ANTIBODY-MEDIATED NEUTRALIZATION OF CHIKUNGUNYA VIRUS
20180079802 ยท 2018-03-22
Inventors
- James E. Crowe, Jr. (Nashville, TN)
- Scott A. Smith (White Bluff, TN, US)
- Terence Dermody (Brentwood, TN, US)
- Laurie Silva (Nashville, TN, US)
Cpc classification
A61K39/395
HUMAN NECESSITIES
C07K16/1081
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K2039/507
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
G01N2333/181
PHYSICS
International classification
Abstract
The present disclosure is directed to antibodies binding to and neutralizing Chikungunya virus (CHIKV) and methods for use thereof.
Claims
1. A method of detecting a Chikungunya virus infection in a subject comprising: (a) contacting a sample from said subject with an antibody or antibody fragment according to claim 26; and (b) detecting Chikungunya virus glycoprotein E2 in said sample by binding of said antibody or antibody fragment to E2 in said sample.
2. The method of claim 1, wherein said sample is a body fluid.
3-4. (canceled)
5. The method of claim 1, further comprising performing steps (a) and (b) a second time and determining a change in the E2 levels as compared to the first assay.
6-12. (canceled)
13. A method of treating a subject infected with Chikungunya Virus, or reducing the likelihood of infection of a subject at risk of contracting Chikungunya virus, comprising delivering to said subject an antibody or antibody fragment according to claim 26.
14-22. (canceled)
23. The method of claim 13, wherein said antibody or antibody fragment is administered prior to infection.
24. The method of claim 13, wherein said antibody or antibody fragment is administered after infection.
25. The method of claim 13, wherein delivering comprises antibody or antibody fragment administration, or genetic delivery with an RNA or DNA sequence or vector encoding the antibody or antibody fragment.
26. A recombinant monoclonal antibody, wherein the antibody or antibody fragment is characterized by clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively.
27. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences according to clone-paired sequences from Table 1.
28. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having at least 70%, 80%, or 90% identity to clone-paired sequences from Table 1.
29. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having at least 95% identity to clone-paired sequences from Table 1.
30. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences according to clone-paired sequences from Table 2.
31. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences having 95% identity to clone-paired sequences from Table 2.
32. The recombinant monoclonal antibody of claim 26, wherein the antibody fragment is a recombinant ScFv (single chain fragment variable) antibody, Fab fragment, F(ab).sub.2 fragment, or Fv fragment.
33. The recombinant monoclonal antibody of 26, wherein said antibody is a chimeric antibody, or is bispecific antibody that targets a Chikungunya virus antigen other than glycoprotein.
34. The recombinant monoclonal antibody of 26, wherein said antibody is an IgG.
35. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment further comprises a cell penetrating peptide and/or is an intrabody.
36. A hybridoma or engineered cell encoding an antibody or antibody fragment according to claim 26.
37-46. (canceled)
47. The recombinant monoclonal antibody of claim 26, wherein said antibody or antibody fragment comprises: a CDRH1 consisting of SEQ ID NO: 103; a CDRH2 consisting of SEQ ID NO: 104; a CDRH3 consisting of SEQ ID NO: 105; a CDRL1 consisting of SEQ ID NO: 187; a CDRL2 consisting of SEQ ID NO: 188; a CDRL3 consisting of SEQ ID NO: 189.
48. The monoclonal antibody of claim 26, wherein the variable region of its heavy chain comprises or consists of SEQ ID NO: 53 and the variable region of its light chain comprises or consists of SEQ ID NO: 54.
49. A pharmaceutical composition comprising the isolated and/or recombinant monoclonal antibody or antibody fragment according to claim 26.
50. A cell line producing the isolated and/or recombinant monoclonal antibody or antibody fragment according to claim 26.
51. A method of producing the isolated and/or recombinant monoclonal antibody or antibody fragment according to claim 1, wherein said method comprises the step of: (a) culturing a cell line producing said isolated and/or recombinant monoclonal antibody or antibody fragment; (b) purifying the produced isolated and/or recombinant monoclonal antibody or antibody fragment; and optionally (c) formulating said isolated and/or recombinant monoclonal antibody or antibody fragment into a pharmaceutical composition.
