteases. In some embodiments, the additive is packaged in dosage form for addition to a cleaning process. In some embodiments, the additive is packaged in dosage form for addition to a cleaning process where a source of peroxygen is employed and increased bleaching effectiveness is desired. Any suitable single dosage unit form finds use with the present invention, including but not limited to pills, tablets, gelcaps, or other single dosage units such as pre-measured powders or liquids. In some embodiments, filler(s) or carrier material(s) are included to increase the volume of such compositions. Suitable filler or carrier materials include, but are not limited to, various salts of sulfate, carbonate and silicate as well as talc, clay and the like. Suitable filler or carrier materials for liquid compositions include, but are not limited to water or low molecular weight primary and secondary alcohols including polyols and diols. Examples of such alcohols include, but are not limited to, methanol, ethanol, propanol and isopropanol. In some embodiments, the compositions contain from about 5% to about 90% of such materials. Acidic fillers find use to reduce pH. Alternatively, in some embodiments, the cleaning additive includes adjunct ingredients, as more fully described below.

    [0193] The present cleaning compositions and cleaning additives require an effective amount of at least one of the metalloprotease polypeptides provided herein, alone or in combination with other proteases and/or additional enzymes. The required level of enzyme is achieved by the addition of one or more metalloprotease polypeptides of the present invention. Typically the present cleaning compositions comprise at least about 0.0001 weight percent, from about 0.0001 to about 10, from about 0.001 to about 1, or from about 0.01 to about 0.1 weight percent of at least one of the metalloprotease polypeptides of the present invention.

    [0194] The cleaning compositions herein are typically formulated such that, during use in aqueous cleaning operations, the wash water will have a pH of from about 4.0 to about 11.5, or even from about 5.0 to about 11.5, or even from about 5.0 to about 8.0, or even from about 7.5 to about 10.5. Liquid product formulations are typically formulated to have a pH from about 3.0 to about 9.0 or even from about 3 to about 5. Granular laundry products are typically formulated to have a pH from about 9 to about 11. Techniques for controlling pH at recommended usage levels include the use of buffers, alkalis, acids, etc., and are well known to those skilled in the art.

    [0195] Suitable low pH cleaning compositions typically have a pH of from about 3 to about 5, and are typically free of surfactants that hydrolyze in such a pH environment. Such surfactants include sodium alkyl sulfate surfactants that comprise at least one ethylene oxide moiety or even from about 1 to about 16 moles of ethylene oxide. Such cleaning compositions typically comprise a sufficient amount of a pH modifier, such as sodium hydroxide, monoethanolamine or hydrochloric acid, to provide such cleaning composition with a pH of from about 3 to about 5. Such compositions typically comprise at least one acid stable enzyme. In some embodiments, the compositions are liquids, while in other embodiments, they are solids. The pH of such liquid compositions is typically measured as a neat pH. The pH of such solid compositions is measured as a 10% solids solution of said composition wherein the solvent is distilled water. In these embodiments, all pH measurements are taken at 20 C., unless otherwise indicated.

    [0196] In some embodiments, when the metalloprotease polypeptide (s) is/are employed in a granular composition or liquid, it is desirable for the metalloprotease polypeptide to be in the form of an encapsulated particle to protect the metalloprotease polypeptide from other components of the granular composition during storage. In addition, encapsulation is also a means of controlling the availability of the metalloprotease polypeptide during the cleaning process. In some embodiments, encapsulation enhances the performance of the metalloprotease polypeptide (s) and/or additional enzymes. In this regard, the metalloprotease polypeptides of the present invention are encapsulated with any suitable encapsulating material known in the art. In some embodiments, the encapsulating material typically encapsulates at least part of the metalloprotease polypeptide (s) of the present invention. Typically, the encapsulating material is water-soluble and/or water-dispersible. In some embodiments, the encapsulating material has a glass transition temperature (Tg) of 0 C. or higher. Glass transition temperature is described in more detail in WO 97/11151. The encapsulating material is typically selected from consisting of carbohydrates, natural or synthetic gums, chitin, chitosan, cellulose and cellulose derivatives, silicates, phosphates, borates, polyvinyl alcohol, polyethylene glycol, paraffin waxes, and combinations thereof. When the encapsulating material is a carbohydrate, it is typically selected from monosaccharides, oligosaccharides, polysaccharides, and combinations thereof. In some typical embodiments, the encapsulating material is a starch (See e.g., EP 0 922 499; U.S. Pat. No. 4,977,252; U.S. Pat. No. 5,354,559, and U.S. Pat. No. 5,935,826). In some embodiments, the encapsulating material is a microsphere made from plastic such as thermoplastics, acrylonitrile, methacrylonitrile, polyacrylonitrile, polymethacrylonitrile and mixtures thereof commercially available microspheres that find use include, but are not limited to those supplied by EXPANCEL (Stockviksverken, Sweden), and PM 6545, PM 6550, PM 7220, PM 7228, EXTENDOSPHERES, LUXSIL, Q-CEL, and SPHERICEL (PQ Corp., Valley Forge, Pa.).

    [0197] As described herein, the metalloprotease polypeptides of the present invention find particular use in the cleaning industry, including, but not limited to laundry and dish detergents. These applications place enzymes under various environmental stresses. The metalloprotease polypeptides of the present invention provide advantages over many currently used enzymes, due to their stability under various conditions.

    [0198] Indeed, there are a variety of wash conditions including varying detergent formulations, wash water volumes, wash water temperatures, and lengths of wash time, to which proteases involved in washing are exposed. In addition, detergent formulations used in different geographical areas have different concentrations of their relevant components present in the wash water. For example, European detergents typically have about 4500-5000 ppm of detergent components in the wash water, while Japanese detergents typically have approximately 667 ppm of detergent components in the wash water. In North America, particularly the United States, detergents typically have about 975 ppm of detergent components present in the wash water.

    [0199] A low detergent concentration system includes detergents where less than about 800 ppm of the detergent components are present in the wash water. Japanese detergents are typically considered low detergent concentration system as they have approximately 667 ppm of detergent components present in the wash water.

    [0200] A medium detergent concentration includes detergents where between about 800 ppm and about 2000 ppm of the detergent components are present in the wash water. North American detergents are generally considered to be medium detergent concentration systems as they have approximately 975 ppm of detergent components present in the wash water. Brazil typically has approximately 1500 ppm of detergent components present in the wash water.

    [0201] A high detergent concentration system includes detergents where greater than about 2000 ppm of the detergent components are present in the wash water. European detergents are generally considered to be high detergent concentration systems as they have approximately 4500-5000 ppm of detergent components in the wash water.

    [0202] Latin American detergents are generally high suds phosphate builder detergents and the range of detergents used in Latin America can fall in both the medium and high detergent concentrations as they range from 1500 ppm to 6000 ppm of detergent components in the wash water. As mentioned above, Brazil typically has approximately 1500 ppm of detergent components present in the wash water. However, other high suds phosphate builder detergent geographies, not limited to other Latin American countries, may have high detergent concentration systems up to about 6000 ppm of detergent components present in the wash water.

    [0203] In light of the foregoing, it is evident that concentrations of detergent compositions in typical wash solutions throughout the world varies from less than about 800 ppm of detergent to about 6000 ppm in high suds phosphate builder geographies.

    [0204] The concentrations of the typical wash solutions are determined empirically. For example, in the U.S., a typical washing machine holds a volume of about 64.4 L of wash solution. Accordingly, in order to obtain a concentration of about 975 ppm of detergent within the wash solution about 62.79 g of detergent composition must be added to the 64.4 L of wash solution. This amount is the typical amount measured into the wash water by the consumer using the measuring cup provided with the detergent.

    [0205] As a further example, different geographies use different wash temperatures. The temperature of the wash water in Japan is typically less than that used in Europe. For example, the temperature of the wash water in North America and Japan is typically between about 10 and about 40 C. (e.g., about 20 C.), whereas the temperature of wash water in Europe is typically between about 30 and about 60 C. (e.g., about 40 C.). However, in the interest of saving energy, many consumers are switching to using cold water washing. In addition, in some further regions, cold water is typically used for laundry, as well as dish washing applications. In some embodiments, the cold water washing of the present invention utilizes cold water detergent suitable for washing at temperatures from about 10 C. to about 40 C., or from about 20 C. to about 30 C., or from about 15 C. to about 25 C., as well as all other combinations within the range of about 15 C. to about 35 C., and all ranges within 10 C. to 40 C.

    [0206] As a further example, different geographies typically have different water hardness. Water hardness is usually described in terms of the grains per gallon mixed Ca.sup.2+/Mg.sup.2+. Hardness is a measure of the amount of calcium (Ca) and magnesium (Mg) in the water. Most water in the United States is hard, but the degree of hardness varies. Moderately hard (60-120 ppm) to hard (121-181 ppm) water has 60 to 181 parts per million (parts per million converted to grains per U.S. gallon is ppm # divided by 17.1 equals grains per gallon) of hardness minerals.

    TABLE-US-00001 Water Grains per gallon Parts per million Soft less than 1.0 less than 17 Slightly hard 1.0 to 3.5 17 to 60 Moderately hard 3.5 to 7.0 60 to 120 Hard 7.0 to 10.5 120 to 180 Very hard greater than 10.5 greater than 180

    [0207] European water hardness is typically greater than about 10.5 (for example about 10.5 to about 20.0) grains per gallon mixed Ca.sup.2+/Mg.sup.2+ (e.g., about 15 grains per gallon mixed Ca.sup.2+/Mg). North American water hardness is typically greater than Japanese water hardness, but less than European water hardness. For example, North American water hardness can be between about 3 to about 10 grains, about 3 to about 8 grains or about 6 grains. Japanese water hardness is typically lower than North American water hardness, usually less than about 4, for example about 3 grains per gallon mixed Ca.sup.2+/Mg.sup.2+.

    [0208] Accordingly, in some embodiments, the present invention provides metalloprotease polypeptides that show surprising wash performance in at least one set of wash conditions (e.g., water temperature, water hardness, and/or detergent concentration). In some embodiments, the metalloprotease polypeptides of the present invention are comparable in wash performance to other metalloprotease polypeptide proteases. In some embodiments of the present invention, the metalloprotease polypeptides provided herein exhibit enhanced oxidative stability, enhanced thermal stability, enhanced cleaning capabilities under various conditions, and/or enhanced chelator stability. In addition, the metalloprotease polypeptides of the present invention find use in cleaning compositions that do not include detergents, again either alone or in combination with builders and stabilizers.

    [0209] In some embodiments of the present invention, the cleaning compositions comprise at least one metalloprotease polypeptide of the present invention at a level from about 0.00001% to about 10% by weight of the composition and the balance (e.g., about 99.999% to about 90.0%) comprising cleaning adjunct materials by weight of composition. In some other embodiments of the present invention, the cleaning compositions of the present invention comprises at least one metalloprotease polypeptide at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% by weight of the composition and the balance of the cleaning composition (e.g., about 99.9999% to about 90.0%, about 99.999% to about 98%, about 99.995% to about 99.5% by weight) comprising cleaning adjunct materials.

    [0210] In some embodiments, the cleaning compositions of the present invention comprise one or more additional detergent enzymes, which provide cleaning performance and/or fabric care and/or dishwashing benefits. Examples of suitable enzymes include, but are not limited to, acyl transferases, alpha-amylases, beta-amylases, alpha-galactosidases, arabinosidases, aryl esterases, beta-galactosidases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases, lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases, pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases, polygalacturonases, proteases, pullulanases, reductases, rhamnogalacturonases, beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, and xylosidases, or any combinations or mixtures thereof. In some embodiments, a combination of enzymes is used (i.e., a cocktail) comprising conventional applicable enzymes like protease, lipase, cutinase and/or cellulase in conjunction with amylase is used.

    [0211] In addition to the metalloprotease polypeptides provided herein, any other suitable protease finds use in the compositions of the present invention. Suitable proteases include those of animal, vegetable or microbial origin. In some embodiments, microbial proteases are used. In some embodiments, chemically or genetically modified mutants are included. In some embodiments, the protease is a serine protease, preferably an alkaline microbial protease or a trypsin-like protease. Examples of alkaline proteases include subtilisins, especially those derived from Bacillus (e.g., subtilisin, lentus, amyloliquefaciens, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168). Additional examples include those mutant proteases described in U.S. Pat. Nos. RE 34,606, 5,955,340, 5,700,676, 6,312,936, and 6,482,628, all of which are incorporated herein by reference. Additional protease examples include, but are not limited to trypsin (e.g., of porcine or bovine origin), and the Fusarium protease described in WO 89/06270. In some embodiments, commercially available protease enzymes that find use in the present invention include, but are not limited to MAXATASE, MAXACAL MAXAPEM, OPTICLEAN, OPTIMASE, PROPERASE, PURAFECT, PURAFECT OXP, PURAMAX, EXCELLASE, and PURAFAST (Genencor); ALCALASE, SAVINASE, PRIMASE, DURAZYM, POLARZYME, OVOZYME, KANNASE, LIQUANASE, NEUTRASE, RELASE and ESPERASE (Novozymes); BLAP and BLAP variants (Henkel Kommanditgesellschaft auf Aktien, Duesseldorf, Germany), and KAP (B. alkalophilus subtilisin; Kao Corp., Tokyo, Japan). Various proteases are described in WO95/23221, WO 92/21760, WO 09/149200, WO 09/149144, WO 09/149145, WO 11/072099, WO 10/056640, WO 10/056653, WO 11/140364, WO 12/151534, U.S. Pat. Publ. No. 2008/0090747, and U.S. Pat. Nos. 5,801,039, 5,340,735, 5,500,364, 5,855,625, US RE 34,606, 5,955,340, 5,700,676, 6,312,936, and 6,482,628, and various other patents. In some further embodiments, metalloproteases find use in the present invention, including but not limited to the neutral metalloprotease described in WO 07/044993.

    [0212] In addition, any suitable lipase finds use in the present invention. Suitable lipases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are encompassed by the present invention. Examples of useful lipases include Humicola lanuginosa lipase (See e.g., EP 258 068, and EP 305 216), Rhizomucor miehei lipase (See e.g., EP 238 023), Candida lipase, such as C. antarctica lipase (e.g., the C. antarctica lipase A or B; See e.g., EP 214 761), Pseudomonas lipases such as P. alcaligenes lipase and P. pseudoalcaligenes lipase (See e.g., EP 218 272), P. cepacia lipase (See e.g., EP 331 376), P. stutzeri lipase (See e.g., GB 1,372,034), P. fluorescens lipase, Bacillus lipase (e.g., B. subtilis lipase [Dartois et al., Biochem. Biophys. Acta 1131:253-260 [1993]); B. stearothermophilus lipase [See e.g., JP 64/744992]; and B. pumilus lipase [See e.g., WO 91/16422]).

    [0213] Furthermore, a number of cloned lipases find use in some embodiments of the present invention, including but not limited to Penicillium camembertii lipase (See, Yamaguchi et al., Gene 103:61-67 [1991]), Geotricum candidum lipase (See, Schimada et al., J. Biochem., 106:383-388 [1989]), and various Rhizopus lipases such as R. delemar lipase (See, Hass et al., Gene 109:117-113 [1991]), a R. niveus lipase (Kugimiya et al., Biosci. Biotech. Biochem. 56:716-719 [1992]) and R. oryzae lipase.

    [0214] Other types of lipase polypeptide enzymes such as cutinases also find use in some embodiments of the present invention, including but not limited to the cutinase derived from Pseudomonas mendocina (See, WO 88/09367), and the cutinase derived from Fusarium solani pisi (See, WO 90/09446).

    [0215] Additional suitable lipases include commercially available lipases such as M1 LIPASE, LUMA FAST, and LIPOMAX (Genencor); LIPEX, LIPOLASE and LIPOLASE ULTRA (Novozymes); and LIPASE P Amano (Amano Pharmaceutical Co. Ltd., Japan).

    [0216] In some embodiments of the present invention, the cleaning compositions of the present invention further comprise lipases at a level from about 0.00001% to about 10% of additional lipase by weight of the composition and the balance of cleaning adjunct materials by weight of composition. In some other embodiments of the present invention, the cleaning compositions of the present invention also comprise lipases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% lipase by weight of the composition.

    [0217] In some embodiments of the present invention, any suitable amylase finds use in the present invention. In some embodiments, any amylase (e.g., alpha and/or beta) suitable for use in alkaline solutions also find use. Suitable amylases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments. Amylases that find use in the present invention, include, but are not limited to -amylases obtained from B. licheniformis (See e.g., GB 1,296,839). Additional suitable amylases include those found in WO9510603, WO9526397, WO9623874, WO9623873, WO9741213, WO9919467, WO0060060, WO0029560, WO9923211, WO9946399, WO0060058, WO0060059, WO9942567, WO0114532, WO02092797, WO0166712, WO0188107, WO0196537, WO0210355, WO9402597, WO0231124, WO9943793, WO9943794, WO2004113551, WO2005001064, WO2005003311, WO0164852, WO2006063594, WO2006066594, WO2006066596, WO2006012899, WO2008092919, WO2008000825, WO2005018336, WO2005066338, WO2009140504, WO2005019443, WO2010091221, WO2010088447, WO0134784, WO2006012902, WO2006031554, WO2006136161, WO2008101894, WO2010059413, WO2011098531, WO2011080352, WO2011080353, WO2011080354, WO2011082425, WO2011082429, WO2011076123, WO2011087836, WO2011076897, WO94183314, WO9535382, WO9909183, WO9826078, WO9902702, WO9743424, WO9929876, WO9100353, WO9605295, WO9630481, WO9710342, WO2008088493, WO2009149419, WO2009061381, WO2009100102, WO2010104675, WO2010117511, and WO2010115021. Commercially available amylases that find use in the present invention include, but are not limited to DURAMYL, TERMAMYL, FUNGAMYL, STAINZYME, STAINZYME PLUS, STAINZYME ULTRA, and BAN (Novozymes), as well as POWERASE, RAPIDASE and MAXAMYL P (Genencor).

    [0218] In some embodiments of the present invention, the cleaning compositions of the present invention further comprise amylases at a level from about 0.00001% to about 10% of additional amylase by weight of the composition and the balance of cleaning adjunct materials by weight of composition. In some other embodiments of the present invention, the cleaning compositions of the present invention also comprise amylases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% amylase by weight of the composition.

    [0219] In some further embodiments, any suitable cellulase finds used in the cleaning compositions of the present invention. Suitable cellulases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments. Suitable cellulases include, but are not limited to Humicola insolens cellulases (See e.g., U.S. Pat. No. 4,435,307). Especially suitable cellulases are the cellulases having color care benefits (See e.g., EP 0 495 257). Commercially available cellulases that find use in the present include, but are not limited to CELLUZYME, CELLUCLEAN, CAREZYME (Novozymes), PURADAX and REVITALENZ (Danisco US Inc.), and KAC-500(B) (Kao Corporation). In some embodiments, cellulases are incorporated as portions or fragments of mature wild-type or variant cellulases, wherein a portion of the N-terminus is deleted (See e.g., U.S. Pat. No. 5,874,276). Additional suitable cellulases include those found in WO2005054475, WO2005056787, U.S. Pat. Nos. 7,449,318, and 7,833,773. In some embodiments, the cleaning compositions of the present invention further comprise cellulases at a level from about 0.00001% to about 10% of additional cellulase by weight of the composition and the balance of cleaning adjunct materials by weight of composition. In some other embodiments of the present invention, the cleaning compositions of the present invention also comprise cellulases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% cellulase by weight of the composition.

    [0220] Any mannanase suitable for use in detergent compositions also finds use in the present invention. Suitable mannanases include, but are not limited to those of bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments. Various mannanases are known which find use in the present invention (See e.g., U.S. Pat. Nos. 6,566,114; 6,602,842, 5,476,775 and 6,440,991 and US Prv. App. Ser. No. 61/739267, all of which are incorporated herein by reference). Commercially available mannanases that find use in the present invention include, but are not limited to MANNASTAR, PURABRITE, and MANNAWAY. In some embodiments, the cleaning compositions of the present invention further comprise mannanases at a level from about 0.00001% to about 10% of additional mannanase by weight of the composition and the balance of cleaning adjunct materials by weight of composition. In some embodiments of the present invention, the cleaning compositions of the present invention also comprise mannanases at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% mannanase by weight of the composition.