52. An isolated and/or recombinant monoclonal antibody, wherein the antibody or antibody fragment is obtainable by the method of claim 51.
53. A kit comprising one isolated and/or recombinant monoclonal antibody or antibody fragment according to claim 26 and optionally packaging material.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0034] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure. The disclosure may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0050] The inventors isolated a large panel of human mAbs that neutralize CHIKV infectivity in cell culture and successfully treated Ifnar.sup./ mice (lacking type I interferon receptors) inoculated with a lethal dose of CHIKV, even when administered as late as 60 hours after infection. They identified the A domain of E2 as the major antigenic site for recognition by mAbs that broadly neutralize CHIKV infection with ultrapotent activity and showed that the principal mechanism of inhibition is to prevent fusion. These and other aspects of the disclosure are described in detail below.
I. CHIKUNGUNYA AND CHIKUNGUNYA VIRUS
[0051] Chikungunya is an infection caused by the chikungunya virus. It features sudden onset fever usually lasting two to seven days, and joint pains typically lasting weeks or months but sometimes years. The mortality rate is a little less than 1 in 1000, with the elderly most likely to die. The virus is passed to humans by two species of mosquito of the genus Aedes: A. albopictus and A. aegypti. Animal reservoirs of the virus include monkeys, birds, cattle, and rodents. This is in contrast to dengue, for which only primates are hosts.
[0052] The best means of prevention is overall mosquito control and the avoidance of bites by any infected mosquitoes. No specific treatment is known, but medications can be used to reduce symptoms. Rest and fluids may also be useful.
[0053] The incubation period of chikungunya disease ranges from two to twelve days, typically three to seven. Between 72 and 97% of those infected will develop symptoms. Symptoms include sudden onset, sometimes biphasic fever typically lasting from a few days to a week, sometimes up to ten days, usually above 39 C. (102 F.) and sometimes reaching 41 C. (104 F.), and strong joint pain or stiffness usually lasting weeks or months but sometimes lasting years. Rash (usually maculopapular), muscle pain, headache, fatigue, nausea or vomiting may also be present. Inflammation of the eyes may present as iridocyclitis, or uveitis, and retina lesions may occur. Typically, the fever lasts for two days and then ends abruptly. However, headache, insomnia and an extreme degree of prostration last for a variable period, usually about five to seven days.
[0054] Observations during recent epidemics have suggested chikungunya may cause long-term symptoms following acute infection. During the La Reunion outbreak in 2006, more than 50% of subjects over the age of 45 reported long-term musculoskeletal pain with up to 60% of people reporting prolonged painful joints three years following initial infection. A study of imported cases in France reported that 59% of people still suffered from arthralgia two years after acute infection. Following a local epidemic of chikungunya in Italy, 66% of people reported muscle pains, joint pains, or asthenia at one year after acute infection. Long-term symptoms are not an entirely new observation; long-term arthritis was observed following an outbreak in 1979. Common predictors of prolonged symptoms are increased age and prior rheumatological disease. The cause of these chronic symptoms is currently not fully known. Markers of autoimmune or rheumatoid disease have not been found in people reporting chronic symptoms. However, some evidence from humans and animal models suggests chikungunya may be able to establish chronic infections within the host. Viral antigen was detected in a muscle biopsy of a people suffering a recurrent episode of disease three months after initial onset. Additionally, viral antigen and RNA were found in synovial macrophages of a person during a relapse of musculoskeletal disease 18 months after initial infection. Several animal models have also suggested chikungunya virus may establish persistent infections. In a mouse model, viral RNA was detected specifically in joint-associated tissue for at least 16 weeks after inoculation, and was associated with chronic synovitis. Similarly, another study reported detection of a viral reporter gene in joint tissue of mice for weeks after inoculation. In a non-human primate model, chikungunya virus was found to persist in the spleen for at least six weeks.
[0055] Chikungunya virus is an alphavirus with a positive-sense single-stranded RNA genome of about 11.6 kb. It is a member of the Semliki Forest virus complex and is closely related to Ross River virus, O'nyong'nyong virus, and Semliki Forest virus. In the United States, it is classified as a category C priority pathogen and work requires biosafety level III precautions. Human epithelial and endothelial cells, primary fibroblasts, and monocyte-derived macrophages are permissive for chikungunya virus in vitro, and viral replication is highly cytopathic, but susceptible to type-I and -II interferon. In vivo, chikungunya virus appears to replicate in fibroblasts, skeletal muscle progenitor cells, and myofibers.
[0056] Chikungunya virus is an alphavirus, as are the viruses that cause eastern equine encephalitis and western equine encephalitis. Chikungunya is generally spread through bites from A. aegypti mosquitoes, but recent research by the Pasteur Institute in Paris has suggested chikungunya virus strains in the 2005-2006 Reunion Island outbreak incurred a mutation that facilitated transmission by the Asian tiger mosquito (A. albopictus).
[0057] Chikungunya virus infection of A. albopictus was caused by a point mutation in one of the viral envelope genes (E1). Enhanced transmission of chikungunya virus by A. albopictus could mean an increased risk for outbreaks in other areas where the Asian tiger mosquito is present. A recent epidemic in Italy was likely perpetuated by A. albopictus. In Africa, chikungunya is spread by a sylvatic cycle in which the virus largely resides in other primates between human outbreaks.
[0058] Upon infection with chikungunya, the host's fibroblasts produce type-1 (alpha and beta) interferon. Mice that lack the interferon alpha receptor die in two to three days upon being exposed to 10.sup.2 chikungunya PFUs, while wild-type mice survive even when exposed to as many as 10.sup.6 PFUs of the virus. At the same time, mice that are partially type-1 deficient (IFN /+/) are mildly affected and experience symptoms such as muscle weakness and lethargy. Partidos et al. (2011) saw similar results with the live attenuated strain CHIKV181/25. However, rather than dying, the type-1 interferon-deficient (IFN //) mice were temporarily disabled and the partially type-1 interferon-deficient mice did not have any problems.
[0059] Several studies have attempted to find the upstream components of the type-1 interferon pathway involved in the host's response to chikungunya infection. So far, no one knows the chikungunya-specific pathogen associated molecular pattern. Nonetheless, IPS-1also known as Cardif, MAVS, and VISAhas been found to be an important factor. In 2011, White et al. found that interfering with IPS-1 decreased the phosphorylation of interferon regulatory factor 3 (IRF3) and the production of IFN-. Other studies have found that IRF3 and IRF7 are important in an age-dependent manner. Adult mice that lack both of these regulatory factors die upon infection with chikungunya. Neonates, on the other hand, succumb to the virus if they are deficient in one of these factors.
[0060] Chikungunya counters the type-I interferon response by producing NS2, a nonstructural protein that degrades RBP1 and turns off the host cell's ability to transcribe DNA. NS2 interferes with the JAK-STAT signaling pathway and prevents STAT from becoming phosphorylated.
[0061] Common laboratory tests for chikungunya include RT-PCR, virus isolation, and serological tests. Virus isolation provides the most definitive diagnosis, but takes one to two weeks for completion and must be carried out in biosafety level III laboratories. The technique involves exposing specific cell lines to samples from whole blood and identifying chikungunya virus-specific responses. RT-PCR using nested primer pairs is used to amplify several chikungunya-specific genes from whole blood. Results can be determined in one to two days.
[0062] Serological diagnosis requires a larger amount of blood than the other methods, and uses an ELISA assay to measure chikungunya-specific IgM levels. Results require two to three days, and false positives can occur with infection via other related viruses, such as o'nyong'nyong virus and Semliki Forest virus.
[0063] The differential diagnosis may include infection with other mosquito-borne viruses, such as dengue, and influenza. Chronic recurrent polyarthralgia occurs in at least 20% of chikungunya patients one year after infection, whereas such symptoms are uncommon in dengue.