    [0221] In some embodiments, peroxidases are used in combination with hydrogen peroxide or a source thereof (e.g., a percarbonate, perborate or persulfate) in the compositions of the present invention. In some alternative embodiments, oxidases are used in combination with oxygen. Both types of enzymes are used for solution bleaching (i.e., to prevent transfer of a textile dye from a dyed fabric to another fabric when the fabrics are washed together in a wash liquor), preferably together with an enhancing agent (See e.g., WO 94/12621 and WO 95/01426). Suitable peroxidases/oxidases include, but are not limited to those of plant, bacterial or fungal origin. Chemically or genetically modified mutants are included in some embodiments. In some embodiments, the cleaning compositions of the present invention further comprise peroxidase and/or oxidase enzymes at a level from about 0.00001% to about 10% of additional peroxidase and/or oxidase by weight of the composition and the balance of cleaning adjunct materials by weight of composition. In some other embodiments of the present invention, the cleaning compositions of the present invention also comprise, peroxidase and/or oxidase enzymes at a level of about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about 0.5% peroxidase and/or oxidase enzymes by weight of the composition.

    [0222] In some embodiments, additional enzymes find use, including but not limited to perhydrolases (See e.g., WO 05/056782). In addition, in some embodiments, mixtures of the above mentioned enzymes are encompassed herein, in particular one or more additional protease, amylase, lipase, mannanase, and/or at least one cellulase. Indeed, it is contemplated that various mixtures of these enzymes will find use in the present invention. It is also contemplated that the varying levels of the metalloprotease polypeptide (s) and one or more additional enzymes may both independently range to about 10%, the balance of the cleaning composition being cleaning adjunct materials. The specific selection of cleaning adjunct materials are readily made by considering the surface, item, or fabric to be cleaned, and the desired form of the composition for the cleaning conditions during use (e.g., through the wash detergent use).

    [0223] Examples of suitable cleaning adjunct materials include, but are not limited to, surfactants, builders, bleaches, bleach activators, bleach catalysts, other enzymes, enzyme stabilizing systems, chelants, optical brighteners, soil release polymers, dye transfer agents, dye transfer inhibiting agents, catalytic materials, hydrogen peroxide, sources of hydrogen peroxide, preformed peracids, polymeric dispersing agents, clay soil removal agents, structure elasticizing agents, dispersants, suds suppressors, dyes, perfumes, colorants, filler salts, hydrotropes, photoactivators, fluorescers, fabric conditioners, fabric softeners, carriers, hydrotropes, processing aids, solvents, pigments, hydrolyzable surfactants, preservatives, anti-oxidants, anti-shrinkage agents, anti-wrinkle agents, germicides, fungicides, color speckles, silvercare, anti-tarnish and/or anti-corrosion agents, alkalinity sources, solubilizing agents, carriers, processing aids, pigments, and pH control agents (See e.g., U.S. Pat. Nos. 6,610,642, 6,605,458, 5,705,464, 5,710,115, 5,698,504, 5,695,679, 5,686,014 and 5,646,101, all of which are incorporated herein by reference). Embodiments of specific cleaning composition materials are exemplified in detail below. In embodiments in which the cleaning adjunct materials are not compatible with the metalloprotease polypeptides of the present invention in the cleaning compositions, then suitable methods of keeping the cleaning adjunct materials and the protease(s) separated (i.e., not in contact with each other) until combination of the two components is appropriate are used. Such separation methods include any suitable method known in the art (e.g., gelcaps, encapsulation, tablets, physical separation, etc.).

    [0224] In some embodiments, an effective amount of one or more metalloprotease polypeptide (s) provided herein is included in compositions useful for cleaning a variety of surfaces in need of proteinaceous stain removal. Such cleaning compositions include cleaning compositions for such applications as cleaning hard surfaces, fabrics, and dishes. Indeed, in some embodiments, the present invention provides fabric cleaning compositions, while in other embodiments, the present invention provides non-fabric cleaning compositions. Notably, the present invention also provides cleaning compositions suitable for personal care, including oral care (including dentrifices, toothpastes, mouthwashes, etc., as well as denture cleaning compositions), skin, and hair cleaning compositions. It is intended that the present invention encompass detergent compositions in any form (i.e., liquid, granular, bar, semi-solid, gels, emulsions, tablets, capsules, etc.).

    [0225] By way of example, several cleaning compositions wherein the metalloprotease polypeptides of the present invention find use are described in greater detail below. In some embodiments in which the cleaning compositions of the present invention are formulated as compositions suitable for use in laundry machine washing method(s), the compositions of the present invention preferably contain at least one surfactant and at least one builder compound, as well as one or more cleaning adjunct materials preferably selected from organic polymeric compounds, bleaching agents, additional enzymes, suds suppressors, dispersants, lime-soap dispersants, soil suspension and anti-redeposition agents and corrosion inhibitors. In some embodiments, laundry compositions also contain softening agents (i.e., as additional cleaning adjunct materials). The compositions of the present invention also find use in detergent additive products in solid or liquid form. Such additive products are intended to supplement and/or boost the performance of conventional detergent compositions and can be added at any stage of the cleaning process. In some embodiments, the density of the laundry detergent compositions herein ranges from about 400 to about 1200 g/liter, while in other embodiments, it ranges from about 500 to about 950 g/liter of composition measured at 20 C.

    [0226] In embodiments formulated as compositions for use in manual dishwashing methods, the compositions of the invention preferably contain at least one surfactant and preferably at least one additional cleaning adjunct material selected from organic polymeric compounds, suds enhancing agents, group II metal ions, solvents, hydrotropes and additional enzymes.

    [0227] In some embodiments, various cleaning compositions such as those provided in U.S. Pat. No. 6,605,458, find use with the metalloprotease polypeptides of the present invention. Thus, in some embodiments, the compositions comprising at least one metalloprotease polypeptide of the present invention is a compact granular fabric cleaning composition, while in other embodiments, the composition is a granular fabric cleaning composition useful in the laundering of colored fabrics, in further embodiments, the composition is a granular fabric cleaning composition which provides softening through the wash capacity, in additional embodiments, the composition is a heavy duty liquid fabric cleaning composition. In some embodiments, the compositions comprising at least one metalloprotease polypeptide of the present invention are fabric cleaning compositions such as those described in U.S. Pat. Nos. 6,610,642 and 6,376,450. In addition, the metalloprotease polypeptides of the present invention find use in granular laundry detergent compositions of particular utility under European or Japanese washing conditions (See e.g., U.S. Pat. No. 6,610,642).

    [0228] In some alternative embodiments, the present invention provides hard surface cleaning compositions comprising at least one metalloprotease polypeptide provided herein. Thus, in some embodiments, the compositions comprising at least one metalloprotease polypeptide of the present invention is a hard surface cleaning composition such as those described in U.S. Pat. Nos. 6,610,642, 6,376,450, and 6,376,450.

    [0229] In yet further embodiments, the present invention provides dishwashing compositions comprising at least one metalloprotease polypeptide provided herein. Thus, in some embodiments, the compositions comprising at least one metalloprotease polypeptide of the present invention is a hard surface cleaning composition such as those in U.S. Pat. Nos. 6,610,642 and 6,376,450. In some still further embodiments, the present invention provides dishwashing compositions comprising at least one metalloprotease polypeptide provided herein. In some further embodiments, the compositions comprising at least one metalloprotease polypeptide of the present invention comprise oral care compositions such as those in U.S. Pat. Nos. 6,376,450, and 6,376,450. The formulations and descriptions of the compounds and cleaning adjunct materials contained in the aforementioned U.S. Pat. Nos. 6,376,450, 6,605,458, 6,605,458, and 6,610,642, find use with the metalloprotease polypeptides provided herein.

    [0230] The cleaning compositions of the present invention are formulated into any suitable form and prepared by any process chosen by the formulator, non-limiting examples of which are described in U.S. Pat. Nos. 5,879,584, 5,691,297, 5,574,005, 5,569,645, 5,565,422, 5,516,448, 5,489,392, and 5,486,303, all of which are incorporated herein by reference. When a low pH cleaning composition is desired, the pH of such composition is adjusted via the addition of a material such as monoethanolamine or an acidic material such as HCl.

    [0231] In some embodiments, the cleaning compositions of the present invention can be formulated to have an alkaline pH under wash conditions, such as a pH of from about 8.0 to about 12.0, or from about 8.5 to about 11.0, or from about 9.0 to about 11.0. In some embodiments, the cleaning compositions of the present invention can be formulated to have a neutral pH under wash conditions, such as a pH of from about 5.0 to about 8.0, or from about 5.5 to about 8.0, or from about 6.0 to about 8.0, or from about 6.0 to about 7.5. In some embodiments, the neutral pH conditions can be measured when the cleaning composition is dissolved 1:100 (wt:wt) in de-ionised water at 20 C., measured using a conventional pH meter.

    [0232] While not essential for the purposes of the present invention, the non-limiting list of adjuncts illustrated hereinafter are suitable for use in the instant cleaning compositions. In some embodiments, these adjuncts are incorporated for example, to assist or enhance cleaning performance, for treatment of the substrate to be cleaned, or to modify the aesthetics of the cleaning composition as is the case with perfumes, colorants, dyes or the like. It is understood that such adjuncts are in addition to the metalloprotease polypeptides of the present invention. The precise nature of these additional components, and levels of incorporation thereof, will depend on the physical form of the composition and the nature of the cleaning operation for which it is to be used. Suitable adjunct materials include, but are not limited to, surfactants, builders, chelating agents, dye transfer inhibiting agents, deposition aids, dispersants, additional enzymes, and enzyme stabilizers, catalytic materials, bleach activators, bleach boosters, hydrogen peroxide, sources of hydrogen peroxide, preformed peracids, polymeric dispersing agents, clay soil removal/anti-redeposition agents, brighteners, suds suppressors, dyes, perfumes, structure elasticizing agents, fabric softeners, carriers, hydrotropes, processing aids and/or pigments. In addition to the disclosure below, suitable examples of such other adjuncts and levels of use are found in U.S. Pat. Nos. 5,576,282, 6,306,812, and 6,326,348, incorporated by reference. The aforementioned adjunct ingredients may constitute the balance of the cleaning compositions of the present invention.

    [0233] In some embodiments, the cleaning compositions according to the present invention comprise an acidifying particle or an amino carboxylic builder. Examples of an amino carboxylic builder include aminocarboxylic acids, salts and derivatives thereof. In some embodiment, the amino carboxylic builder is an aminopolycarboxylic builder, such as glycine-N,N-diacetic acid or derivative of general formula MOOCCHRN(CH.sub.2COOM).sub.2 where R is 12 alkyl and M is alkali metal. In some embodiments, the amino carboxylic builder can be methylglycine diacetic acid (MGDA), GLDA (glutamic-N,N-diacetic acid), iminodisuccinic acid (IDS), carboxymethyl inulin and salts and derivatives thereof, aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl)aspartic acid (SEAS), N-(2-sulfomethyl)glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), IDS (iminodiacetic acid) and salts and derivatives thereof such as N-methyliminodiacetic acid (MIDA), alpha-alanine-N,N-diacetic acid (alpha-ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,Ndiacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N,N-diacetic acid (SLDA), taurine-N,N-diacetic acid (TUDA) and sulfomethyl-N,N-diacetic acid (SMDA) and alkali metal salts and derivative thereof. In some embodiments, the acidifying particle has a weight geometric mean particle size of from about 400 to about 1200 and a bulk density of at least 550 g/L. In some embodiments, the acidifying particle comprises at least about 5% of the builder.

    [0234] In some embodiments, the acidifying particle can comprise any acid, including organic acids and mineral acids. Organic acids can have one or two carboxyls and in some instances up to 15 carbons, especially up to 10 carbons, such as formic, acetic, propionic, capric, oxalic, succinic, adipic, maleic, fumaric, sebacic, malic, lactic, glycolic, tartaric and glyoxylic acids. In some embodiments, the acid is citric acid. Mineral acids include hydrochloric and sulphuric acid. In some instances, the acidifying particle of the invention is a highly active particle comprising a high level of amino carboxylic builder. Sulphuric acid has been found to further contribute to the stability of the final particle.

    [0235] In some embodiments, the cleaning compositions according to the present invention comprise at least one surfactant and/or a surfactant system wherein the surfactant is selected from nonionic surfactants, anionic surfactants, cationic surfactants, ampholytic surfactants, zwitterionic surfactants, semi-polar nonionic surfactants and mixtures thereof. In some low pH cleaning composition embodiments (e.g., compositions having a neat pH of from about 3 to about 5), the composition typically does not contain alkyl ethoxylated sulfate, as it is believed that such surfactant may be hydrolyzed by such compositions the acidic contents. In some embodiments, the surfactant is present at a level of from about 0.1% to about 60%, while in alternative embodiments the level is from about 1% to about 50%, while in still further embodiments the level is from about 5% to about 40%, by weight of the cleaning composition.

    [0236] In some embodiments, the cleaning compositions of the present invention comprise one or more detergent builders or builder systems. In some embodiments incorporating at least one builder, the cleaning compositions comprise at least about 1%, from about 3% to about 60% or even from about 5% to about 40% builder by weight of the cleaning composition. Builders include, but are not limited to, the alkali metal, ammonium and alkanolammonium salts of polyphosphates, alkali metal silicates, alkaline earth and alkali metal carbonates, aluminosilicates, polycarboxylate compounds, ether hydroxypolycarboxylates, copolymers of maleic anhydride with ethylene or vinyl methyl ether, 1, 3, 5-trihydroxy benzene-2, 4, 6-trisulphonic acid, and carboxymethyloxysuccinic acid, the various alkali metal, ammonium and substituted ammonium salts of polyacetic acids such as ethylenediamine tetraacetic acid and nitrilotriacetic acid, as well as polycarboxylates such as mellitic acid, succinic acid, citric acid, oxydisuccinic acid, polymaleic acid, benzene 1,3,5-tricarboxylic acid, carboxymethyloxysuccinic acid, and soluble salts thereof. Indeed, it is contemplated that any suitable builder will find use in various embodiments of the present invention.

    [0237] In some embodiments, the builders form water-soluble hardness ion complexes (e.g., sequestering builders), such as citrates and polyphosphates (e.g., sodium tripolyphosphate and sodium tripolyphospate hexahydrate, potassium tripolyphosphate, and mixed sodium and potassium tripolyphosphate, etc.). It is contemplated that any suitable builder will find use in the present invention, including those known in the art (See e.g., EP 2 100 949).

    [0238] In some embodiments, builders for use herein include phosphate builders and non-phosphate builders. In some embodiments, the builder is a phosphate builder. In some embodiments, the builder is a non-phosphate builder. If present, builders are used in a level of from 0.1% to 80%, or from 5 to 60%, or from 10 to 50% by weight of the composition. In some embodiments the product comprises a mixture of phosphate and non-phosphate builders. Suitable phosphate builders include mono-phosphates, di-phosphates, tri-polyphosphates or oligomeric-poylphosphates, including the alkali metal salts of these compounds, including the sodium salts. In some embodiments, a builder can be sodium tripolyphosphate (STPP). Additionally, the composition can comprise carbonate and/or citrate, preferably citrate that helps to achieve a neutral pH composition of the invention. Other suitable non-phosphate builders include homopolymers and copolymers of polycarboxylic acids and their partially or completely neutralized salts, monomeric polycarboxylic acids and hydroxycarboxylic acids and their salts. In some embodiments, salts of the above mentioned compounds include the ammonium and/or alkali metal salts, i.e. the lithium, sodium, and potassium salts, including sodium salts. Suitable polycarboxylic acids include acyclic, alicyclic, hetero-cyclic and aromatic carboxylic acids, wherein in some embodiments, they can contain at least two carboxyl groups which are in each case separated from one another by, in some instances, no more than two carbon atoms.

    [0239] In some embodiments, the cleaning compositions of the present invention contain at least one chelating agent. Suitable chelating agents include, but are not limited to copper, iron and/or manganese chelating agents and mixtures thereof. In embodiments in which at least one chelating agent is used, the cleaning compositions of the present invention comprise from about 0.1% to about 15% or even from about 3.0% to about 10% chelating agent by weight of the subject cleaning composition.

    [0240] In some still further embodiments, the cleaning compositions provided herein contain at least one deposition aid. Suitable deposition aids include, but are not limited to, polyethylene glycol, polypropylene glycol, polycarboxylate, soil release polymers such as polytelephthalic acid, clays such as kaolinite, montmorillonite, atapulgite, illite, bentonite, halloysite, and mixtures thereof.

    [0241] As indicated herein, in some embodiments, anti-redeposition agents find use in some embodiments of the present invention. In some embodiments, non-ionic surfactants find use. For example, in automatic dishwashing embodiments, non-ionic surfactants find use for surface modification purposes, in particular for sheeting, to avoid filming and spotting and to improve shine. These non-ionic surfactants also find use in preventing the re-deposition of soils. In some embodiments, the anti-redeposition agent is a non-ionic surfactant as known in the art (See e.g., EP 2 100 949). In some embodiments, the non-ionic surfactant can be ethoxylated nonionic surfactants, epoxy-capped poly(oxyalkylated) alcohols and amine oxides surfactants.

    [0242] In some embodiments, the cleaning compositions of the present invention include one or more dye transfer inhibiting agents. Suitable polymeric dye transfer inhibiting agents include, but are not limited to, polyvinylpyrrolidone polymers, polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof. In embodiments in which at least one dye transfer inhibiting agent is used, the cleaning compositions of the present invention comprise from about 0.0001% to about 10%, from about 0.01% to about 5%, or even from about 0.1% to about 3% by weight of the cleaning composition.

    [0243] In some embodiments, silicates are included within the compositions of the present invention. In some such embodiments, sodium silicates (e.g., sodium disilicate, sodium metasilicate, and crystalline phyllosilicates) find use. In some embodiments, silicates are present at a level of from about 1% to about 20%. In some embodiments, silicates are present at a level of from about 5% to about 15% by weight of the composition.

    [0244] In some still additional embodiments, the cleaning compositions of the present invention also contain dispersants. Suitable water-soluble organic materials include, but are not limited to the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated from each other by not more than two carbon atoms.

    [0245] In some further embodiments, the enzymes used in the cleaning compositions are stabilized by any suitable technique. In some embodiments, the enzymes employed herein are stabilized by the presence of water-soluble sources of calcium and/or magnesium ions in the finished compositions that provide such ions to the enzymes. In some embodiments, the enzyme stabilizers include oligosaccharides, polysaccharides, and inorganic divalent metal salts, including alkaline earth metals, such as calcium salts, such as calcium formate. It is contemplated that various techniques for enzyme stabilization will find use in the present invention. For example, in some embodiments, the enzymes employed herein are stabilized by the presence of water-soluble sources of zinc (II), calcium (II) and/or magnesium (II) ions in the finished compositions that provide such ions to the enzymes, as well as other metal ions (e.g., barium (II), scandium (II), iron (II), manganese (II), aluminum (III), Tin (II), cobalt (II), copper (II), nickel (II), and oxovanadium (IV). Chlorides and sulfates also find use in some embodiments of the present invention. Examples of suitable oligosaccharides and polysaccharides (e.g., dextrins) are known in the art (See e.g., WO 07/145964). In some embodiments, reversible protease inhibitors also find use, such as boron-containing compounds (e.g., borate, 4-formyl phenyl boronic acid) and/or a tripeptide aldehyde find use to further improve stability, as desired.

    [0246] In some embodiments, bleaches, bleach activators and/or bleach catalysts are present in the compositions of the present invention. In some embodiments, the cleaning compositions of the present invention comprise inorganic and/or organic bleaching compound(s). Inorganic bleaches include, but are not limited to perhydrate salts (e.g., perborate, percarbonate, perphosphate, persulfate, and persilicate salts). In some embodiments, inorganic perhydrate salts are alkali metal salts. In some embodiments, inorganic perhydrate salts are included as the crystalline solid, without additional protection, although in some other embodiments, the salt is coated. Any suitable salt known in the art finds use in the present invention (See e.g., EP 2 100 949).

    [0247] In some embodiments, bleach activators are used in the compositions of the present invention. Bleach activators are typically organic peracid precursors that enhance the bleaching action in the course of cleaning at temperatures of 60 C. and below. Bleach activators suitable for use herein include compounds which, under perhydrolysis conditions, give aliphatic peroxoycarboxylic acids having preferably from about 1 to about 10 carbon atoms, in particular from about 2 to about 4 carbon atoms, and/or optionally substituted perbenzoic acid. Additional bleach activators are known in the art and find use in the present invention (See e.g., EP 2 100 949).

    [0248] In addition, in some embodiments and as further described herein, the cleaning compositions of the present invention further comprise at least one bleach catalyst. In some embodiments, the manganese triazacyclononane and related complexes find use, as well as cobalt, copper, manganese, and iron complexes. Additional bleach catalysts find use in the present invention (See e.g., U.S. Pat. Nos. 4,246,612, 5,227,084, 4,810410, WO 99/06521, and EP 2 100 949).