[0064] Currently, no specific treatment is available. Attempts to relieve the symptoms include the use of NSAIDs such as naproxen or paracetamol (acetaminophen) and fluids. Aspirin is not recommended. In those who have more than two weeks of arthritis, ribavirin may be useful. The effect of chloroquine is not clear. It does not appear to help acute disease, but tentative evidence indicates it might help those with chronic arthritis. Steroids do not appear useful, either.
[0065] Chikungunya is mostly present in the developing world. The epidemiology of chikungunya is related to mosquitoes, their environments, and human behavior. The adaptation of mosquitoes to the changing climate of North Africa around 5,000 years ago made them seek out environments where humans stored water. Human habitation and the mosquitoes' environments were then very closely connected. During periods of epidemics humans are the reservoir of the virus. During other times, monkey, birds and other vertebrates have served as reservoirs.
[0066] Three genotypes of this virus have been described: West African, East/Central/South African, and Asian genotypes. Explosive epidemics in Indian Ocean in 2005 and Pacific Islands in 2011, as well as now in the Americas, continue to change the distribution of genotypes.
[0067] On 28 May 2009 in Changwat Trang of Thailand, where the virus is endemic, the provincial hospital decided to deliver by Caesarean section a male baby from his chikungunya-infected mother, Khwanruethai Sutmueang, 28, a Trang native, to prevent mother-fetus virus transmission. However, after delivering the baby, the physicians discovered the baby was already infected with the virus, and put him into intensive care because the infection had left the baby unable to breathe by himself or to drink milk. The physicians presumed the virus might be able to be transmitted from a mother to her fetus, but without laboratory confirmation.
[0068] In December 2013, chikungunya was confirmed on the Caribbean island of St. Martin with 66 confirmed cases and suspected cases of around 181. This outbreak is the first time in the Western Hemisphere that the disease has spread to humans from a population of infected mosquitoes. By January 2014, the Public Health Agency of Canada reported that cases were confirmed on the British Virgin Islands, Saint-Barthlemy, Guadeloupe, Dominica, Martinique, and French Guyana. In April 2014, chikungunya was also confirmed in the Dominican Republic by the Centers for Disease Control and Prevention (CDC). By the end of April, it had spread to 14 countries in all, including Jamaica, St. Lucia, St. Kitts and Nevis, and Haiti where an epidemic was declared.
[0069] By the end of May 2014, over ten imported cases of the virus had been reported in the United States by people traveling to Florida from areas where the virus is endemic. The strain of chikungunya spreading to the U.S. from the Caribbean is most easily spread by A. aegypti. Concern exists that this strain of chikungunya could mutate to make the A. albopictus vector more efficient. If this mutation were to occur, chikungunya would be more of a public health concern to the US because the A. albopictus or Asian tiger mosquito is more widespread in the U.S. and is more aggressive than the A. aegypti.
[0070] On June 2014 six cases of the virus were confirmed in Brazil, two in the city of Campinas in the state of Sao Paulo. The six cases are Brazilian army soldiers who had recently returned from Haiti, where they were participating in the reconstruction efforts as members of the United Nations Stabilisation Mission in Haiti. The information was officially released by Campinas municipality, which considers that it has taken the appropriate actions.
[0071] On 16 Jun. 2014, Florida had a cumulative total of 42 cases. As of 11 Sep. 2014, the number of reported cases in Puerto Rico for the year was 1,636. By 28 October, that number had increased to 2,974 confirmed cases with over 10,000 cases suspected. On 17 Jun. 2014, Department of Health officials in the U.S. state of Mississippi confirmed they are investigating the first potential case in a Mississippi resident who recently travelled to Haiti. On 19 Jun. 2014, the virus had spread to Georgia, USA. On 24 Jun. 2014, a case was reported in Poinciana, Polk County, Fla., USA. On 25 Jun. 2014, the Health Department of the U.S. state of Arkansas confirmed that one person from that state is carrying chikungunya. On 26 Jun. 2014, a case was reported in the Mexican state of Jalisco.