    [0249] In some embodiments, the cleaning compositions of the present invention contain one or more catalytic metal complexes. In some embodiments, a metal-containing bleach catalyst finds use. In some embodiments, the metal bleach catalyst comprises a catalyst system comprising a transition metal cation of defined bleach catalytic activity, (e.g., copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations), an auxiliary metal cation having little or no bleach catalytic activity (e.g., zinc or aluminum cations), and a sequestrate having defined stability constants for the catalytic and auxiliary metal cations, particularly ethylenediaminetetraacetic acid, ethylenediaminetetra (methylenephosphonic acid) and water-soluble salts thereof are used (See e.g., U.S. Pat. No. 4,430,243). In some embodiments, the cleaning compositions of the present invention are catalyzed by means of a manganese compound. Such compounds and levels of use are well known in the art (See e.g., U.S. Pat. No. 5,576,282). In additional embodiments, cobalt bleach catalysts find use in the cleaning compositions of the present invention. Various cobalt bleach catalysts are known in the art (See e.g., U.S. Pat. Nos. 5,597,936 and 5,595,967) and are readily prepared by known procedures.

    [0250] In some additional embodiments, the cleaning compositions of the present invention include a transition metal complex of a macropolycyclic rigid ligand (MRL). As a practical matter, and not by way of limitation, in some embodiments, the compositions and cleaning processes provided by the present invention are adjusted to provide on the order of at least one part per hundred million of the active MRL species in the aqueous washing medium, and in some embodiments, provide from about 0.005 ppm to about 25 ppm, more preferably from about 0.05 ppm to about 10 ppm, and most preferably from about 0.1 ppm to about 5 ppm, of the MRL in the wash liquor.

    [0251] In some embodiments, transition-metals in the instant transition-metal bleach catalyst include, but are not limited to manganese, iron and chromium. MRLs also include, but are not limited to special ultra-rigid ligands that are cross-bridged (e.g., 5,12-diethyl-1,5,8,12-tetraazabicyclo[6.6.2]hexadecane). Suitable transition metal MRLs are readily prepared by known procedures (See e.g., WO 2000/32601, and U.S. Pat. No. 6,225,464).

    [0252] In some embodiments, the cleaning compositions of the present invention comprise metal care agents. Metal care agents find use in preventing and/or reducing the tarnishing, corrosion, and/or oxidation of metals, including aluminum, stainless steel, and non-ferrous metals (e.g., silver and copper). Suitable metal care agents include those described in EP 2 100 949, WO 9426860 and WO 94/26859). In some embodiments, the metal care agent is a zinc salt. In some further embodiments, the cleaning compositions of the present invention comprise from about 0.1% to about 5% by weight of one or more metal care agent.

    [0253] In some embodiments, the cleaning composition is a high density liquid (HDL) composition having a variant metalloprotease polypeptide protease. The HDL liquid laundry detergent can comprise a detersive surfactant (10%-40%) comprising anionic detersive surfactant (selected from a group of linear or branched or random chain, substituted or unsubstituted alkyl sulphates, alkyl sulphonates, alkyl alkoxylated sulphate, alkyl phosphates, alkyl phosphonates, alkyl carboxylates, and/or mixtures thereof); and optionally non-ionic surfactant (selected from a group of linear or branched or random chain, substituted or unsubstituted alkyl alkoxylated alcohol, for example a C.sub.8-C.sub.18 alkyl ethoxylated alcohol and/or C.sub.6-C.sub.12 alkyl phenol alkoxylates), optionally wherein the weight ratio of anionic detersive surfactant (with a hydrophilic index (HIc) of from 6.0 to 9) to non-ionic detersive surfactant is greater than 1:1.

    [0254] The composition can comprise optionally, a surfactancy boosting polymer consisting of amphiphilic alkoxylated grease cleaning polymers (selected from a group of alkoxylated polymers having branched hydrophilic and hydrophobic properties, such as alkoxylated polyalkylenimines in the range of 0.05 wt %-10 wt %) and/or random graft polymers (typically comprising of hydrophilic backbone comprising monomers selected from the group consisting of: unsaturated C.sub.1-C.sub.6 carboxylic acids, ethers, alcohols, aldehydes, ketones, esters, sugar units, alkoxy units, maleic anhydride, saturated polyalcohols such as glycerol, and mixtures thereof; and hydrophobic side chain(s) selected from the group consisting of: C.sub.4-C.sub.25 alkyl group, polypropylene, polybutylene, vinyl ester of a saturated C-C.sub.6 mono-carboxylic acid, C.sub.1-C.sub.6 alkyl ester of acrylic or methacrylic acid, and mixtures thereof.

    [0255] The composition can comprise additional polymers such as soil release polymers (include anionically end-capped polyesters, for example SRP1, polymers comprising at least one monomer unit selected from saccharide, dicarboxylic acid, polyol and combinations thereof, in random or block configuration, ethylene terephthalate-based polymers and co-polymers thereof in random or block configuration, for example Repel-o-tex SF, SF-2 and SRP6, Texcare SRA100, SRA300, SRN100, SRN170, SRN240, SRN300 and SRN325, Marloquest SL), anti-redeposition polymers (0.1 wt % to 10 wt %, include carboxylate polymers, such as polymers comprising at least one monomer selected from acrylic acid, maleic acid (or maleic anhydride), fumaric acid, itaconic acid, aconitic acid, mesaconic acid, citraconic acid, methylenemalonic acid, and any mixture thereof, vinylpyrrolidone homopolymer, and/or polyethylene glycol, molecular weight in the range of from 500 to 100,000 Da); cellulosic polymer (including those selected from alkyl cellulose, alkyl alkoxyalkyl cellulose, carboxyalkyl cellulose, alkyl carboxyalkyl cellulose examples of which include carboxymethyl cellulose, methyl cellulose, methyl hydroxyethyl cellulose, methyl carboxymethyl cellulose, and mixtures thereof) and polymeric carboxylate (such as maleate/acrylate random copolymer or polyacrylate homopolymer).

    [0256] The composition can further comprise saturated or unsaturated fatty acid, preferably saturated or unsaturated C.sub.12-C.sub.24 fatty acid (0 wt % to 10 wt %); deposition aids (examples for which include polysaccharides, preferably cellulosic polymers, poly diallyl dimethyl ammonium halides (DADMAC), and co-polymers of DAD MAC with vinyl pyrrolidone, acrylamides, imidazoles, imidazolinium halides, and mixtures thereof, in random or block configuration, cationic guar gum, cationic cellulose such as cationic hydoxyethyl cellulose, cationic starch, cationic polyacylamides, and mixtures thereof.

    [0257] The composition can further comprise dye transfer inhibiting agents examples of which include manganese phthalocyanine, peroxidases, polyvinylpyrrolidone polymers, polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinyloxazolidones and polyvinylimidazoles and/or mixtures thereof; chelating agents examples of which include ethylene-diamine-tetraacetic acid (EDTA); diethylene triamine penta methylene phosphonic acid (DTPMP); hydroxy-ethane diphosphonic acid (HEDP); ethylenediamine N,N-disuccinic acid (EDDS); methyl glycine diacetic acid (MGDA); diethylene triamine penta acetic acid (DTPA); propylene diamine tetracetic acid (PDT A); 2-hydroxypyridine-N-oxide (HPNO); or methyl glycine diacetic acid (MGDA); glutamic acid N,N-diacetic acid (N,N-dicarboxymethyl glutamic acid tetrasodium salt (GLDA); nitrilotriacetic acid (NTA); 4,5-dihydroxy-m-benzenedisulfonic acid; citric acid and any salts thereof; N-hydroxyethylethylenediaminetri-acetic acid (HEDTA), triethylenetetraaminehexaacetic acid (TTHA), N-hydroxyethyliminodiacetic acid (HEIDA), dihydroxyethylglycine (DHEG), ethylenediaminetetrapropionic acid (EDTP) and derivatives thereof.

    [0258] The composition can further comprise enzymes (0.01 wt % active enzyme to 0.03 wt % active enzyme) selected from a group of acyl transferases, alpha-amylases, beta-amylases, alpha-galactosidases, arabinosidases, aryl esterases, beta-galactosidases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases, lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases, pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases, polygalacturonases, proteases, pullulanases, reductases, rhamnogalacturonases, beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, and xylosidases, and any mixture thereof. The composition may comprise an enzyme stabilizer (examples of which include polyols such as propylene glycol or glycerol, sugar or sugar alcohol, lactic acid, reversible protease inhibitor, boric acid, a boric acid derivative, e.g., an aromatic borate ester, or a phenyl boronic acid derivative such as 4-formylphenyl boronic acid, peptides or formate).

    [0259] The composition can further comprise silicone or fatty-acid based suds suppressors; heuing dyes, calcium and magnesium cations, visual signaling ingredients, anti-foam (0.001 wt % to about 4.0 wt %), and/or structurant/thickener (0.01 wt % to 5 wt %, selected from the group consisting of diglycerides and triglycerides, ethylene glycol distearate, microcrystalline cellulose, cellulose based materials, microfiber cellulose, biopolymers, xanthan gum, gellan gum, and mixtures thereof).

    [0260] Suitable detersive surfactants also include cationic detersive surfactants (selected from a group of alkyl pyridinium compounds, alkyl quarternary ammonium compounds, alkyl quarternary phosphonium compounds, alkyl ternary sulphonium compounds, and/or mixtures thereof); zwitterionic and/or amphoteric detersive surfactants (selected from a group of alkanolamine sulpho-betaines); ampholytic surfactants; semi-polar non-ionic surfactants and mixtures thereof.

    [0261] The composition can be any liquid form, for example a liquid or gel form, or any combination thereof. The composition may be in any unit dose form, for example a pouch.

    [0262] In some embodiments, the cleaning composition is a high density powder (HDD) composition having a variant metalloprotease polypeptide protease. The HDD powder laundry detergent can comprise a detersive surfactant including anionic detersive surfactants (selected from a group of linear or branched or random chain, substituted or unsubstituted alkyl sulphates, alkyl sulphonates, alkyl alkoxylated sulphate, alkyl phosphates, alkyl phosphonates, alkyl carboxylates and/or mixtures thereof), non-ionic detersive surfactant (selected from a group of linear or branched or random chain, substituted or unsubstituted C.sub.8-C.sub.18 alkyl ethoxylates, and/or C.sub.6-C.sub.12 alkyl phenol alkoxylates), cationic detersive surfactants (selected from a group of alkyl pyridinium compounds, alkyl quaternary ammonium compounds, alkyl quaternary phosphonium compounds, alkyl ternary sulphonium compounds, and mixtures thereof), zwitterionic and/or amphoteric detersive surfactants (selected from a group of alkanolamine sulpho-betaines); ampholytic surfactants; semi-polar non-ionic surfactants and mixtures thereof; builders (phosphate free builders [for example zeolite builders examples of which include zeolite A, zeolite X, zeolite P and zeolite MAP in the range of 0 wt % to less than 10 wt %]; phosphate builders [examples of which include sodium tri-polyphosphate in the range of 0 wt % to less than 10 wt %]; citric acid, citrate salts and nitrilotriacetic acid or salt thereof in the range of less than 15 wt %); silicate salt (sodium or potassium silicate or sodium meta-silicate in the range of 0 wt % to less than 10 wt %, or layered silicate (SKS-6)); carbonate salt (sodium carbonate and/or sodium bicarbonate in the range of 0 wt % to less than 10 wt %); and bleaching agents (photobleaches, examples of which include sulfonated zinc phthalocyanines, sulfonated aluminum phthalocyanines, xanthenes dyes, and mixtures thereof; hydrophobic or hydrophilic bleach activators (examples of which include dodecanoyl oxybenzene sulfonate, decanoyl oxybenzene sulfonate, decanoyl oxybenzoic acid or salts thereof, 3,5,5-trimethy hexanoyl oxybenzene sulfonate, tetraacetyl ethylene diamine-TAED, and nonanoyloxybenzene sulfonate-NOB S, nitrile quats, and mixtures thereof; hydrogen peroxide; sources of hydrogen peroxide (inorganic perhydrate salts examples of which include mono or tetra hydrate sodium salt of perborate, percarbonate, persulfate, perphosphate, or persilicate); preformed hydrophilic and/or hydrophobic peracids (selected from a group consisting of percarboxylic acids and salts, percarbonic acids and salts, perimidic acids and salts, peroxymonosulfuric acids and salts) & mixtures thereof and/or bleach catalyst (such as imine bleach boosters examples of which include iminium cations and polyions; iminium zwitterions; modified amines; modified amine oxides; N-sulphonyl imines; N-phosphonyl imines; N-acyl imines; thiadiazole dioxides; perfluoroimines; cyclic sugar ketones and mixtures thereof; metal-containing bleach catalyst for example copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations along with an auxiliary metal cations such as zinc or aluminum and a sequestrate such as ethylenediaminetetraacetic acid, ethylenediaminetetra(methylenephoscustom-characterphonic acid) and water-soluble salts thereof).

    [0263] The composition can further comprise enzymes selected from a group of acyl transferases, alpha-amylases, beta-amylases, alpha-galactosidases, arabinosidases, aryl esterases, beta-galactosidases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases, lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases, pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases, polygalacturonases, proteases, pullulanases, reductases, rhamnogalacturonases, beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, and xylosidases and any mixture thereof.

    [0264] The composition can further comprise additional detergent ingredients including perfume microcapsules, starch encapsulated perfume accord, hueing agents, additional polymers including fabric integrity and cationic polymers, dye lock ingredients, fabric-softening agents, brighteners (for example C.I. Fluorescent brighteners), flocculating agents, chelating agents, alkoxylated polyamines, fabric deposition aids, and/or cyclodextrin.

    [0265] In some embodiments, the cleaning composition is an automatic dishwashing (ADW) detergent composition having a metalloprotease of the present invention. The ADW detergent composition can comprise two or more non-ionic surfactants selected from a group of ethoxylated non-ionic surfactants, alcohol alkoxylated surfactants, epoxy-capped poly(oxyalkylated) alcohols, or amine oxide surfactants present in amounts from 0 to 10% by weight; builders in the range of 5-60% comprising either phosphate (mono-phosphates, di-phosphates, tri-polyphosphates or oligomeric-poylphosphates, preferred sodium tripolyphosphate-STPP or phosphate-free builders [amino acid based compounds, examples of which include MGDA (methyl-glycine-diacetic acid), and salts and derivatives thereof, GLDA (glutamic-N,Ndiacetic acid) and salts and derivatives thereof, IDS (iminodisuccinic acid) and salts and derivatives thereof, carboxy methyl inulin and salts and derivatives thereof and mixtures thereof, nitrilotriacetic acid (NTA), diethylene triamine penta acetic acid (DTPA), B-alaninediacetic acid (B-ADA) and their salts], homopolymers and copolymers of polycarboxylic acids and their partially or completely neutralized salts, monomeric polycarboxylic acids and hydroxycarboxylic acids and their salts in the range of 0.5% to 50% by weight; sulfonated/carboxylated polymers (provide dimensional stability to the product) in the range of about 0.1% to about 50% by weight; drying aids in the range of about 0.1% to about 10% by weight (selected from polyesters, especially anionic polyesters optionally together with further monomers with 3 to 6 functionalities which are conducive to polycondensation, specifically acid, alcohol or ester functionalities, polycarbonate-, polyurethane- and/or polyurea-polyorganosiloxane compounds or precursor compounds thereof of the reactive cyclic carbonate and urea type); silicates in the range from about 1% to about 20% by weight (sodium or potassium silicates for example sodium disilicate, sodium meta-silicate and crystalline phyllosilicates); bleach-inorganic (for example perhydrate salts such as perborate, percarbonate, perphosphate, persulfate and persilicate salts) and organic (for example organic peroxyacids including diacyl and tetraacylperoxides, especially diperoxydodecanedioc acid, diperoxytetradecanedioc acid, and diperoxyhexadecanedioc acid); bleach activators-organic peracid precursors in the range from about 0.1% to about 10% by weight; bleach catalysts (selected from manganese triazacyclononane and related complexes, Co, Cu, Mn and Fe bispyridylamine and related complexes, and pentamine acetate cobalt(III) and related complexes); metal care agents in the range from about 0.1% to 5% by weight (selected from benzatriazoles, metal salts and complexes, and/or silicates); enzymes in the range from about 0.01 to 5.0 mg of active enzyme per gram of automatic dishwashing detergent composition (acyl transferases, alpha-amylases, beta-amylases, alpha-galactosidases, arabinosidases, aryl esterases, beta-galactosidases, carrageenases, catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4-glucanases, endo-beta-mannanases, esterases, exo-mannanases, galactanases, glucoamylases, hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases, lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases, pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases, polygalacturonases, proteases, pullulanases, reductases, rhamnogalacturonases, beta-glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases, and xylosidases, and any mixture thereof); and enzyme stabilizer components (selected from oligosaccharides, polysaccharides and inorganic divalent metal salts).

    [0266] The metalloproteases are normally incorporated into the detergent composition at a level of from 0.000001% to 5% of enzyme protein by weight of the composition, or from 0.00001% to 2%, or from 0.0001% to 1%, or from 0.001% to 0.75% of enzyme protein by weight of the composition.

    Metalloprotease Polypeptides of the Present Invention for Use in Animal Feed

    [0267] In a further aspect of the invention, the metalloprotease polypeptides of the present invention can be used as a compontent of an animal feed composition, animal feed additive and/or pet food comprising a metalloprotease and variants thereof. The present invention further relates to a method for preparing such an animal feed composition, animal feed additive composition and/or pet food comprising mixing the metalloprotease polypeptide with one or more animal feed ingredients and/or animal feed additive ingredients and/or pet food ingredients. Furthermore, the present invention relates to the use of the metalloprotease polypeptide in the preparation of an animal feed composition and/or animal feed additive composition and/or pet food.

    [0268] The term animal includes all non-ruminant and ruminant animals. In a particular embodiment, the animal is a non-ruminant animal, such as a horse and a mono-gastric animal. Examples of mono-gastric animals include, but are not limited to, pigs and swine, such as piglets, growing pigs, sows; poultry such as turkeys, ducks, chicken, broiler chicks, layers; fish such as salmon, trout, tilapia, catfish and carps; and crustaceans such as shrimps and prawns. In a further embodiment the animal is a ruminant animal including, but not limited to, cattle, young calves, goats, sheep, giraffes, bison, moose, elk, yaks, water buffalo, deer, camels, alpacas, llamas, antelope, pronghorn and nilgai.

    [0269] In the present context, it is intended that the term pet food is understood to mean a food for a household animal such as, but not limited to, dogs, cats, gerbils, hamsters, chinchillas, fancy rats, guinea pigs; avian pets, such as canaries, parakeets, and parrots; reptile pets, such as turtles, lizards and snakes; and aquatic pets, such as tropical fish and frogs.

    [0270] The terms animal feed composition, feedstuff and fodder are used interchangeably and can comprise one or more feed materials selected from the group comprising a) cereals, such as small grains (e.g., wheat, barley, rye, oats and combinations thereof) and/or large grains such as maize or sorghum; b) by products from cereals, such as corn gluten meal, Distillers Dried Grain Solubles (DDGS) (particularly corn based Distillers Dried Grain Solubles (cDDGS), wheat bran, wheat middlings, wheat shorts, rice bran, rice hulls, oat hulls, palm kernel, and citrus pulp; c) protein obtained from sources such as soya, sunflower, peanut, lupin, peas, fava beans, cotton, canola, fish meal, dried plasma protein, meat and bone meal, potato protein, whey, copra, sesame; d) oils and fats obtained from vegetable and animal sources; e) minerals and vitamins.

    Metalloprotease Polypeptides of the Present Invention for Use in Textile Desizing

    [0271] Also contemplated are compositions and methods of treating fabrics (e.g., to desize a textile) using a metalloprotease polypeptide of the present invention. Fabric-treating methods are well known in the art (see, e.g., U.S. Pat. No. 6,077,316). For example, the feel and appearance of a fabric can be improved by a method comprising contacting the fabric with a metalloprotease in a solution. The fabric can be treated with the solution under pressure.

    [0272] A metalloprotease of the present invention can be applied during or after the weaving of a textile, or during the desizing stage, or one or more additional fabric processing steps. During the weaving of textiles, the threads are exposed to considerable mechanical strain. Prior to weaving on mechanical looms, warp yarns are often coated with sizing starch or starch derivatives to increase their tensile strength and to prevent breaking. A metalloprotease of the present invention can be applied during or after the weaving to remove these sizing starch or starch derivatives. After weaving, the metalloprotease can be used to remove the size coating before further processing the fabric to ensure a homogeneous and wash-proof result.

    [0273] A metalloprotease of the present invention can be used alone or with other desizing chemical reagents and/or desizing enzymes to desize fabrics, including cotton-containing fabrics, as detergent additives, e.g., in aqueous compositions. An amylase also can be used in compositions and methods for producing a stonewashed look on indigo-dyed denim fabric and garments. For the manufacture of clothes, the fabric can be cut and sewn into clothes or garments, which are afterwards finished. In particular, for the manufacture of denim jeans, different enzymatic finishing methods have been developed. The finishing of denim garment normally is initiated with an enzymatic desizing step, during which garments are subjected to the action of proteolytic enzymes to provide softness to the fabric and make the cotton more accessible to the subsequent enzymatic finishing steps. The metalloprotease can be used in methods of finishing denim garments (e.g., a bio-stoning process), enzymatic desizing and providing softness to fabrics, and/or finishing process.

    Metalloprotease Polypeptides of the Present Invention for Use in Paper Pulp Bleaching

    [0274] The metalloprotease polypeptides described herein find further use in the enzyme aided bleaching of paper pulps such as chemical pulps, semi-chemical pulps, kraft pulps, mechanical pulps or pulps prepared by the sulfite method. In general terms, paper pulps are incubated with a metalloprotease polypeptide of the present invention under conditions suitable for bleaching the paper pulp.

    [0275] In some embodiments, the pulps are chlorine free pulps bleached with oxygen, ozone, peroxide or peroxyacids. In some embodiments, the metalloprotease polypeptides are used in enzyme aided bleaching of pulps produced by modified or continuous pulping methods that exhibit low lignin contents. In some other embodiments, the metalloprotease polypeptides are applied alone or preferably in combination with xylanase and/or endoglucanase and/or alpha-galactosidase and/or cellobiohydrolase enzymes.

    Metalloprotease Polypeptides of the Present Invention for Use in Protein Degradation

    [0276] The metalloprotease polypeptides described herein find further use in the enzyme aided removal of proteins from animals and their subsequent degradation or disposal, such as feathers, skin, hair, hide, and the like. In some instances, immersion of the animal carcass in a solution comprising a metalloprotease polypeptide of the present invention can act to protect the skin from damage in comparison to the traditional immersion in scalding water or the defeathering process. In one embodiment, feathers can be sprayed with an isolated metalloprotase polypeptide of the present invention under conditions suitable for digesting or initiating degradation of the plumage. In some embodiments, a metalloprotease of the present invention can be used, as above, in combination with an oxidizing agent.

    [0277] In some embodiments, removal of the oil or fat associated with raw feathers is assisted by using a metalloprotease polypeptide of the present invention. In some embodiments, the metalloprotease polypeptides are used in compositions for cleaning the feathers as well as to sanitize and partially dehydrate the fibers. In some other embodiments, the metalloprotease polypeptides are applied in a wash solution in combination with 95% ethanol or other polar organic solvent with or without a surfactant at about 0.5% (v/v).

    [0278] In yet other embodiments, the disclosed metalloprotease polypeptides find use in recovering protein from plumage. The disclosed metalloprotease polypeptides may be used alone or in combination in suitable feather processing and proteolytic methods, such as those disclosed in PCT/EP2013/065362, PCT/EP2013/065363, and PCT/EP2013/065364, which are hereby incorporated by reference. In some embodiments, the recovered protein can be subsequently used in animal or fish feed.

    Experimental

    [0279] The claimed invention is described in further detail in the following examples which are not in any way intended to limit the scope of the invention as claimed.

    Example 1.1

    [0280] Cloning of Metalloprotease AruPro1 from Anoxybacillus Rupiensis

    [0281] Anoxybacillus rupiensis strain DSM 17127, obtained from DSMZ (Deutsche Sammlung von Mikroorganismen and Zellkulturen, Braunschweig, Germany), was selected as a potential source for enzymes that may be useful for various industrial applications. To identify these enzymes and the genes that encode these enzymes, the entire genome of Anoxybacillus rupiensis strain DSM 17127 was sequenced by Illumina's next generation sequencing technology. Genomic DNA was isolated and used for genome sequencing. Genomic DNA for sequencing was obtained by first growing the strain on Heart Infusion agar plates (Difco) at 37 C. for 24 h. Cell material was scraped from the plates and used to prepare genomic DNA with the ZF Fungal/Bacterial DNA miniprep kit from Zymo (Cat No. D6005). Genome sequencing and assembly of the sequence data was performed by BaseClear (Leiden, The Netherlands). Contigs were annotated by BioXpr (Namur, Belgium). One of the genes identified this way in Anoxybacillus rupiensis strain DSM 17127 encodes a protease that showed, after a BLAST search (Altschul et al. (1990) J Mol Biol 215: 403-410), homology to metalloproteases of various other organisms. The sequence of this gene, called AruPro1, is provided in SEQ ID NO: 1. The corresponding protein encoded by the AruPro1 gene is shown in SEQ ID NO: 2. At the N-terminus, the protein has a signal peptide with a length of 24 amino acids as predicted by SignalP-4.0 (Nordahl Petersen et al. (2011) Nature Methods, 8:785-786). The presence of a signal sequence suggests that AruPro1 is a secreted enzyme. The pre-pro and mature regions of AruPro1 protein (SEQ ID NO: 2, SEQ ID NO: 3) were predicted based on an alignment with thermolysin of Bacillus thermoproteolyticus (O'Donohue et al. (1994) Biochem J 300: 599-603).

    [0282] The nucleic acid sequence of the AruPro1 gene isolated from Anoxybacillus rupiensis is set forth as SEQ ID NO: 1.

    TABLE-US-00002 ATGAAAAAGAAAGCTACTTTTATTTTAGCAGCAGGTTTAACGTTTAGTGC CCTTCTTCCATCATCGTATGCGGCCGTACAATCTCCCGCAGCACAAAAGC ATGCCCACCAGAAAATGCAAATCCTCCAAGAAAACTGGGATGCGAAAAAC GGTGCTCCAGAATTTCTATCCGGAAAGCTATCTTCACAGTCTTTTAAAAG CGAAAAAACGATCCGGGAATTTTTGAAAAACAATCAAGAAATTTATCAGA TCAATCCTGACACAGAGCTTACATTAGTCGATGTGAAGACCGATGAATTA GGCATGACCCACTATAAATATGTTCAGTCACTCAATGGCGTTCCGATAGA TGGCGGAGAATTTTTAGTCCATACGGATAAAAACGGGATTGTCAAAGCCA CGAACGGAAAGCTCCGTCCTAGCGCTTCGGACAAATTTAAAAACAAAACA GCCGCTAAAATTTCGGATAAAGAAGCCATTGACTTGGCTTGGAAGCACAT TAATGTAACGAAACAAGAAACAGAGGTCAAAGAGGATAACGCACCTTTAA AAGAAAAAACGGATGTCGCCAATACAGTGGAAAAAAGCAAACTGGTTGTT TACGAGAAGGATGGAAACTACTATTTGACCCATAAAGTAGAATTGCAATT TATTTATCCGTATCCGGCCAATTGGAAAATTTACGTTGATGCAAATAACG GCAAAATTGTCGATGCCTACAATGCTGTAGCCGAAGAGGCAACAAGCGGC TATGGCTACGGAGTATTAGGAGATTACAAAACTCTTAATACTTACTACTC TAACGGCACCTATTATTTATACGATGTGACAAAGCCGATGTCAGGGGTCA TCGAAACACGCACGGCGCAAAATGGCACGAGCTTGCCTGGCTCCTACTCT GTTGACAGCAATAATGCATGGACTGCTTCTTCACAACGTGCTGATGTAGA TGCCCATTATTATGCAGGAGTCGTCTACGACTATTACAAAAACACACATA ATCGCAATAGCTTTGATAACAACGGAGCAACGATTCGCTCAACGGTTCAC TATAGCAATAGATATAACAACGCATTTTGGAACGGAGTACAGATGGTTTA TGGAGACGGGGACGGAACGACGTTCGCTCCTTTATCAGGCGGACTCGATG TTGTCGCACATGAGTTAACACATGCTGTCACTGATCGAACAGCAGGGCTC GAATATCGCAACCAATCAGGCGCATTAAATGAATCAATGTCAGATGTTTT CGCTTGCTTTGTAGATTCAAATGATTACTTAATCGGCGAAGACGTCTATA CACCTAACGTTTCCGGCGATGCTTTAAGAAGCCTTTCTAATCCTCAAGCA TACGGACAGCCAGCTCACATGAACGACTATGTATACACCTCTTCAGATAA CGGCGGAGTGCATACAAATAGCGGTATTCCAAATAAAGCTGCCTATTTGA CGATTACTGCAATTGGCAAGGAAAAAGCAGAAAAAATTTATTATCGAGCA TTAACTGTCTATTTAACTCCAACAAGCAATTTCAGCAATGCTCGAGCCGC TTTATTACAAGCTGCTGCTGATTTGTATGGATCCGGCAGTTCAACATATA ATGCGGTGGCCAACGCTTGGAACCAAGTAGGAGTATAT

    [0283] The amino acid sequence of the AruPro1 precursor protein is set forth as SEQ ID NO: 2. The predicted native signal peptide is shown in italics, and the predicted pro-peptide is shown in underlined text.

    TABLE-US-00003 MKKKATFILAAGLTFSALLPSSYAAVQSPAAQKHAHQKMQILQENWDAKN GAPEFLSGKLSSQSFKSEKTIREFLKNNQEIYQINPDTELTLVDVKTDEL GMTHYKYVQSLNGVPIDGGEFLVHTDKNGIVKATNGKLRPSASDKFKNKT AAKISDKEAIDLAWKHINVTKQETEVKEDNAPLKEKTDVANTVEKSKLVV YEKDGNYYLTHKVELQFIYPYPANWKIYVDANNGKIVDAYNAVAEEATSG YGYGVLGDYKTLNTYYSNGTYYLYDVTKPMSGVIETRTAQNGTSLPGSYS VDSNNAWTASSQRADVDAHYYAGVVYDYYKNTHNRNSFDNNGATIRSTVH YSNRYNNAFWNGVQMVYGDGDGTTFAPLSGGLDVVAHELTHAVTDRTAGL EYRNQSGALNESMSDVFACFVDSNDYLIGEDVYTPNVSGDALRSLSNPQA YGQPAHMNDYVYTSSDNGGVHTNSGIPNKAAYLTITAIGKEKAEKIYYRA LTVYLTPTSNFSNARAALLQAAADLYGSGSSTYNAVANAWNQVGVY.

    [0284] The amino acid sequence of the predicted mature form of AruPro1 is set forth as SEQ ID NO: 3:

    TABLE-US-00004 VAEEATSGYGYGVLGDYKTLNTYYSNGTYYLYDVTKPMSGVIETRTAQNG TSLPGSYSVDSNNAWTASSQRADVDAHYYAGVVYDYYKNTHNRNSFDNNG ATIRSTVHYSNRYNNAFWNGVQMVYGDGDGTTFAPLSGGLDVVAHELTHA VTDRTAGLEYRNQSGALNEMSDVFACFVDSNDYLIGEDVYTPNVSGDALR SLSNPQAYGQPAHMNDYVYTSSDNGGVHTNSGIPNKAAYLTITAIGKEKA EKIYYRALTVYLTPTSNFSNARAALLQAAADLYGSGSSTYNAVANAWNQV GVY

    Example 1.2

    Expression of Metalloprotease AruPro1

    [0285] The DNA sequence of the propeptide-mature form of AruPro1 was synthesized and inserted into the Bacillus subtilis expression vector p2JM103BBI (Vogtentanz, Protein Expr Purif, 55:40-52, 2007) by Generay (Shanghai, China), resulting in plasmid pGX133 (AprE-AruPro1) (FIG. 1). Ligation of this gene encoding the AruPro1 protein into the digested vector resulted in the addition of three codons (Ala-Gly-Lys) between the 3 end of the Bacillus subtilis AprE signal sequence and the 5 end of the predicted AruPro1 native propeptide. The gene has an alternative start codon (GTG). As shown in FIG. 1, pGX133 (AprE-AruPro1) contains an AprE promoter, an AprE signal sequence used to direct target protein secretion in B. subtilis, and the synthetic nucleotide gene sequence (SEQ ID NO: 4), encoding the predicted propeptide and mature region of AruPro1. The translation product of the synthetic AprE-AruPro1 gene is shown in SEQ ID NO: 5.

    [0286] The pGX133(AprE-AruPro1) plasmid was then transformed into B. subtilis cells (degU.sup.Hy32, scoC) and the transformed cells were spread on Luria Agar plates supplemented with 5 ppm Chloramphenicol and 1.2% skim milk (Cat#232100, Difco). Colonies with the largest clear halos on the plates were selected and subjected to fermentation in a 250 ml shake flask with MBD medium (a MOPS based defined medium, supplemented with additional 5 mM CaCl.sub.2).

    [0287] The broth from the shake flasks was concentrated and buffer-exchanged into the loading buffer containing 20 mM Tris-HCl (pH 8.5), 1 mM CaCl.sub.2 and 10% propylene glycol using a VivaFlow 200 ultra filtration device (Sartorius Stedim). After filtering, this sample was applied to a 150 ml Q Sepharose High Performance column pre-equilibrated with the loading buffer above, and the active flow-through fractions were collected, concentrated and buffer-exchanged again into the loading buffer described above. The sample was then applied to Superdex-75 2660 column pre-equilibrated with the loading buffer above. The corresponding active purified protein fractions were pooled and concentrated via 5 K Amicon Ultra. The final product is more than 95% pure and stored in 40% glycerol at 20 C. until usage.

    [0288] The nucleotide sequence of the synthesized AruPro1 gene in plasmid pGX133 (AprE-AruPro1) is depicted in SEQ ID NO: 4. The oligonucleotide encoding the three residue addition (AGK) is shown in bold:

    TABLE-US-00005 GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAAT CTTTACGATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGCAG TTCAGAGCCCGGCAGCGCAAAAACACGCACACCAGAAGATGCAGATTCTG CAGGAAAACTGGGATGCGAAGAATGGCGCACCGGAGTTCCTGTCAGGCAA ACTTAGCTCACAAAGCTTCAAAAGCGAGAAAACGATCAGAGAGTTTCTGA AGAACAACCAGGAGATCTACCAAATCAACCCGGACACAGAACTGACGCTG GTTGATGTGAAAACAGACGAGCTGGGCATGACACACTACAAGTATGTTCA AAGCCTGAACGGCGTCCCGATTGATGGAGGCGAATTTCTGGTGCACACAG ACAAGAACGGCATTGTTAAAGCTACAAATGGAAAGCTGAGACCGAGCGCT TCAGACAAATTCAAGAATAAGACAGCAGCGAAGATCAGCGACAAAGAGGC TATCGACCTGGCGTGGAAACATATCAATGTGACGAAACAAGAGACAGAAG TGAAGGAAGATAATGCGCCGCTTAAAGAAAAGACGGATGTCGCAAATACA GTGGAGAAGTCAAAACTTGTCGTGTACGAAAAGGATGGAAACTATTATCT GACACATAAAGTCGAACTTCAATTCATCTATCCTTATCCGGCGAACTGGA AGATCTATGTTGATGCTAATAACGGAAAGATCGTGGACGCGTACAACGCA GTGGCAGAGGAAGCAACGTCAGGCTACGGATATGGCGTGCTTGGCGATTA CAAGACGCTGAATACATATTACAGCAATGGCACGTATTACCTTTACGATG TCACGAAGCCTATGAGCGGCGTGATTGAGACGAGAACAGCCCAAAACGGC ACGAGCCTTCCGGGATCATACAGCGTTGACTCAAATAACGCCTGGACGGC CTCATCACAGAGAGCAGATGTTGACGCGCACTACTACGCGGGAGTCGTTT ACGACTACTATAAGAACACACACAATAGAAACAGCTTTGACAACAATGGA GCAACAATTAGATCAACGGTGCATTACTCAAACAGATATAACAACGCTTT CTGGAACGGAGTGCAGATGGTTTATGGCGACGGCGATGGAACAACATTTG CTCCGCTGAGCGGAGGACTGGATGTTGTGGCACACGAGCTTACACATGCA GTCACAGATAGAACAGCTGGCCTGGAGTATAGAAATCAATCAGGCGCGCT GAACGAATCAATGAGCGACGTGTTTGCATGCTTTGTTGACAGCAACGATT ACCTGATCGGCGAGGATGTTTACACACCGAACGTCTCAGGCGACGCACTG AGATCACTTAGCAATCCGCAAGCATATGGCCAACCTGCGCACATGAATGA TTACGTGTATACGTCAAGCGATAACGGCGGCGTTCACACGAACTCAGGCA TCCCGAATAAAGCGGCATACCTGACAATTACGGCAATTGGCAAAGAGAAG GCGGAGAAGATTTACTACAGAGCGCTGACGGTGTACCTGACACCGACAAG CAACTTCTCAAATGCGAGAGCGGCACTGCTGCAAGCCGCAGCAGACCTGT ACGGCTCAGGCTCAAGCACATACAATGCAGTTGCCAACGCATGGAATCAA GTGGGCGTTTAT

    [0289] The amino acid sequence of the AruPro1 precursor protein expressed from plasmid pGX133 (AprE-AruPro1) is depicted in SEQ ID NO: 5. The predicted signal sequence is shown in italics, the three residue addition (AGK) is shown in bold, and the predicted pro-peptide is shown in underlined text:

    TABLE-US-00006 MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKAVQSPAAQKHAHQKMQI LQENWDAKNGAPEFLSGKLSSQSFKSEKTIREFLKNNQEIYQINPDTELT LVDVKTDELGMTHYKYVQSLNGVPIDGGEFLVHTDKNGIVKATNGKLRPS ASDKFKNKTAAKISDKEAIDLAWKHINVTKQETEVKEDNAPLKEKTDVAN TVEKSKLVVYEKDGNYYLTHKVELQFIYPYPANWKIYVDANNGKIVDAYN AVAEEATSGYGYGVLGDYKTLNTYYSNGTYYLYDVTKPMSGVIETRTAQN GTSLPGSYSVDSNNAWTASSQRADVDAHYYAGVVYDYYKNTHNRNSFDNN GATIRSTVHYSNRYNNAFWNGVQMVYGDGDGTTFAPLSGGLDVVAHELTH AVTDRTAGLEYRNQSGALNESMSDVFACFVDSNDYLIGEDVYTPNVSGDA LRSLSNPQAYGQPAHMNDYVYTSSDNGGVHTNSGIPNKAAYLTITAIGKE KAEKIYYRALTVYLTPTSNFSNARAALLQAAADLYGSGSSTYNAVANAWN QVGVY

    [0290] The amino acid sequence of the recombinant AruPro1 protein isolated from B. subtilis expression host was determined by tandem mass spectrometry and is set forth as SEQ ID NO: 6.

    TABLE-US-00007 EATSGYGYGVLGDYKTLNTYYSNGTYYLYDVTKPMSGVIETRTAQNGTS LPGSYSVDSNNAWTASSQRADVDAHYYAGVVYDYYKNTHNRNSFDNNGA TIRSTVHYSNRYNNAFWNGVQMVYGDGDGTTFAPLSGGLDVVAHELTHA VTDRTAGLEYRNQSGALNESMSDVFACFVDSNDYLIGEDVYTPNVSGDA LRSLSNPQAYGQPAHMNDYVYTSSDNGGVHTNSGIPNKAAYLTITAIGK EKAEKIYYRALTVYLTPTSNFSNARAALLQAAADLYGSGSSTYNAVANA WNQVGVY

    Example 1.3

    Proteolytic Activity of Metalloprotease AruPro1

    [0291] The proteolytic activity of purified AruPro1 was measured in 50 mM Tris (pH 7), using azo-casein (Cat#74H7165, Megazyme) as a substrate. Prior to the reaction, the enzyme was diluted with Milli-Q water (Millipore) to specific concentrations. The azo-casein was dissolved in 100 mM Tris buffer (pH 7) to a final concentration of 1.5% (w/v). To initiate the reaction, 50 l of the diluted enzyme (or Milli-Q H.sub.2O alone as the blank control) was added to the non-binding 96-well Microtiter Plate (96-MTP) (Corning Life Sciences, #3641) placed on ice, followed by the addition of 50 l of 1.5% azo-casein. After sealing the 96-MTP, the reaction was carried out in a Thermomixer (Eppendorf) at 40 C. and 650 rpm for 10 min. The reaction was terminated by adding 100 l of 5% Trichloroacetic Acid (TCA). Following equilibration (5 min at the room temperature) and subsequent centrifugation (2000 g for 10 min at 4 C.), 120 l supernatant was transferred to a new 96-MTP, and absorbance of the supernatant was measured at 440 nm (A.sub.440) using a SpectraMax 190. Net A.sub.440 nm was calculated by subtracting the A.sub.440 nm of the blank control from that of enzyme, and then plotted against different protein concentrations (from 1.25 ppm to 40 ppm). Each value was the mean of duplicate assays, and the value varies no more than 5%. The proteolytic activity is shown as Net A.sub.440 nm.