[0072] On 17 Jul. 2014, the first chikungunya case acquired in the United States was reported in Florida by the Centers for Disease Control and Prevention. Since 2006, over 200 cases have been reported in the United States, but only in people who had traveled to other countries. This is the first time the virus was passed by mosquitoes to a person on the U.S. mainland. On 2 Sep. 2014, the Centers for Disease Control and Prevention reported that there had been seven confirmed cases of chikungunya in the United States in people who had acquired the disease locally.
[0073] On 25 Sep. 2014, official authorities in E1 Salvador report over 30,000 confirmed cases of this new epidemy. The new epidemic is also on the rise in Jamaica and in Barbados. There is a risk that tourists to those countries may bring the virus to their own countries. November 2014: Brazil has reported a local transmission of a different strain (genotype) of chikungunya that has never been documented in the Americas. This is an African genotype, but oddly fails to explain if it is South African or West African. The new genotype (in the Americas) is more severe than the Asian genotype which is currently spreading through the Americas, and immunity to one genotype does not confer immunity to others. French Polynesia is among other regions experiencing ongoing outbreaks.
[0074] On 7 Nov. 2014 Mexico reported an outbreak of chikungunya, acquired by local transmission, in southern state of Chiapas. The outbreak extends across the coastline from the Guatemala border to the neighbouring state of Oaxaca. Health authorities have reported a cumulative load of 39 laboratory-confirmed cases (by the end of week 48). No suspect cases have been reported. In January 2015, there were 90,481 reported cases of chikungunya in Colombia.
II. MONOCLONAL ANTIBODIES AND PRODUCTION THEREOF
[0075] A. General Methods
[0076] It will be understood that monoclonal antibodies binding to Chikungunya virus will have several applications. These include the production of diagnostic kits for use in detecting and diagnosing Chikungunya virus infection, as well as for treating the same. In these contexts, one may link such antibodies to diagnostic or therapeutic agents, use them as capture agents or competitors in competitive assays, or use them individually without additional agents being attached thereto. The antibodies may be mutated or modified, as discussed further below. Methods for preparing and characterizing antibodies are well known in the art (see, e.g., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988; U.S. Pat. No. 4,196,265).
[0077] The methods for generating monoclonal antibodies (MAbs) generally begin along the same lines as those for preparing polyclonal antibodies. The first step for both these methods is immunization of an appropriate host or identification of subjects who are immune due to prior natural infection. As is well known in the art, a given composition for immunization may vary in its immunogenicity. It is often necessary therefore to boost the host immune system, as may be achieved by coupling a peptide or polypeptide immunogen to a carrier. Exemplary and preferred carriers are keyhole limpet hemocyanin (KLH) and bovine serum albumin (BSA). Other albumins such as ovalbumin, mouse serum albumin or rabbit serum albumin can also be used as carriers. Means for conjugating a polypeptide to a carrier protein are well known in the art and include glutaraldehyde, m-maleimidobencoyl-N-hydroxysuccinimide ester, carbodiimyde and bis-biazotized benzidine. As also is well known in the art, the immunogenicity of a particular immunogen composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants. Exemplary and preferred adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants and aluminum hydroxide adjuvant.
[0078] The amount of immunogen composition used in the production of polyclonal antibodies varies upon the nature of the immunogen as well as the animal used for immunization. A variety of routes can be used to administer the immunogen (subcutaneous, intramuscular, intradermal, intravenous and intraperitoneal). The production of polyclonal antibodies may be monitored by sampling blood of the immunized animal at various points following immunization. A second, booster injection, also may be given. The process of boosting and titering is repeated until a suitable titer is achieved. When a desired level of immunogenicity is obtained, the immunized animal can be bled and the serum isolated and stored, and/or the animal can be used to generate MAbs.
[0079] Following immunization, somatic cells with the potential for producing antibodies, specifically B lymphocytes (B cells), are selected for use in the MAb generating protocol. These cells may be obtained from biopsied spleens or lymph nodes, or from circulating blood. The antibody-producing B lymphocytes from the immunized animal are then fused with cells of an immortal myeloma cell, generally one of the same species as the animal that was immunized or human or human/mouse chimeric cells. Myeloma cell lines suited for use in hybridoma-producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render then incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas). Any one of a number of myeloma cells may be used, as are known to those of skill in the art (Goding, pp. 65-66, 1986; Campbell, pp. 75-83, 1984).