    [0292] The proteolytic assays with azo-casein as the substrate (FIG. 1.2) indicate that AruPro1 is an active protease.

    Example 1.4

    pH Profile of AruPro1 Protein

    [0293] With azo-casein as the substrate, the pH profile of AruPro1 protein was studied in 12.5 mM acetate/Bis-Tris/HEPES/CHES buffer with different pH values (ranging from pH 4 to 10.3). To initiate the assay, 50 l of 25 mM acetate/Bis-Tris/HEPES/CHES buffer with a specific pH was first mixed with 2 l diluted enzyme (125 ppm in Milli-Q H.sub.2O) in a 96-MTP placed on ice, followed by the addition of 48 l of 1.5% (w/v) azo-casein prepared in H.sub.2O. The reaction was performed and analyzed as described in Example 1.3. Enzyme activity at each pH was reported as the relative activity, where the activity at the optimal pH was set to be 100%. The pH values tested were 4, 5, 5.5, 6, 6.4, 7, 7.4, 7.8, 8.3, 9.7 and 10.3 using 12.5 mM acetate/Bis-Tris/HEPES/CHES buffer. Note that 100% activity corresponds to the activity of AruPro1 at pH 7. Each activity value was the mean of triplicate assays.

    [0294] As shown in FIG. 1.3, the optimal pH of AruPro1 is about 7 and the enzyme was found to retain greater than 70% of its maximal activity between pH 5.5 and 8.5.

    Example 1.5

    Temperature Profile of AruPro1 Protein

    [0295] The temperature profile of AruPro1 protein was analyzed in 50 mM Tris buffer (pH 7) using the azo-casein assay. The enzyme sample and azo-casein substrate were prepared as in Example 1.3. Prior to the reaction, 50 l of 1.5% azo-casein and 45 l Milli-Q H.sub.2O were mixed in a 200 l PCR tube, which was then subsequently incubated in a Peltier Thermal Cycler (BioRad) at desired temperatures (i.e. 20-90 C.) for 5 min. After the incubation, 5 l of diluted AruPro1 (50 ppm) or H.sub.2O (the blank control) was added to the substrate mixture, and the reaction was carried out in the Peltier Thermal Cycle for 10 min at different temperatures. To terminate the reaction, each assay mixture was transferred to a 96-MTP containing 100 l of 5% TCA per well. Subsequent centrifugation and absorbance measurement were performed as described in Example 1.3. The activity was reported as the relative activity, where the activity at the optimal temperature was set to be 100%. The tested temperatures are 20, 30, 40, 50, 60, 70, 80, and 90 C. Note that 100% activity corresponds to the activity of AruPro1 at 60 C. Each value was the mean of triplicate assays. The data in FIG. 1.4 suggest that AruPro1 showed an optimal temperature at 60 C., and retained greater than 70% of its maximal activity between 50 and 75 C.

    Example 1.6

    Cleaning Performance of AruPro1 in ADW Conditions

    [0296] The cleaning performance of AruPro1 protein was tested using PA-S-38 (egg yolk, with pigment, aged by heating) microswatches (CFT-Vlaardingen, The Netherlands) at pH 6 and 8 using a model automatic dishwashing (ADW) detergent. Prior to the reaction, purified AruPro1 protein samples were diluted with a dilution solution containing 10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN 80 and 10% propylene glycol to the desired concentrations. The reactions were performed in AT detergent at pH 6 or pH 8 with or without a bleach component (Peracid N,N-phthaloylaminoperoxycaproic acid-PAP) with 100 ppm water hardness (Ca.sup.2+: Mg.sup.2+=3:1) (detergent composition shown in Table 1.1). To initiate the reaction, 180 l of the AT detergent was added to a 96-MTP placed with PA-S-38 microswatches, followed by the addition of 20 l of diluted enzymes (or the dilution solution as the blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 30 min at 50 C. and 1150 rpm. After incubation, 100 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance was measured at 405 nm (referred here as the Initial performance) using a spectrophotometer. The remaining wash liquid in the 96-well plate was discarded and the microswatches were rinsed once with 200 l water. Following the addition of 180 l of 0.1 M CAPS buffer (pH 10), the second incubation was carried out in the incubator/shaker at 50 C. and 1150 rpm for 10 min. One hundred microliters of the resulting wash liquid was transferred to a new 96-MTP, and its absorbance measured at 405 nm (referred here as the Wash-off). The sum of two absorbance measurements (Initial performance plus Wash-off) gives the Total performance, which measures the protease activity on the model stain.

    [0297] Dose response for cleaning of PA-S-38 microswatches at pH 6 and pH 8 in AT dish detergent, in the absence of bleach, is shown in FIG. 5A and in the presence of bleach is shown in FIG. 5B.

    TABLE-US-00008 TABLE 1.1 Composition of AT dish detergent formula with bleach Concentration Ingredient (mg/ml) MGDA (methylglycinediacetic acid) 0.143 Sodium citrate 1.86 Citric acid* varies PAP (peracid N,N-phthaloylaminoperoxycaproic acid) 0.057 Plurafac LF 18B (a non-ionic surfactant) 0.029 Bismuthcitrate 0.006 Bayhibit S (Phosphonobutantricar- 0.006 boxylic acid sodium salt) Acusol 587 (a calcium polyphosphate inhibitor) 0.029 PEG 6000 0.043 PEG 1500 0.1 *The pH of the ADW formula detergent is adjusted to the desired value by the addition of 0.9M citric acid.

    [0298] As shown in FIG. 1.5, at pH 6 and pH 8 without bleach (FIG. 1.5A) and with bleach (FIG. 1.5B) assay conditions, AruPro1 exhibited substantially increased cleaning performance, demonstrating its potential in the application of ADW.

    Example 1.7

    Cleaning Performance of AruPro1 in Laundry Conditions

    A. Cleaning Performance in Liquid Laundry Detergent

    [0299] The cleaning performance of AruPro1 protein was tested using EMPA-116 (cotton soiled with blood/milk/ink) microswatches (obtained from CFT-Vlaardingen, The Netherlands) at pH 8.2 using a commercial detergent. Prior to the reaction, purified AruPro1 protein samples were diluted with a dilution solution (10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN 80 and 10% propylene glycol) to the desired concentrations and the commercial detergent (Tide, Clean Breeze, Proctor & Gamble, USA, purchased September 2011) was incubated at 95 C. for 1 hour to inactivate the enzymes present in the detergent. Proteolytic assays were subsequently performed to confirm the inactivation of proteases in the commercial detergent. The heat treated detergent was further diluted with 5 mM HEPES (pH 8.2) to a final concentration of 0.788 g/L. Meanwhile, the water hardness of the buffered liquid detergent was adjusted to 103 ppm (Ca.sup.2+: Mg.sup.2+=3:1). The specific conductivity of the buffered detergent was adjusted to either 0.62 mS/cm (low conductivity) or 3.5 mS/cm (high conductivity) by adjusting the NaCl concentration in the buffered detergent. To initiate the reaction, 190 l of either the high or low conductivity buffered detergent was added to a 96-MTP containing the EMPA-116 microswatches followed by the addition of 10 l of diluted enzyme (or the dilution solution as blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 20 min at 32 C. and 1150 rpm. After incubation, 150 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance measured at 600 nm (A.sub.600) using a spectrophotometer; and Net A.sub.600 was subsequently calculated by subtracting the A.sub.600 of the blank control from that of the enzyme. Dose response for the cleaning of EMPA-116 microswatches in liquid laundry detergent at high and low conductivity is shown in FIG. 1.6A.

    B. Cleaning Performance in Powder Laundry Detergent

    [0300] The cleaning performance of AruPro1 protein in powder laundry detergent was tested using PA-S-38 (egg yolk, with pigment, aged by heating) microswatches (CFT-Vlaardingen, The Netherlands) at) using a commercial detergent. Prior to the reaction, purified AruPro1 protein samples were diluted with a dilution solution (10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN and 10% propylene glycol) to the desired concentrations. The powder laundry detergent (Tide, Bleach Free, Proctor & Gamble, China, purchased in December 2011) was dissolved in water with 103 ppm water hardness (Ca.sup.2+: Mg.sup.2+=3:1) to a final concentration of 2 g/L (with conductivity of 2.3 mS/m-low conductivity) or 5 g/L (with conductivity of 5.5 mS/m-high conductivity). The detergents of different conductivities were subsequently heated in a microwave to near boiling in order to inactivate the enzymes present in the detergent. Proteolytic activity was measured following treatment to ensure that proteases in the commercial detergent had been inactivated. To initiate the reaction, 190 l of either the high or low conductivity heat-treated detergent was added to a 96-MTP containing the PA-S-38 microswatches, followed by the addition of 10 l of diluted enzyme (or the dilution solution as blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 15 minutes at 32 C. and 1150 rpm. After incubation, 150 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance measured at 405 nm (A.sub.405) using a spectrophotometer; and Net A.sub.405 was subsequently calculated by subtracting the A.sub.405 of the blank control from that of the enzyme. Dose response for the cleaning of PA-S-38 microswatches in powder laundry detergent at high and low conductivity is shown in FIG. 1.6B.

    Example 1.8

    Keratinolytic Activity of Metalloprotease AruPro1

    [0301] The keratin azure was prepared as follows. Commercially available keratin azure strings (K8500, Sigma) were scissored to small fragments, and subsequently suspended in 100 mM Tris buffer (pH 8) to a final concentration of 1% (w/v). To accelerate the substrate dissolution and homogenize the mixture, the keratin azure suspension was dispersed using an electric disperser (T 25 digital ULTRA-TURRAX-IKA) at 7200 rpm for 1 hr. The sample was kept on ice during the preparation process and the resulting suspension was stored in 4 C. for future assays.

    [0302] The keratinolytic activity of purified AruPro1 protease was measured in 50 mM Tris buffer (pH 8), using the 1% keratin azure as a substrate. Prior to the reaction, the enzyme was diluted with Milli-Q water (Millipore) to specific concentrations. To initiate the reaction, 50 l of the diluted enzyme (or Milli-Q H.sub.2O alone as the blank control) was added to the non-binding 96-well microtiter plate (96-MTP) (Corning Life Sciences, #3641) placed on ice, followed by the addition of 50 l of 1% keratin azure. After sealing the 96-MTP, the reaction was carried out in a Thermomixer (Eppendorf) at 50 C. and 600 rpm for 30 min. The reaction was terminated by adding 100 l of 10% Trichloroacetic Acid (TCA). Following equilibration (5 min at the room temperature) and subsequent centrifugation (2000 g for 10 min at 4 C.), 120 l of supernatant was transferred to a new 96-MTP, and absorbance of the supernatant was measured at 595 nm (A.sub.595) using a SpectraMax 190. Net A.sub.595 was calculated by subtracting the A.sub.595 of the blank control from that of enzyme, and then plotted against different protein concentrations (from 5 ppm to 160 ppm). Each value was the mean of duplicate assays (the value varies no more than 5%).

    [0303] The proteolytic activity is shown as Net A595. The keratinolytic assay as shown in FIG. 1.7 indicates that AruPro1 is active in degrading keratin azure.

    Example 1.9

    Activity of Metalloprotease AruPro1 on Chicken Feather Degradation

    [0304] The feather degradation activity of AruPro1 was tested in 50 mM Tris buffer (pH 8), using the natural chicken feather as a substrate. Before the assay, the chicken feather was rinsed by Milli-Q water, sterilized by soaking in 70% (v/v) ethanol for 3 hrs, and air dried and trimmed to have an ultimate weight between 0.02 g and 0.023 g. To initiate the reaction, one stem of the trimmed chicken feather was soaked into 10 ml of 50 mM Tris buffer (pH 8) supplemented with 0.2 mg/ml enzyme (or buffer alone as the blank control) in a 15 ml Falcon tube. The reaction was carried out at 50 C. in a water bath incubator for 6 days. Starting from Day 2, 100 l of diluted enzyme (2 mg/ml in 50 mM Tris buffer (pH 8)) (or buffer alone for the blank control) was added to the reaction solution, for compensating the activity loss during incubation. At the end of Day 6, photographs were taken for each tube to demonstrate the extent of feather degradation.

    [0305] Feather degradation is assessed by the observable amount of feather hairs fallen in the solution at the end of Day 6. As shown in FIG. 1.8, AruPro1 is active in degrading chicken feather. Images for the feather treatment in the presence of AruPro1 (Panel A and B) or buffer alone (blank control, Panel C and D) were taken at the end of Day 6 incubation. Panel B and D are close-up views of the tube bottoms shown in Panel A and C, respectively. No fallen hairs were observed at the beginning of the incubation.

    Example 1.10

    Comparison of AruPro1 to Other Proteases

    A. Identification of Homologous Proteases

    [0306] Homologs were identified by a BLAST search (Altschul et al., Nucleic Acids Res, 25:3389-402, 1997) against the NCBI non-redundant protein database and the Genome Quest Patent database with search parameters set to default values. The mature protein amino acid sequence for AruPro1 sequence (SEQ ID NO: 6) determined by tandem mass spectrometry was used as the query sequence. Percent identity (PID) is defined as the number of identical residues divided by the number of aligned residues in the pairwise alignment. Table 1.2 provides a list of sequences with the percent identity to AruPro1. The lengths in Table 1.2 refers to the entire sequence length of the homologous proteases.

    TABLE-US-00009 TABLE 1.2 List of sequences with percent identity to AruPro1 protein Accession # or % Identity Patent ID # to AruPro1 Organism Length EP0418625-0002 61.4 548 EP2390321-0182 61.4 316 JP1989095778-0001 61.4 316 JP1990268688-0001 61.4 552 JP1994014788-0002 61.4 316 JP2011103791-0020 61.4 552 P00800 61.4 Bacillus thermoproteolyticus 548 YP_002770810 61.5 Brevibacillus brevis NBRC 100599 528 ZP_01862236 61.9 Bacillus sp. 560 ZP_08640523 62 Brevibacillus laterosporus LMG 564 15441 YP_003597483 62.2 Bacillus megaterium DSM 319 562 YP_004646155 62.2 Paenibacillus mucilaginosus 525 AEN89796 62.2 Bacillus megaterium WSH-002 562 JP2002272453-0002 62.6 562 YP_005317038 62.8 Paenibacillus mucilaginosus 525 EP2390321-0186 62.9 304 WO2004011619-0001 62.9 319 YP_003251828 62.9 Geobacillus sp. 546 Q59223 62.9 Bacillus sp. 546 YP_004983596 62.9 Geobacillus thermoleovorans 546 YP_148691 62.9 Geobacillus kaustophilus 287 EP0867512-0001 63.2 319 EP2390321-0184 63.2 319 EP0867512-0002 63.4 316 AAP35685 63.4 Thermoactinomyces sp. 673 US6103512-0003 63.5 319 P43263 63.5 Brevibacillus brevis 527 ZP_04149015 65.4 Bacillus thuringiensis serovar 551 tochigiensis BGSC 4Y1 YP_002533316 67.4 Bacillus cereus 556 YP_001967182 67.8 Bacillus cereus 556 YP_002267469 67.8 Bacillus cereus H3081.97 556 ZP_04112166 67.8 Bacillus thuringiensis serovar 556 monterrey BGSC 4AJ1 ZP_04290037 67.8 Bacillus cereus 556 YP_895690 68.1 Bacillus thuringiensis str. Al Hakam 576 ZP_03110190 68.1 Bacillus cereus 556 ZP_04082272 68.1 Bacillus thuringiensis serovar 556 pulsiensis BGSC 4CCl ZP_04312654 68.1 Bacillus cereus BGSC 6E1 556 YP_245856 68.1 Bacillus cereus 556 YP_245603 68.6 Bacillus cereus 274 ZP_04270287 68.8 Bacillus cereus BDRD-ST26 556 YP_001374904 69.8 Bacillus cytotoxicus NVH 391-98 556 ZP_03225115 76.1 Bacillus coahuilensis m4-4 552 ZP_01168811 79.1 Bacillus sp. 549 ZP_01859803 79.7 Bacillus sp. 553 BAD13318 82.4 Bacillus vietnamensis 547

    B. Alignment of Homologous Protease Sequences

    [0307] The amino acid sequence of mature AruPro1 protein sequence (SEQ ID NO: 6) determined by tandem mass spectrometry was aligned with thermolysin (P00800, Bacillus thermoproteolyticus), NprE (WO 2008/153935), and protease from Bacillus vietnamensis (BAD13318) sequences using CLUSTALW software (Thompson et al., Nucleic Acids Research, 22:4673-4680, 1994) with the default parameters. FIG. 1.9 shows the alignment of AruPro1 with these protease sequences.

    C. Phylogenetic Tree

    [0308] A phylogenetic tree for AruPro1 precursor protein (SEQ ID NO: 2) was built using sequences of representative homologs from Table 2 and the Neighbor Joining method (NJ) (Saitou, N.; and Nei, M. (1987). The neighbor-joining method: A new method for reconstructing Guide Trees. Mol. Biol. Evol. 4, 406-425). The NJ method works on a matrix of distances between all pairs of sequence to be analyzed. These distances are related to the degree of divergence between the sequences. The phylodendron-phylogenetic tree printer software (http://iubio.bio.indiana.edu/treeapp/treeprint-form.html) was used to display the phylogenetic tree shown in FIG. 1.10.

    Example 2.1

    Cloning of Metalloprotease LmaPro1 from Lysinibacillus Macroides

    [0309] A Lysinibacillus macroides strain was selected as a potential source for different enzymes that are useful for various industrial applications. One of the genes identified in Lysinibacillus macroides encodes a metalloprotease and the sequence of this gene, called the LmaPro1 gene, is provided in SEQ ID NO: 7. The corresponding protein encoded by the LmaPro1 gene is shown in SEQ ID NO: 8. At the N-terminus, the protein has a signal peptide with a length of 33 amino acids as predicted by SignalP-4.0 (Nordahl Petersen et al. (2011) Nature Methods, 8:785-786). The presence of a signal sequence suggests that LmaPro1 is a secreted enzyme. The pre-pro and mature regions of LmaPro1 protein (SEQ ID NO: 8, SEQ ID NO: 9) were predicted based on the MEROPS peptide database (http://merops.sanger.ac.uk/) annotation for metalloprotease homolog MER001031.

    [0310] The nucleotide sequence of the LmaPro1 gene isolated from Lysinibacillus macroides is set forth as SEQ ID NO: 7. The sequence encoding the predicted native signal peptide is shown in italics:

    TABLE-US-00010 ATGAAGGAGTTGAGTGTTATGAAAGGTAAGGTATTTTTAGGAACTGCACT ATCAATCGGTCTATTATTTTCTGCTATTCCCCATCAAGAAGCTTTAGCGG CAAAAAATGTGTTAAGTGTTGAAAAGTACAATAAGCATAGGGATTCGCTA GAATACAAGTCTGGGAAGCTTACGGACCCCTCAAAGCAAACGGCAGAAGA TATCATTCTTACCTTTTTTGATGAGAACAAAAAGTCTTACAAGCTAGAAA AGCAAAAGGCGAAGGACTCCTTCACGATCGAGAAAGAAAGCAAGGATGAA CTGGGCAATACCGTCCTTAAATTGCAACAAACCTATAAAGGCGTACCAGT ATGGAATTCCACACAAGCCGTATTGATTGACGCTAAAGGTGTATTGACCG TCGTGTCCGGTACGGTTGAAGCCAATCTAAACACGAAATTAGGGAAAAAG GCTAAAAAAGGCATCAGTGAATCCGAAGCTATCAAAATAGCTGAAGCGGA TCTGGGGTTCACACCTGCTTACGAGCAATCACCTGAATCTGACCTGTATG TATACGCAAATGAAGGCAAGGCCGATTATGTATATAAAGTCAATTTGAAA TTCTTAAGTCCGGAACCAGGAAATCATCATTATTTCATTTCAGTCAAAAC GGGTAAAATCCTGAATAAATATAATACATTGGATGAAGTGACGGGGACCA ACTCCGTCGGAACGGGCACTGGCGTCTTAAACAATACGGTGTCGCTGAAC ACTACCTTATCCAACGGTCAATACTACTTACAAGATAATACACGCGGTAA AGGCATCTACACGTATAACGCCAATAACCGTTCAAGATTGCCTGGTACAC TCTTTTCCAACACAACAAATGCTTTTACTGCTTCTGCCGATAAAGCTGCG GTGGATGCCCATTATTATGCGGGTAAAACCTATGATTATTACAAATCCAC ATTTGGCCGGAACTCCTATGATGGTAATGGAACCATCCTGAAATCAACCG TCCATTATGGCTCAAGATACAATAATGCTTTTTGGGATGGCACCCAAATG GTTTACGGTGATGGAGATGGCACGACGTTCATCCCATTGTCCGGCGGGCT CGATGTCGTTGCGCATGAATTGACGCATGCCGTCACTTCCTCGGAATCGA ACCTTACATATCAATATGAATCCGGTGCTTTGAATGAAGCGATATCTGAT ATTTTTGGCACTGTCGTAGAATTTAAGAATCAAAGTGCCAAAGCCGATTA TTTGGTTGGGGAAGATATTTACACACCTAACATTTCCGGTGATGCACTCC GCTCGATGGCTAATCCAACATTGAATGGGGACCCTGACCATTATTCGAAC CGTTATACAGGAACGGGTGATAATGGCGGAGTCCACACGAACAGCGGAAT CATTAATAAGGCAGCTTATTTAATCTCTGCAGGCGGAACCCACCATGGCG TGAGTGTATCCGGAATCGGCATCGATAAACTAGGAACCATCTTTTATCGG GCAAACACAACATATTTAACTTCGTCGTCTACTTTTTCACAAGCCAGAGC GGCCGTCATACAATCGGCCTCTGATTTATACGGTTCAAGCAGTGCAGAAG TCACGGCTGTCAAAAATGCCTTTACTGCTGTCGGTGTGAAT

    [0311] The amino acid sequence of the LmaPro1 precursor protein is set forth as SEQ ID NO: 8. The predicted native signal peptide is shown in italics, and the predicted pro-peptide is shown in underlined text.

    TABLE-US-00011 MKELSVMKGKVFLGTALSIGLLFSAIPHQEALAAKNVLSVEKYNKHRDS LEYKSGKLTDPSKQTAEDIILTFFDENKKSYKLEKQKAKDSFTIEKESK DELGNTVLKLQQTYKGVPVWNSTQAVLIDAKGVLTVVSGTVEANLNTKL GKKAKKGISESEAIKIAEADLGETPAYEQSPESDLYVYANEGKADYVYK VNLKFLSPEPGNHEYFISVKTGKILNKYNTLDEVTGTNSVGTGTGVLNN TVSLNTTLSNGQYYLQDNTRGKGIYTYNANNRSRLPGTLFSNTTNAFTA SADKAAVDAHYYAGKTYDYYKSTFGRNSYDGNGTILKSTVHYGSRYNNA FWDGTQMVYGDGDGTTFIPLSGGLDVVAHELTHAVTSSESNLTYQYESG ALNEAISDIFGTVVEFKNQSAKADYLVGEDIYTPNISGDALRSMANPTL NGDPDHYSNRYTGTGDNGGVHTNSGIINKAAYLISAGGTHHGVSVSGIG IDKLGTIFYRANTTYLTSSSTFSQARAAVIQSASDLYGSSSAEVTAVKN AFTAVGVN
    The amino acid sequence of the predicted mature form of LmaPro1 is set forth as SEQ ID NO: 9.

    TABLE-US-00012 VTGTNSVGTGTGVLNNTVSLNTTLSNGQYYLQDNTRGKGIYTYNANNRSR LPGTLFSNTTNAFTASADKAAVDAHYYAGKTYDYYKSTFGRNSYDGNGTI LKSTVHYGSRYNNAFWDGTQMVYGDGDGTTFIPLSGGLDVVAHELTHAVT SSESNLTYQYESGALNEAISDIFGTVVEFKNQSAKADYLVGEDIYTPNIS GDALRSMANPTLNGDPDHYSNRYTGTGDNGGVHTNSGIINKAAYLISAGG THHGVSVSGIGIDKLGTIFYRANTTYLTSSSTFSQARAAVIQSASDLYGS SSAEVTAVKNAFTAVGVN

    Example 2.2

    Expression of Metalloprotease LmaPro1

    [0312] The DNA sequence of the propeptide-mature form of LmaPro1 was synthesized and inserted into the Bacillus subtilis expression vector p2JM103BBI (Vogtentanz, Protein Expr Purif, 55:40-52, 2007) by Generay (Shanghai, China), resulting in plasmid pGX125 (AprE-LmaPro1) (FIG. 2.1). Ligation of this gene encoding the LmaPro1 protein into the digested vector resulted in the addition of three codons (Ala-Gly-Lys) between the 3 end of the Bacillus subtilis AprE signal sequence and the 5 end of the predicted LmaPro1 native propeptide. The gene has an alternative start codon (GTG). The resulting plasmid shown in FIG. 1, labeled pGX125 (AprE-LmaPro1) contains an AprE promoter, an AprE signal sequence used to direct target protein secretion in B. subtilis, and the synthetic gene (SEQ ID NO: 10) encoding the predicted propeptide and mature regions of LmaPro1. The translation product of the synthetic AprE-LmaPro1 gene is shown in SEQ ID NO: 11.

    [0313] The pGX125 (AprE-LmaPro1) plasmid was then transformed into B. subtilis cells (degU.sup.Hy32, scoC) and the transformed cells were spread on Luria Agar plates supplemented with 5 ppm Chloramphenicol and 1.2% skim milk (Cat#232100, Difco). Colonies with the largest clear halos on the plates were selected and subjected to fermentation in a 250 ml shake flask with MBD medium (a MOPS based defined medium, supplemented with additional 5 mM CaCl.sub.2).

    [0314] The broth from the shake flasks was concentrated and buffer-exchanged into the loading buffer containing 20 mM Tris-HCl (pH 8.5), 1 mM CaCl.sub.2 and 10% propylene glycol using a VivaFlow 200 ultra filtration device (Sartorius Stedim). After filtering, this sample was applied to a 150 ml Q Sepharose High Performance column pre-equilibrated with the loading buffer above; and the active flow-through fractions were collected, concentrated and buffer-exchanged again into the loading buffer described above. The sample was loaded onto a 320 ml Superdex 75 gel filtration column pre-equilibrated with the loading buffer described above supplemented with additional 0.5 M NaCl. The corresponding active purified protein fractions were further pooled and concentrated via 10K Amicon Ultra for further analyses.

    [0315] The nucleotide sequence of LmaPro1 gene in plasmid pGX125(AprE-LmaPro1) is depicted in SEQ ID NO: 10. The predicted signal sequence is shown in italics and the oligonucleotide encoding the three residue addition (AGK) is shown in bold:

    TABLE-US-00013 GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAA TCTTTACGATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAGC GAAAAATGTTCTGTCAGTCGAAAAGTACAATAAGCATAGAGATTCACTG GAGTACAAGAGCGGAAAGCTTACAGATCCGAGCAAACAGACAGCAGAGG ACATCATCCTGACGTTCTTCGACGAAAACAAGAAGTCATACAAACTGGA GAAACAGAAAGCCAAGGATAGCTTCACGATCGAGAAAGAGTCAAAGGAC GAACTGGGAAACACAGTTCTTAAACTGCAGCAGACGTATAAGGGCGTTC CGGTTTGGAATAGCACGCAAGCTGTTCTGATTGATGCGAAGGGAGTTCT GACAGTCGTTAGCGGAACGGTGGAAGCGAACCTTAATACGAAACTGGGC AAGAAGGCAAAGAAAGGAATCAGCGAGAGCGAGGCCATCAAGATTGCCG AGGCCGATCTGGGCTTTACGCCTGCATATGAGCAAAGCCCTGAATCAGA TCTTTACGTGTACGCCAACGAGGGAAAAGCGGATTATGTCTACAAAGTT AACCTGAAGTTCCTTAGCCCGGAGCCTGGCAATCATCATTACTTTATCA GCGTTAAGACGGGAAAAATCCTGAACAAGTATAATACGCTGGACGAGGT TACGGGCACGAATAGCGTGGGCACAGGCACGGGCGTGCTTAATAACACG GTCTCACTTAACACGACACTGTCAAACGGCCAGTACTATCTGCAAGACA ACACGAGAGGCAAGGGAATCTACACATACAACGCGAATAACAGATCAAG ACTGCCGGGCACACTGTTTTCAAATACAACAAACGCCTTTACGGCTAGC GCGGATAAAGCAGCCGTGGATGCACATTACTACGCAGGAAAAACATACG ATTACTACAAAAGCACGTTTGGCAGAAATTCATACGACGGCAACGGCAC AATTCTGAAGAGCACGGTGCATTACGGAAGCAGATATAACAATGCCTTT TGGGACGGCACGCAGATGGTCTATGGAGATGGCGATGGCACAACGTTCA TCCCGCTGTCAGGCGGACTGGATGTGGTTGCACATGAGCTGACACATGC AGTGACGAGCAGCGAAAGCAACCTGACATATCAGTACGAATCAGGCGCG CTTAATGAGGCAATTTCAGACATCTTCGGCACAGTGGTTGAGTTCAAGA ACCAGAGCGCGAAGGCTGACTACCTGGTTGGCGAAGACATTTACACACC GAATATCTCAGGCGATGCCCTGAGAAGCATGGCCAACCCGACGCTTAAC GGCGACCCGGATCATTACAGCAATAGATACACGGGAACAGGCGACAATG GCGGCGTCCATACAAATTCAGGCATTATCAACAAGGCAGCCTATCTGAT CTCAGCTGGCGGCACACATCATGGCGTTTCAGTCTCAGGAATTGGCATC GACAAGCTGGGAACGATCTTCTACAGAGCGAACACAACATACCTTACGA GCTCAAGCACATTCTCACAAGCAAGAGCAGCAGTCATTCAGTCAGCATC AGACCTGTATGGCTCATCATCAGCAGAAGTGACGGCTGTTAAGAATGCG TTCACAGCAGTTGGAGTTAAT

    [0316] The amino acid sequence of the LmaPro1 precursor protein expressed from plasmid pGX125 (AprE-LmaPro1) is depicted in SEQ ID NO: 11. The predicted signal sequence is shown in italics, the three residue addition (AGK) is shown in bold, and the predicted pro-peptide is shown in underlined text:

    TABLE-US-00014 MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKAKNVLSVEKYNKHRDSL EYKSGKLTDPSKQTAEDIILTFFDENKKSYKLEKQKAKDSFTIEKESKD ELGNTVLKLQQTYKGVPVWNSTQAVLIDAKGVLTVVSGTVEANLNTKLG KKAKKGISESEAIKIAEADLGFTPAYEQSPESDLYVYANEGKADYVYKV NLKFLSPEPGNHHYFISVKTGKILNKYNTLDEVTGTNSVGTGTGVLNNT VSLNTTLSNGQYYLQDNTRGKGIYTYNANNRSRLPGTLFSNTTNAFTAS ADKAAVDAHYYAGKTYDYYKSTFGRNSYDGNGTILKSTVHYGSRYNNAF WDGTQMVYGDGDGTTFIPLSGGLDVVAHELTHAVTSSESNLTYQYESGA LNEAISDIFGTVVEFKNQSAKADYLVGEDIYTPNISGDALRSMANPTLN GDPDHYSNRYTGTGDNGGVHTNSGIINKAAYLISAGGTHHGVSVSGIGI DKLGTIFYRANTTYLTSSSTFSQARAAVIQSASDLYGSSSAEVTAVKNA FTAVGVN

    [0317] The amino acid sequence of the recombinant LmaPro1 protein isolated from Bacillus subtilis culture was determined by tandem mass spectrometry, and shown below. It is the same as predicted and depicted in SEQ ID NO: 9.

    TABLE-US-00015 VTGTNSVGTGTGVLNNTVSLNTTLSNGQYYLQDNTRGKGIYTYNANNRS RLPGTLFSNTTNAFTASADKAAVDAHYYAGKTYDYYKSTFGRNSYDGNG TILKSTVHYGSRYNNAFWDGTQMVYGDGDGTTFIPLSGGLDVVAHELTH AVTSSESNLTYQYESGALNEAISDIFGTVVEFKNQSAKADYLVGEDIYT PNISGDALRSMANPTLNGDPDHYSNRYTGTGDNGGVHTNSGIINKAAYL ISAGGTHHGVSVSGIGIDKLGTIFYRANTTYLTSSSTFSQARAAVIQSA SDLYGSSSAEVTAVKNAFTAVGVN

    Example 2.3

    Proteolytic Activity of Metalloprotease LmaPro1

    [0318] The proteolytic activity of purified LmaPro1 was measured in 50 mM Tris (pH 7), using azo-casein (Cat#74H7165, Megazyme) as a substrate. Prior to the reaction, the enzyme was diluted with Milli-Q water (Millipore) to specific concentrations. The azo-casein was dissolved in 100 mM Tris buffer (pH 7) to a final concentration of 1.5% (w/v). To initiate the reaction, 50 l of the diluted enzyme (or Milli-Q H.sub.2O alone as the blank control) was added to the non-binding 96-well Microtiter Plate (96-MTP) (Corning Life Sciences, #3641) placed on ice, followed by the addition of 50 l of 1.5% azo-casein. After sealing the 96-MTP, the reaction was carried out in a Thermomixer (Eppendorf) at 40 C. and 650 rpm for 30 min. The reaction was terminated by adding 100 l of 5% Trichloroacetic Acid (TCA). Following equilibration (5 min at the room temperature) and subsequent centrifugation (2000g for 10 min at 4 C.), 120 l supernatant was transferred to a new 96-MTP, and absorbance of the supernatant was measured at 440 nm (A.sub.440) using a SpectraMax 190. Net A.sub.440 was calculated by subtracting the A.sub.440 of the blank control from that of enzyme, and then plotted against different protein concentrations (from 1.25 ppm to 40 ppm). Each value was the mean of triplicate assays. The proteolytic activity is shown as Net A440. The proteolytic assays with azo-casein as the substrate (FIG. 1.2) indicate that LmaPro1 is an active protease.

    Example 2.4

    pH Profile of LmaPro1 Protein

    [0319] With azo-casein as the substrate, the pH profile of LmaPro1 was studied in 12.5 mM acetate/Bis-Tris/HEPES/CHES buffer with different pH values (ranging from pH 4 to 11). To initiate the assay, 50 l of 25 mM acetate/Bis-Tris/HEPES/CHES buffer with a specific pH was first mixed with 2 l diluted enzyme (1000 ppm in Milli-Q H.sub.2O) in a 96-MTP placed on ice, followed by the addition of 48 l of 1.5% (w/v) azo-casein prepared in H.sub.2O. The reaction was performed and analyzed as described in Example 2.3. Enzyme activity at each pH was reported as the relative activity, where the activity at the optimal pH was set to be 100%. The pH values tested were 4, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 10 and 11 using 12.5 mM acetate/Bis-Tris/HEPES/CHES buffer. Note that 100% activity corresponds to the activity of LmaPro1 at pH 7. Each value was the mean of triplicate assays. As shown in FIG. 2.3, the optimal pH of LmaPro1 is about 7 and the enzyme was found to retain greater than 70% of its maximal activity between pH 6 and 8.5.

    Example 2.5

    Temperature Profile of LmaPro1

    [0320] The temperature profile of LmaPro1 was analyzed in 50 mM Tris buffer (pH 7) using the azo-casein assay. The enzyme sample and azo-casein substrate were prepared as in Example 2.3. Prior to the reaction, 50 l of 1.5% azo-casein and 45 l Milli-Q H.sub.2O were mixed in a 200 l PCR tube, which was then subsequently incubated in a Peltier Thermal Cycler (BioRad) at desired temperatures (i.e. 2090 C) for 5 min. After the incubation, 5 l of diluted LmaPro1 (400 ppm) or H.sub.2O (the blank control) was added to the substrate mixture, and the reaction was carried out in the Peltier Thermal Cycle for 10 min at different temperatures. To terminate the reaction, each assay mixture was transferred to a 96-MTP containing 100 l of 5% TCA per well. Subsequent centrifugation and absorbance measurement were performed as described in Example 2.3. The activity was reported as the relative activity, where the activity at the optimal temperature was set to be 100%. The tested temperatures are 20, 30, 40, 50, 60, 70, 80 and 90 C. Note that 100% activity corresponds to the activity of LmaPro1 at 40 C. Each value was the mean of triplicate assays. The data in FIG. 2.4 suggest that LmaPro1 showed an optimal temperature at 40 C., and retained greater than 70% of its maximal activity between 30 and 45 C.

    Example 2.6

    Cleaning Performance of LmaPro1 in Automatic Dishwashing Conditions

    [0321] The cleaning performance of LmaPro1 protein was tested using PA-S-38 (egg yolk, with pigment, aged by heating) microswatches (CFT-Vlaardingen, The Netherlands) at pH 6 and 8 using a model automatic dishwashing (ADW). Prior to the reaction, purified LmaPro1 protein samples were diluted with a dilution solution containing 10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN 80 and 10% propylene glycol to the desired concentrations. The reactions were performed in AT detergent buffered at pH 6 or pH 8 with a bleach component (Peracid N,N-phthaloylaminoperoxycaproic acid-PAP) with 100 ppm water hardness (Ca.sup.2+: Mg.sup.2+=3:1) (detergent composition shown in Table 2.1). To initiate the reaction, 180 l of the detergent was added to a 96-MTP placed with PA-S-38 microswatches, followed by the addition of 20 l of diluted enzymes (or the dilution solution as the blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 30 min at 50 C. and 1150 rpm. After incubation, 100 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance was measured at 405 nm (referred here as the Initial performance) using a spectrophotometer. The remaining wash liquid in the 96-well plate was discarded and the microswatches were rinsed once with 200 l water. Following the addition of 180 l of 0.1 M CAPS buffer (pH 10), the second incubation was carried out in the incubator/shaker at 50 C. and 1150 rpm for 10 min. One hundred microliters of the resulting wash liquid was transferred to a new 96-MTP, and its absorbance measured at 405 nm (referred here as the Wash-off). The sum of two absorbance measurements (Initial performance plus Wash-off) gives the Total performance, which measures the protease activity on the model stain. Dose response for cleaning of PA-S-38 microswatches at pH 6 in the presence of bleach, is shown in FIG. 5A and at pH 8 in the presence of bleach is shown in FIG. 5B.

    TABLE-US-00016 TABLE 2.1 Composition of AT dish detergent Concentration Ingredient (mg/ml) MGDA (methylglycinediacetic acid) 0.143 Sodium citrate 1.86 Citric acid* varies PAP (peracid N,N-phthaloylaminoperoxycaproic acid) 0.057 Plurafac LF 301 (a non-ionic surfactant) 0.029 Bismuthcitrate 0.006 Bayhibit S (Phosphonobutantricar- 0.006 boxylic acid sodium salt) Acusol 587 (a calcium polyphosphate inhibitor) 0.029 PEG 6000 0.043 PEG 1500 0.1 *The pH of the AT formula detergent is adjusted to the desired value (pH 6 or 8) by the addition of 0.9M citric acid. As shown in FIG. 2.5, at both pH 6 (FIG. 2.5A) and pH 8 (FIG. 2.5B) assay conditions, LmaPro1 exhibited cleaning performance.

    Example 2.7

    Cleaning Performance of LmaPro1 in Laundry Conditions

    A. Cleaning Performance in Liquid Laundry Detergent

    [0322] The cleaning performance of LmaPro1 protein in liquid laundry detergent was tested using EMPA-116 (cotton soiled with blood/milk/ink) microswatches (obtained from CFT-Vlaardingen, The Netherlands) at pH 8.2 using a commercial detergent. Prior to the reaction, purified LmaPro1 protein samples were diluted with a dilution solution (10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN 80 and 10% propylene glycol) to the desired concentrations; and the commercial detergent (Tide, Clean Breeze, Proctor & Gamble, USA, purchased September 2011) was incubated at 95 C. for 1 hour to inactivate the enzymes present in the detergent. Proteolytic assays were subsequently performed to confirm the inactivation of proteases in the commercial detergent. The heat treated detergent was further diluted with 5 mM HEPES (pH 8.2) to a final concentration of 0.788 g/L. Meanwhile, the water hardness of the buffered liquid detergent was adjusted to 103 ppm (Ca.sup.2+: Mg.sup.2+=3:1). The specific conductivity of the buffered detergent was adjusted to either 0.62 mS/cm (low conductivity) or 3.5 mS/cm (high conductivity) by adjusting the NaCl concentration in the buffered detergent. To initiate the reaction, 190 l of either the high or low conductivity buffered detergent was added to a 96-MTP containing the EMPA-116 microswatches followed by the addition of 10 l of diluted enzyme (or the dilution solution as blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 20 min at 32 C. and 1150 rpm. After incubation, 150 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance measured at 600 nm (A600) using a spectrophotometer; and Net A.sub.600 was subsequently calculated by subtracting the A600 of the blank control from that of the enzyme. Dose response for the cleaning of EMPA-116 microswatches in liquid laundry detergent at high and low conductivity is shown in FIG. 2.6A.

    B. Cleaning Performance in Powder Laundry Detergent

    [0323] The cleaning performance of LmaPro1 protein in powder laundry detergent was tested using PA-S-38 (egg yolk, with pigment, aged by heating) microswatches (CFT-Vlaardingen, The Netherlands) using a commercial detergent. Prior to the reaction, purified LmaPro1 protein samples were diluted with a dilution solution (10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN 80 and 10% propylene glycol) to the desired concentrations. The powder laundry detergent (Tide, Bleach Free, Proctor & Gamble, China, purchased in December 2011) was dissolved in water with 103 ppm water hardness (Ca.sup.2+: Mg.sup.2+=3:1) to a final concentration of 2 g/L (with conductivity of 2.3 mS/m-low conductivity) or 5 g/L (with conductivity of 5.5 mS/m-high conductivity). The detergents of different conductivities were subsequently heated in a microwave to near boiling in order to inactivate the enzymes present in the detergent. Proteolytic activity was measured following treatment to ensure that proteases in the commercial detergent had been inactivated. To initiate the reaction, 190 l of either the high or low conductivity heat-treated detergent was added to a 96-MTP containing the PA-S-38 microswatches, followed by the addition of 10 l of diluted enzyme (or the dilution solution as blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 15 minutes at 32 C. and 1150 rpm. After incubation, 150 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance measured at 405 nm (A.sub.405) using a spectrophotometer; and Net A.sub.405 was subsequently calculated by subtracting the A.sub.405 of the blank control from that of the enzyme. Dose response for the cleaning of PA-S-38 microswatches in powder laundry detergent at high and low conductivity is shown in FIG. 2.6B.

    Example 2.8

    Comparison of LmaPro1 to Other Proteases

    [0324] A. Identification of Homologous Proteases

    [0325] Homologs were identified by a BLAST search (Altschul et al., Nucleic Acids Res, 25:3389-402, 1997) against the NCBI non-redundant protein database and the Genome Quest Patent database with search parameters set to default values. The mature amino acid sequence for LmaPro1 (SEQ ID NO: 9) was used as the query sequence. Percent identity (PID) is defined as the number of identical residues divided by the number of aligned residues in the pairwise alignment. Table 2.2 provides a list of sequences with the percent identity to LmaPro1. The length in Table 2.2 refers to the entire sequence length of the homologous proteases.

    TABLE-US-00017 TABLE 2.2 List of sequences with percent identity to LmaPro1 protein Accession # or % Identity to Patent ID # LmaPro1 Organism Length EP0418625-0002 68 548 JP1989095778-0001 68 316 JP2011103791-0020 68 552 P00800 68 Bacillus thermoproteolyticus 548 WO2004011619-0046 68.1 536 ZP_01862236 68.1 Bacillus sp. 560 ZP_01858398 69.4 Bacillus sp. 546 ACK38255 70 Bacillus pseudomycoides 566 ZP_04287690 70 Bacillus cereus 565 NP_830419 70 Bacillus cereus ATCC 14579 566 ZP_09359745 70 Bacillus sp. 566 ABA41628 70 Bacillus cereus 317 ZP_03103075 70.3 Bacillus cereus 566 ZP_03235110 70.3 Bacillus cereus H3081.97 566 ZP_04118794 70.3 Bacillus thuringiensis serovar 566 pakistani str. T13001 ZP_04315842 70.3 Bacillus cereus ATCC 10876 566 P0CH29 70.3 Bacillus megaterium 562 AAZ42070 70.3 Bacillus cereus 566 WO2004011619-0047 70.4 532 JP2002272453-0002 70.5 562 YP_002336730 70.7 Bacillus cereus 566 ZP_04070233 70.7 Bacillus thuringiensis IBL 200 566 ZP_04232101 70.7 Bacillus cereus Rock3-28 566 ZP_04249501 70.7 Bacillus cereus 95/8201 581 ZP_04321694 70.7 Bacillus cereus 566 YP_003597483 70.7 Bacillus megaterium DSM 319 562 AEN89796 70.7 Bacillus megaterium WSH-002 562 NP_976992 70.7 Bacillus cereus ATCC 10987 566 ZP_00237895 70.7 Bacillus cereus 566 YP_001373863 71 Bacillus cytotoxicus NVH 391-98 565 1ESP_A 71 Bacillus cereus 317 YP_001643408 71 Bacillus weihenstephanensis 566 ZP_04076923 71 Bacillus thuringiensis serovar 581 pulsiensis BGSC 4CC1 ZP_04100468 71 Bacillus thuringiensis serovar 566 berliner ATCC 10792 ZP_04149724 71 Bacillus pseudomycoides DSM 12442 566 ZP_04167241 71 Bacillus mycoides DSM 2048 566 ZP_04216147 71 Bacillus cereus Rock3-44 566 ZP_04260426 71 Bacillus cereus BDRD-ST196 566 ZP_04298968 71 Bacillus cereus 566 YP_082117 71 Bacillus cereus 566 JP1994014788-0003 71.3 317 ZP_03108685 71.3 Bacillus cereus NVH0597-99 566 ZP_04195790 71.3 Bacillus cereus 566 ZP_04293320 71.3 Bacillus cereus 566 YP_893436 71.6 Bacillus thuringiensis str. Al Hakam 566 ZP_03114008 71.6 Bacillus cereus 566

    [0326] B. Alignment of Homologous Protease Sequences

    [0327] The amino acid sequence of mature LmaPro1 protein (SEQ ID NO: 9) was aligned to thermolysin (P00800, Bacillus thermoproteolyticus) and Bacillolysin (using ZP 04310163, Bacillus cereus BGSC 6E1) sequences using CLUSTALW software (Thompson et al., Nucleic Acids Research, 22:4673-4680, 1994) with the default parameters. FIG. 2.7 shows the alignment of LmaPro1 with these protease sequences.

    [0328] C. Phylogenetic Tree

    [0329] A phylogenetic tree for LmaPro1 precursor protein (SEQ ID NO: 8) was built using sequences of representative homologs from Table 2.2 and the Neighbor Joining method (NJ) (Saitou, N.; and Nei, M. (1987). The neighbor-joining method: a new method for reconstructing Guide Trees. MolBiol.Evol. 4, 406-425). The NJ method works on a matrix of distances between all pairs of sequence to be analyzed. These distances are related to the degree of divergence between the sequences. The phylodendron-phylogenetic tree printer software (http://iubio.bio.indiana.edu/treeapp/treeprint-form.html) was used to display the phylogenetic tree shown in FIG. 2.8.

    Example 3.1

    Cloning of Brevibacillus brevis Metalloprotease BbrPro1

    [0330] The nucleic acid sequence for the BbrPro1 gene was identified in the NCBI database (GenBank Reference Sequence: X61286.1 from 647-2230) and is provided in SEQ ID NO: 12. The corresponding protein encoded by the BbrPro1 gene is shown in SEQ ID NO: 13. At the N-terminus, the protein has a signal peptide with a length of 28 amino acids as predicted by SignalP version 4.0 (Nordahl Petersen et al. (2011) Nature Methods, 8:785-786). The presence of a signal sequence suggests that BbrPro1 is a secreted enzyme. The propeptide region was predicted based on protein sequence alignment with the Paenibacillus polymyxa Npr protein (Takekawa et al. (1991) Journal of Bacteriology, 173 (21): 6820-6825). The predicted mature region of BbrPro1 protein is shown in SEQ ID NO: 14.

    [0331] The nucleotide sequence of the BbrPro1 gene identified from NCBI database is set forth as SEQ ID NO: 12. The sequence encoding the predicted native signal peptide is shown in italics:

    TABLE-US-00018 ATGAAAAAGTCTTACCTTGCTACCAGCCTTACTCTCAGTATTGCCGTAGG TGTGTCGGGATTTACGTCGGTGCCTGCTTTCGCCAAAACGAAGATCGACT ACCACAAACAGTGGGACACACCGCAGTATATCGGTGAAGTATGGGAGCCA GAAGGGGCAAAGGGGGATGACGTCGTCTGGTCATACCTCGAAAAGTACAA AGACGAGTTCCGTATTCAAGGAAATGTGGAGGACCACTTCGAAATTGTGA ATGAGGCTCGCAACAAAGAAACGGATACGAAGCACTATCGGTTGCAGGAA GTCTACAACGGAATTCCGATTTACGGCTTCCAGCAAACCGTTCACATAGA TGCTGACGGCAATGTCACGTCTTTTCTGGGCCAATTCATTCCCGATCTCG ATTCCAACAAGCAGTTGAAAAAGAAGCCGAAGCTCAATGAACAAAAAGCA GTGAAACAAGCGATCAAGGACGTTGAGGGCGAAGTGGGCGAAAAGCCGGA TTTCATCCAGGACCCAGAGGCGAAGCTGTACATTTACGTGCATGAGGATG AATCTTATCTGGCGTATGCAGTCGAGCTGAACTTCCTCGATCCGGAGCCA GGCCGTTGGATGTACTTCATCGACGCCCATAGCGGAGATGTCATCAACAA ATACAATATGCTCGACCACGTGACCGCAACCGGAAAAGGGGTACTGGGCG ATACGAAACAGTTCGAGACCACAAAGCAAGGTAGCACGTACATGTTGAAA GACACGACGCGCGGAAAAGGCATCGAGACATACACGCCAATAACCGCACT TCGCTTCCTGGCACGCTTATGACCGACAGCGACAACTATTGGACAGATGG GGCTGCAGTCGATGCACACGCCCATGCGCAAAAGACGTACGACTACTTCC GCAACGTCCACAACCGCAACAGCTACGATGGAAACGGCGCCGTGATCCGC TCCACCGTTCACTACAGCACGAGATACAATAACGCCTTCTGGAACGGCAG CCAGATGGTTTATGGAGATGGAGACGGCACTACATTCCTGCCACTGTCCG GCGGGCTGGACGTAGTAGCGCATGAGCTGACCCACGCCGTTACCGAGAGG ACAGCAGGACTGGTCTATCAAAATGAATCCGGTGCGTTGAACGAATCGAT GTCCGACATTTTCGGCGCGATGGTTGACAACGACGATTGGCTGATGGGCG AGGACATCTACACACCAGGTAGAAGCGGAGACGCACTGCGCTCCCTGCAG GACCCGGCAGCGTATGGCGACCCGGATCACTACAGCAAGCGCTACACCGG CTCCCAGGATAACGGCGGCGTCCACACCAACAGCGGAATCAACAACAAGG CAGCGTACCTGCTGGCAGAAGGCGGCACGCACTACGGAGTACGCGTCAAC GGCATCGGCCGCACAGATACAGCGAAAATTTACTACCATGCCCTGACGCA TTACCTGACACCTTACTCCAACTTCTCCGCTATGCGCCGTGCAGCAGTGC TGTCCGCTACTGACTTGTTCGGTGCAAACTCCCGTCAGGTTCAAGCTGTT AATGCAGCGTATGACGCTGTAGGCGTAAAATAA

    [0332] The amino acid sequence of the BbrPro1 precursor protein is set forth as SEQ ID NO: 13. The predicted signal sequence is shown in italics, and the predicted pro-peptide is shown in underlined text:

    TABLE-US-00019 MKKSYLATSLTLSIAVGVSGFTSVPAFAKTKIDYHKQWDTPQYIGEVWEP EGAKGDDVVWSYLEKYKDEFRIQGNVEDHFEIVNEARNKETDTKHYRLQE VYNGIPIYGFQQTVHIDADGNVTSFLGQFIPDLDSNKQLKKKPKLNEQKA VKQAIKDVEGEVGEKPDFIQDPEAKLYIYVHEDESYLAYAVELNELDPEP GRWMYFIDAHSGDVINKYNMLDHVTATGKGVLGDTKQFETTKQGSTYMLK DTTRGKGIETYTANNRTSLPGTLMTDSDNYWTDGAAVDAHAHAQKTYDYF RNVHNRNSYDGNGAVIRSTVHYSTRYNNAFWNGSQMVYGDGDGTTFLPLS GGLDVVAHELTHAVTERTAGLVYQNESGALNESMSDIFGAMVDNDDWLMG EDIYTPGRSGDALRSLQDPAAYGDPDHYSKRYTGSQDNGGVHTNSGINNK AAYLLAEGGTHYGVRVNGIGRTDTAKIYYHALTHYLTPYSNFSAMRRAAV LSATDLFGANSRQVQAVNAAYDAVGVK

    [0333] The amino acid sequence of the predicted mature form of BbrPro1 is set forth as SEQ ID NO: 14:

    TABLE-US-00020 VTATGKGVLGDTKQFETTKQGSTYMLKDTTRGKGIETYTANNRTSLPGTL MTDSDNYWTDGAAVDAHAHAQKTYDYFRNVHNRNSYDGNGAVIRSTVHYS TRYNNAFWNGSQMVYGDGDGTTFLPLSGGLDVVAHELTHAVTERTAGLVY QNESGALNESMSDIFGAMVDNDDWLMGEDIYTPGRSGDALRSLQDPAAYG DPDHYSKRYTGSQDNGGVHTNSGINNKAAYLLAEGGTHYGVRVNGIGRTD TAKIYYHALTHYLTPYSNFSAMRRAAVLSATDLFGANSRQVQAVNAAYDA VGVK

    Example 3.2

    Expression of Brevibacillus brevis Metalloprotease BbrPro1

    [0334] The DNA sequence of the propeptide-mature form of BbrPro1 was synthesized and inserted into the Bacillus subtilis expression vector p2JM103BBI (Vogtentanz, Protein Expr Purif, 55:40-52, 2007) by Generay (Shanghai, China), resulting in plasmid pGX140 (AprE-BbrPro1) (FIG. 1). Ligation of this gene encoding the BbrPro1 protein into the digested vector resulted in the addition of three codons (Ala-Gly-Lys) between the 3 end of the B. subtilis AprE signal sequence and the 5 end of the predicted BbrPro1 native propeptide. The gene has an alternative start codon (GTG). The resulting plasmid shown in FIG. 3.1, labeled pGX140 (AprE-BbrPro1) contains an AprE promoter, an AprE signal sequence used to direct target protein secretion in B. subtilis, and the synthetic nucleotide sequence encoding the predicted propeptide and mature regions of BbrPro1 (SEQ ID NO: 15). The translation product of the synthetic AprE-BbrPro1 gene is shown in SEQ ID NO: 16.

    [0335] The pGX140(AprE-BbrPro1) plasmid was then transformed into B. subtilis cells (degU.sup.Hy32, scoC) and the transformed cells were spread on Luria Agar plates supplemented with 5 ppm Chloramphenicol and 1.2% skim milk (Cat#232100, Difco). Colonies with the largest clear halos on the plates were selected and subjected to fermentation in a 250 ml shake flask with MBD medium (a MOPS based defined medium, supplemented with additional 5 mM CaCl.sub.2).

    [0336] The broth from the shake flasks was concentrated and buffer-exchanged into the loading buffer containing 20 mM Tris-HCl (pH 8.5), 1 mM CaCl.sub.2 and 10% propylene glycol using a VivaFlow 200 ultra filtration device (Sartorius Stedim). After filtering, this sample was applied to an 80 ml Q Sepharose High Performance column pre-equilibrated with the loading buffer above; and the active flow-through fractions were collected and concentrated. The sample was loaded onto a 320 ml Superdex 75 gel filtration column pre-equilibrated with the loading buffer described above containing 0.15 M NaCl. The corresponding active purified protein fractions were further pooled and concentrated via 10K Amicon Ultra for further analyses.

    [0337] The nucleotide sequence of the synthesized BbrPro1 gene in plasmid pGX140(AprE-BbrPro1) is depicted in SEQ ID NO: 15. The sequence encoding the three residue addition (AGK) is shown in bold:

    TABLE-US-00021 GTGAGAAGCAAAAAATTGTGGATCAGCTTGTTGTTTGCGTTAACGTTAAT CTTTACGATGGCGTTCAGCAACATGAGCGCGCAGGCTGCTGGAAAAAAAA CAAAGATCGACACCATAAACAATGGGACACGCCTCAGTACATCGGCGAGG TTTGGGAACCGGAAGGAGCAAAGGGCGACGATGTGGTCTGGAGCTATCTG GAGAAGTACAAAGACGAGTTTAGAATCCAGGGCAACGTCGAGGATCACTT TGAGATCGTCAACGAGGCCAGAAACAGGAGACAGACACAAAACACTACAG ACTGCAGGAGGTGTATAACGGCATTCCGATTTACGGCTTCCAGCAGACGG TCCATATTGACGCGGATGGAAACGTTACGAGCTTCCTGGGACAGTTTATC CCGGATCTGGACAGCAACAAGCAACTGAAAAAGAAGCCGAAACTGAACGA GCAGAAGGCCGTCAAACAAGCGATCAAAGATGTTGAAGGAGAGGTCGGCG AAAAACCGGACTTCATCCAAGATCCTGAGGCCAAACTGTACATCTATGTT CACGAGGACGAAAGCTACCTTGCGTATGCAGTGGAACTTAATTTCCTGGA CCCTGAACCGGGCAGATGGATGTATTTCATCGACGCCCACTCAGGCGACG TCATCAACAAATACAATATGCTTGACCACGTGACGGCTACGGGCAAAGGC GTTCTGGGAGATACGAAGCAGTTCGAGACGACAAAGCAGGGCAGCACATA CATGCTGAAGGACACAACAAGAGGAAAGGGAATCGAAACGTACACGGCAA ACAATAGAACATCACTGCCTGGCACGCTGATGACAGATTCAGACAACTAT TGGACGGACGGAGCAGCTGTCGACGCGCATGCACACGCGCAGAAAACGTA TGACTACTTCAGAAACGTGCATAACAGAAACTCATACGACGGCAATGGCG CCGTCATTAGATCAACGGTGCATTACAGCACGAGATATAACAATGCGTTT TGGAACGGAAGCCAGATGGTGTACGGCGACGGAGACGGCACGACATTCCT TCCTCTGTCAGGCGGCCTGGATGTTGTTGCACATGAACTGACACACGCAG TTACGGAGAGAACAGCGGGCCTGGTTTATCAGAATGAAAGCGGAGCGCTT AATGAGTCAATGAGCGACATTTTCGGCGCGATGGTCGATAACGACGATTG GCTGATGGGCGAGGACATTTATACGCCGGGAAGAAGCGGCGATGCACTGA GAAGCCTGCAAGACCCTGCCGCGTATGGCGACCCGGACCACTACTCAAAA AGATATACAGGCAGCCAGGACAACGGCGGAGTTCACACGAATAGCGGAAT TAACAATAAAGCGGCATACCTGCTTGCTGAGGGCGGCACACACTATGGAG TTAGAGTGAATGGCATTGGCAGAACGGACACAGCCAAAATCTATTATCAC GCTCTGACGCACTACCTGACGCCGTATAGCAACTTCAGCGCAATGAGAAG AGCTGCAGTTCTTTCAGCGACAGACCTGTTCGGAGCCAACTCAAGACAAG TGCAAGCGGTGAACGCCGCATATGATGCAGTCGGAGTGAAA

    [0338] The amino acid sequence of the BbrPro1 precursor protein expressed from plasmid pGX140 (AprE-BbrPro1) is depicted in SEQ ID NO: 16. The predicted signal sequence is shown in italics, the three residue addition (AGK) is shown in bold, and the predicted pro-peptide is shown in underlined text.

    TABLE-US-00022 MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKKTKIDYHKQWDTPQYIG EVWEPEGAKGDDVVWSYLEKYKDEFRIQGNVEDHFEIVNEARNKETDTK HYRLQEVYNGIPIYGFQQTVHIDADGNVTSFLGQFIPDLDSNKQLKKKP KLNEQKAVKQAIKDVEGEVGEKPDFIQDPEAKLYIYVHEDESYLAYAVE LNFLDPEPGRWMYFIDAHSGDVINKYNMLDHVTATGKGVLGDTKQFETT KQGSTYMLKDTTRGKGIETYTANNRTSLPGTLMTDSDNYWTDGAAVDAH AHAQKTYDYFRNVHNRNSYDGNGAVIRSTVHYSTRYNNAFWNGSQMVYG DGDGTTFLPLSGGLDVVAHELTHAVTERTAGLVYQNESGALNESMSDIF GAMVDNDDWLMGEDIYTPGRSGDALRSLQDPAAYGDPDHYSKRYTGSQD NGGVHTNSGINNKAAYLLAEGGTHYGVRVNGIGRTDTAKIYYHALTHYL TPYSNFSAMRRAAVLSATDLFGANSRQVQAVNAAYDAVGVK

    Example 3.3

    Proteolytic Activity of Metalloprotease BbrPro1

    [0339] The proteolytic activity of purified BbrPro1 was measured in 50 mM Tris (pH 7), using azo-casein (Cat#74H7165, Megazyme) as a substrate. Prior to the reaction, the enzyme was diluted with Milli-Q water (Millipore) to specific concentrations. The azo-casein was dissolved in 100 mM Tris buffer (pH 7) to a final concentration of 1.5% (w/v). To initiate the reaction, 50 l of the diluted enzyme (or Milli-Q H.sub.2O alone as the blank control) was added to the non-binding 96-well Microtiter Plate (96-MTP) (Corning Life Sciences, #3641) placed on ice, followed by the addition of 50 l of 1.5% azo-casein. After sealing the 96-MTP, the reaction was carried out in a Thermomixer (Eppendorf) at 40 C. and 650 rpm for 10 min. The reaction was terminated by adding 100 l of 5% Trichloroacetic Acid (TCA). Following equilibration (5 min at the room temperature) and subsequent centrifugation (2000 g for 10 min at 4 C.), 120 l supernatant was transferred to a new 96-MTP, and absorbance of the supernatant was measured at 440 nm (A.sub.440) using a SpectraMax 190. Net A.sub.440 was calculated by subtracting the A.sub.440 of the blank control from that of enzyme, and then plotted against different protein concentrations (from 1.25 ppm to 40 ppm). Each value was the mean of triplicate assays.

    [0340] The proteolytic activity is shown as Net A.sub.440. The proteolytic assay with azo-casein as the substrate shown in FIG. 2 indicates that BbrPro1 is an active protease.

    Example 3.4

    pH Profile of Metalloprotease BbrPro1

    [0341] With azo-casein as the substrate, the pH profile of the purified BbrPro1 was studied in 12.5 mM acetate/Bis-Tris/HEPES/CHES buffer with different pH values (ranging from pH 4 to 11). To initiate the assay, 50 l of 25 mM acetate/Bis-Tris/HEPES/CHES buffer with a specific pH was first mixed with 2 l diluted enzyme (62.5 ppm in Milli-Q H.sub.2O) in a 96-MTP placed on ice, followed by the addition of 48 l of 1.5% (w/v) azo-casein prepared in H.sub.2O. The reaction was performed and analyzed as described in Example 3.3. Enzyme activity at each pH was reported as the relative activity, where the activity at the optimal pH was set to be 100%. The pH values tested were 4, 5, 6, 7, 8, 9, 10 and 11. Each value was the mean of triplicate assays. As shown in FIG. 3.3, the optimal pH of BbrPro1 is about 8, with greater than 70% of maximal activity retained between 6 and 9.5.

    Example 3.5

    Temperature Profile of Metalloprotease BbrPro1

    [0342] The temperature profile of the purified BbrPro1 was analyzed in 50 mM Tris buffer (pH 7) using the azo-casein assays. The enzyme sample and azo-casein substrate were prepared as in Example 3.3. Prior to the reaction, 50 l of 1.5% azo-casein and 45 l Milli-Q H.sub.2O were mixed in a 200 l PCR tube, which was then subsequently incubated in a Peltier Thermal Cycler (BioRad) at desired temperatures (i.e. 2090 C.) for 5 min. After the incubation, 5 l of diluted enzyme (25 ppm) or H.sub.2O (the blank control) was added to the substrate mixture, and the reaction was carried out in the Peltier Thermal Cycle for 10 min at different temperatures. To terminate the reaction, each assay mixture was transferred to a 96-MTP containing 100 l of 5% TCA per well. Subsequent centrifugation and absorbance measurement were performed as described in Example 3.3. The activity was reported as the relative activity, where the activity at the optimal temperature was set to be 100%. The tested temperatures are 20, 30, 40, 50, 60, 70, 80, and 90 C. Each value was the mean of duplicate assays (the value varies no more than 5%). The data in FIG. 3.4 suggest that BbrPro1 showed an optimal temperature at 70 C., and retained greater than 70% of its maximum activity between 55 and 75 C.

    Example 3.6

    Cleaning Performance of Metalloprotease BbrPro1

    [0343] The cleaning performance of purified BbrPro1 was tested using PA-S-38 (egg yolk, with pigment, aged by heating) microswatches (CFT-Vlaardingen, The Netherlands) at pH 6 and 8 using a model automatic dishwashing (ADW) detergent. Prior to the reaction, purified protease samples were diluted with a dilution solution containing 10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005% TWEEN 80 and 10% propylene glycol to the desired concentrations. The reactions were performed in AT detergent (composition shown in Table 3.1) with 100 ppm water hardness (Ca.sup.2+: Mg.sup.2+=3:1), in the presence of a bleach component (Peracid N,N-phthaloylaminoperoxycaproic acid-PAP). To initiate the reaction, 180 l of the AT detergent buffered at pH 6 or pH 8 was added to a 96-MTP placed with PA-S-38 microswatches, followed by the addition of 20 l of diluted enzymes (or the dilution solution as the blank control). The 96-MTP was sealed and incubated in an incubator/shaker for 30 min at 50 C. and 1150 rpm. After incubation, 100 l of wash liquid from each well was transferred to a new 96-MTP, and its absorbance was measured at 405 nm (referred here as the Initial performance) using a spectrophotometer. The remaining wash liquid in the 96-MTP was discarded and the microswatches were rinsed once with 200 l water. Following the addition of 180 l of 0.1 M CAPS buffer (pH 10), the second incubation was carried out in the incubator/shaker at 50 C. and 1150 rpm for 10 min. One hundred microliters of the resulting wash liquid was transferred to a new 96-MTP, and its absorbance was measured at 405 nm (referred here as the Wash-off). The sum of two absorbance measurements (Initial performance plus Wash-off) gives the Total performance, which measures the protease activity on the model stain; and Net A.sub.405 was subsequently calculated by subtracting the A.sub.405 of the Total performance of the blank control from that of the enzyme. Dose response in cleaning the PA-S-38 microswatches at pH 6 and pH 8 for BbrPro1 in AT dish detergent, in the presence of bleach, is shown in FIGS. 3.5A and 3.5B, respectively.

    TABLE-US-00023 TABLE 3.1 Composition of AT dish detergent (containing bleach) Concentration Ingredient (mg/ml) MGDA (methylglycinediacetic acid) 0.143 Sodium citrate 1.86 Citric acid* varies PAP (peracid N,N-phthaloylaminoperoxycaproic acid) 0.057 Plurafac LF 18B (a non-ionic surfactant) 0.029 Bismuthcitrate 0.006 Bayhibit S (Phosphonobutantricar- 0.006 boxylic acid sodium salt) Acusol 587 (a calcium polyphosphate inhibitor) 0.029 PEG 6000 0.043 PEG 1500 0.1 *The pH of the AT formula detergent is adjusted to the desired value (pH 6 or 8) by the addition of 0.9M citric acid.

    Example 3.8

    Keratinolytic Activity of Metalloprotease BbrPro1

    [0344] The keratin azure was prepared as follows. Commercially available keratin azure strings (K8500, Sigma) were scissored to small fragments, and subsequently suspended in 100 mM Tris buffer (pH 8) to a final concentration of 1% (w/v). To accelerate the substrate dissolution and homogenize the mixture, the keratin azure suspension was dispersed using an electric disperser (T 25 digital ULTRA-TURRAX-IKA) at 7200 rpm for 1 hr. The sample was kept on ice during the preparation process and the resulting suspension was stored in 4 C. for future assays.

    [0345] The keratinolytic activity of purified BbrPro1 protease was measured in 50 mM Tris buffer (pH 8), using the 1% keratin azure as a substrate. Prior to the reaction, the enzyme was diluted with Milli-Q water (Millipore) to specific concentrations. To initiate the reaction, 50 l of the diluted enzyme (or Milli-Q H.sub.2O alone as the blank control) was added to the non-binding 96-well microtiter plate (96-MTP) (Corning Life Sciences, #3641) placed on ice, followed by the addition of 50 l of 1% keratin azure. After sealing the 96-MTP, the reaction was carried out in a Thermomixer (Eppendorf) at 50 C. and 600 rpm for 30 min. The reaction was terminated by adding 100 l of 10% Trichloroacetic Acid (TCA). Following equilibration (5 min at the room temperature) and subsequent centrifugation (2000 g for 10 min at 4 C.), 120 l of supernatant was transferred to a new 96-MTP, and absorbance of the supernatant was measured at 595 nm (A.sub.595) using a SpectraMax 190. Net A.sub.595 was calculated by subtracting the A.sub.595 of the blank control from that of enzyme, and then plotted against different protein concentrations (from 5 ppm to 160 ppm). Each value was the mean of duplicate assays (the value varies no more than 5%). The proteolytic activity is shown as Net A595. The keratinolytic assay as shown in FIG. 3.6 indicates that BbrPro1 is active in degrading keratin azure.

    Example 3.9

    Activity of Metalloprotease BbrPro1 on Chicken Feather Degradation

    [0346] The feather degradation activity of BbrPro1 was tested in 50 mM Tris buffer (pH 8), using the natural chicken feather as a substrate. Before the assay, the chicken feather was rinsed by Milli-Q water, sterilized by soaking in 70% (v/v) ethanol for 3 hrs, and air dried and trimmed to have an ultimate weight between 0.02 g and 0.023 g. To initiate the reaction, one stem of the trimmed chicken feather was soaked into 10 ml of 50 mM Tris buffer (pH 8) supplemented with 0.2 mg/ml enzyme (or buffer alone as the blank control) in a 15 ml Falcon tube. The reaction was carried out at 50 C. in a water bath incubator for 6 days. Starting from Day 2, 100 l of diluted enzyme (2 mg/ml in 50 mM Tris buffer (pH 8)) (or buffer alone for the blank control) was added to the reaction solution, for compensating the activity loss during incubation. At the end of Day 6, photographs were taken for each tube to demonstrate the extent of feather degradation. Feather degradation is assessed by the observable amount of feather hairs fallen in the solution at the end of Day 6. As shown in FIG. 3.7, BbrPro1 is active in degrading chicken feather.

    Example 3.10

    Comparison of BbrPro1 to Other Proteases

    [0347] A. Identification of Homologous Proteases

    [0348] Homologs were identified by a BLAST search (Altschul et al., Nucleic Acids Res, 25:3389-402, 1997) against the NCBI non-redundant protein database and the Genome Quest Patent database with search parameters set to default values. The predicted mature protein amino acid sequence for BbrPro1 (SEQ ID NO: 14) was used as the query sequence. Percent identity (PID) for both search sets is defined as the number of identical residues divided by the number of aligned residues in the pairwise alignment. Tables 3.2A and 3.2B provide a list of sequences with the percent identity to BbrPro1. The lengths in Table 3.2 refer to the entire sequence length of the homologous proteases.

    TABLE-US-00024 TABLE 3.2A List of sequences with percent identity to BbrPro1 protein identified from the NCBI non-redundant protein database Accession # PID to BbrPro1 Organism Length AAA22623.1 65 Bacillus caldolyticus 544 AAA22621.1 66 Geobacillus stearothermophilus 548 ZP_08511445.1 66 Paenibacillus sp. HGF7 525 P00800 67 Bacillus thermoproteolyticus 548 ZP_09071078.1 67 Paenibacillus larvae subsp. larvae B-3650 529 ZP_08093424.1 67 Planococcus donghaensis MPA1U2 553 ZP_08640523.1 69 Brevibacillus laterosporus LMG 15441 564 ZP_01862236.1 69 Bacillus sp. SG-1 560 YP_004646155.1 72 Paenibacillus mucilaginosus KNP414 525 YP_005317038.1 72 Paenibacillus mucilaginosus 3016 525 ZP_10575942.1 75 Brevibacillus sp. BC25 528 YP_002770810.1 78 Brevibacillus brevis NBRC 100599 528 ZP_10738945.1 86 Brevibacillus sp. CF112 528 CAA43589.1 100 Brevibacillus brevis 527

    TABLE-US-00025 TABLE 3.2B List of sequences with percent identity to BbrPro1 protein identified from the Genome Quest Patent database Patent ID # PID to BbrPro1 Organism Length WO2012110563-0002 66.02 Bacillus caldolyticus 319 US6518054-0001 66.99 Bacillus sp. 319 US20090208474-0030 67.53 Bacillus thermoproteolyticus 316 US20120107907-0182 67.86 Bacillus thermoproteolyticus 316 US6103512-0004 67.86 316 US20120009651-0002 67.86 Geobacillus caldoproteolyticus 548 WO2004011619-0051 67.86 empty 551 JP2011103791-0020 67.86 Geobacillus stearothermophilus 552 JP1990265491-0001 67.86 Bacillus stearothermophilus 552 WO2004011619-0050 67.86 552 US8114656-0183 67.86 Bacillus stearothermophilis 316 WO2004011619-0054 68.18 548 WO2004011619-0044 93.42 507 US8114656-0186 100 Bacillus brevis 304

    [0349] B. Alignment of Homologous Protease Sequences

    [0350] The amino acid sequence of predicted mature BbrPro1 (SEQ ID NO: 14) was aligned with Proteinase T (P00800, Bacillus thermoproteolyticus), NprE (WO 2008/153935), and protease from Brevibacillus brevis (CAA43589.1) using CLUSTALW software (Thompson et al., Nucleic Acids Research, 22:4673-4680, 1994) with the default parameters. FIG. 3.8 shows the alignment of BbrPro1 with these protease sequences.

    [0351] C. Phylogenetic Tree

    [0352] A phylogenetic tree for precursor BbrPro1 (SEQ ID NO: 13) was built using sequences of representative homologs from Table 3.2A and the Neighbor Joining method (NJ) (Saitou, N.; and Nei, M. (1987). The neighbor-joining method: a new method for reconstructing Guide Trees. MolBiol.Evol. 4, 406-425). The NJ method works on a matrix of distances between all pairs of sequences to be analyzed. These distances are related to the degree of divergence between the sequences. The phylodendron-phylogenetic tree printer software (http://iubio.bio.indiana.edu/treeapp/treeprint-form.html) was used to display the phylogenetic tree shown in FIG. 3.9.

    Example 3.11

    Terg-o-Tometer Performance Evaluation of BbrPro1

    [0353] The wash performance of BbrPro1 was tested in a laundry detergent application using a Terg-o-Tometer (Instrument Marketing Services, Inc, Fairfield, N.J.). The performance evaluation was conducted at 32 C. and 16 C. The soil load consisted of two of each of the following stain swatches: EMPA116 Blood, Milk, Ink on cotton (Test materials AG, St. Gallen, Switzerland), EMPA117 Blood, Milk, Ink on polycotton (Test materials AG, St. Gallen, Switzerland), EMPA112 Cocoa on cotton (Test materials AG, St. Gallen, Switzerland), and CFT C-10 Pigment, Oil, and Milk content on cotton (Center for Testmaterials BV, Vlaardingen, Netherlands), plus extra white interlock knit fabric to bring the total fabric load to 40 g per beaker of the Terg-o-Tometer, which was filled with 1 L of deionized water. The water hardness was adjusted to 6 grains per gallon, and the pH in the beaker was buffered with 5 mM HEPES, pH 8.2. Heat inactivated Tide Regular HDL (Procter & Gamble), a commercial liquid detergent purchased in a local US supermarket, was used at 0.8 g/L. The detergent was inactivated before use by treatment at 92 C. in a water bath for 2-3 hours followed by cooling to room temperature. Heat inactivation of commercial detergents serves to destroy the activity of enzymatic components while retaining the properties of the non-enzymatic components. Enzyme activity in the heat inactivated detergent was measured using the Suc-AAPF-pNA assay for measuring protease activity. The Purafect Prime HA, (Genencor Int'l) and BbrPro1 proteases were each added to final concentrations of 0, 0.2, 0.5, 1, and 1.5 ppm. The wash time was 12 minutes. After the wash treatment, all swatches were rinsed for 3 minutes and machine-dried at low heat.

    [0354] Four of each types of swatch were measured before and after treatment by optical reflectance using a Tristimulus Minolta Meter CR-400. The difference in the L, a, b values was converted to total color difference (dE), as defined by the CIE-LAB color space. Cleaning of the stains is expressed as percent stain removal index (% SRI) by taking a ratio between the color difference before and after washing, and comparing it to the difference of unwashed soils (before wash) to unsoiled fabric, and averaging the eight values obtained by reading two different regions of each washed swatch and is reported in Tables 3.11A and 3.11B as Average % SRI (dE)95CI. Table 3.11A summarizes the cleaning performance of BbrPro1 at 32 C. and Table 3.11B at 16 C.

    TABLE-US-00026 TABLE 3.11A Cleaning performance of BbrPro1 at 32 C. ppm enzyme EMPA-116 EMPA-117 Purafect Prime Purafect Prime HA BbrPro1 HA BbrPro1 95CI 95CI 95CI 95CI Average [% Average [% Average [% Average [% % SRI SRI % SRI SRI % SRI SRI % SRI SRI (dE) (dE)] (dE) (dE)] (dE) (dE)] (dE) (dE)] 0 0.25 0.02 0.25 0.02 0.19 0.02 0.19 0.02 0.2 0.31 0.02 0.29 0.03 0.31 0.03 0.27 0.02 0.5 0.34 0.02 0.32 0.03 0.34 0.02 0.32 0.02 1 0.35 0.03 0.32 0.01 0.38 0.03 0.32 0.02 1.5 0.36 0.02 0.37 0.03 0.35 0.03 0.38 0.03 ppm enzyme EMPA-112 CFT C-10 Purafect Prime Purafect Prime HA BbrPro1 HA BbrPro1 95CI 95CI 95CI 95CI Average [% Average [% Average [% Average [% % SRI SRI % SRI SRI % SRI SRI % SRI SRI (dE) (dE)] (dE) (dE)] (dE) (dE)] (dE) (dE)] 0 0.15 0.03 0.15 0.03 0.07 0.01 0.07 0.01 0.2 0.17 0.04 0.13 0.03 0.11 0.01 0.12 0.01 0.5 0.19 0.02 0.14 0.02 0.13 0.01 0.16 0.01 1 0.20 0.03 0.15 0.05 0.17 0.01 0.18 0.01 1.5 0.24 0.03 0.13 0.03 0.17 0.02 0.17 0.02

    TABLE-US-00027 TABLE 3.11B Cleaning performance of BbrPro1 at 16 C. ppm enzyme EMPA-116 EMPA-117 Purafect Prime Purafect Prime HA BbrPro1 HA BbrPro1 95CI 95CI 95CI 95CI Average [% Average [% Average [% Average [% % SRI SRI % SRI SRI % SRI SRI % SRI SRI (dE) (dE)] (dE) (dE)] (dE) (dE)] (dE) (dE)] 0 0.14 0.02 0.14 0.02 0.12 0.01 0.12 0.01 0.2 0.19 0.03 0.16 0.02 0.17 0.02 0.13 0.01 0.5 0.22 0.03 0.18 0.02 0.20 0.03 0.15 0.02 1 0.24 0.03 0.21 0.02 0.20 0.01 0.18 0.02 1.5 0.23 0.03 0.21 0.02 0.23 0.02 0.17 0.03 ppm enzyme EMPA-112 CFT C-10 Purafect Prime Purafect Prime HA BbrPro1 HA BbrPro1 95CI 95CI 95CI 95CI Average [% Average [% Average [% Average [% % SRI SRI % SRI SRI % SRI SRI % SRI SRI (dE) (dE)] (dE) (dE)] (dE) (dE)] (dE) (dE)] 0 0.09 0.03 0.09 0.03 0.07 0.01 0.07 0.01 0.2 0.07 0.01 0.08 0.02 0.08 0.02 0.06 0.00 0.5 0.11 0.02 0.11 0.02 0.10 0.01 0.06 0.01 1 0.11 0.02 0.10 0.02 0.13 0.01 0.07 0.01 1.5 0.13 0.03 0.09 0.02 0.13 0.01 0.12 0.01

    [0355] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein can be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.