[0080] Methods for generating hybrids of antibody-producing spleen or lymph node cells and myeloma cells usually comprise mixing somatic cells with myeloma cells in a 2:1 proportion, though the proportion may vary from about 20:1 to about 1:1, respectively, in the presence of an agent or agents (chemical or electrical) that promote the fusion of cell membranes. Fusion methods using Sendai virus have been described by Kohler and Milstein (1975; 1976), and those using polyethylene glycol (PEG), such as 37% (v/v) PEG, by Gefter et al. (1977). The use of electrically induced fusion methods also is appropriate (Goding, pp. 71-74, 1986). Fusion procedures usually produce viable hybrids at low frequencies, about 110.sup.6 to 110.sup.8. However, this does not pose a problem, as the viable, fused hybrids are differentiated from the parental, infused cells (particularly the infused myeloma cells that would normally continue to divide indefinitely) by culturing in a selective medium. The selective medium is generally one that contains an agent that blocks the de novo synthesis of nucleotides in the tissue culture media. Exemplary and preferred agents are aminopterin, methotrexate, and azaserine. Aminopterin and methotrexate block de novo synthesis of both purines and pyrimidines, whereas azaserine blocks only purine synthesis. Where aminopterin or methotrexate is used, the media is supplemented with hypoxanthine and thymidine as a source of nucleotides (HAT medium). Where azaserine is used, the media is supplemented with hypoxanthine. Ouabain is added if the B cell source is an Epstein Barr virus (EBV) transformed human B cell line, in order to eliminate EBV transformed lines that have not fused to the myeloma.
[0081] The preferred selection medium is HAT or HAT with ouabain. Only cells capable of operating nucleotide salvage pathways are able to survive in HAT medium. The myeloma cells are defective in key enzymes of the salvage pathway, e.g., hypoxanthine phosphoribosyl transferase (HPRT), and they cannot survive. The B cells can operate this pathway, but they have a limited life span in culture and generally die within about two weeks. Therefore, the only cells that can survive in the selective media are those hybrids formed from myeloma and B cells. When the source of B cells used for fusion is a line of EBV-transformed B cells, as here, ouabain may also be used for drug selection of hybrids as EBV-transformed B cells are susceptible to drug killing, whereas the myeloma partner used is chosen to be ouabain resistant.
[0082] Culturing provides a population of hybridomas from which specific hybridomas are selected. Typically, selection of hybridomas is performed by culturing the cells by single-clone dilution in microtiter plates, followed by testing the individual clonal supernatants (after about two to three weeks) for the desired reactivity. The assay should be sensitive, simple and rapid, such as radioimmunoassays, enzyme immunoassays, cytotoxicity assays, plaque assays dot immunobinding assays, and the like. The selected hybridomas are then serially diluted or single-cell sorted by flow cytometric sorting and cloned into individual antibody-producing cell lines, which clones can then be propagated indefinitely to provide mAbs. The cell lines may be exploited for MAb production in two basic ways. A sample of the hybridoma can be injected (often into the peritoneal cavity) into an animal (e.g., a mouse). Optionally, the animals are primed with a hydrocarbon, especially oils such as pristane (tetramethylpentadecane) prior to injection. When human hybridomas are used in this way, it is optimal to inject immunocompromised mice, such as SCID mice, to prevent tumor rejection. The injected animal develops tumors secreting the specific monoclonal antibody produced by the fused cell hybrid. The body fluids of the animal, such as serum or ascites fluid, can then be tapped to provide MAbs in high concentration. The individual cell lines could also be cultured in vitro, where the MAbs are naturally secreted into the culture medium from which they can be readily obtained in high concentrations. Alternatively, human hybridoma cells lines can be used in vitro to produce immunoglobulins in cell supernatant. The cell lines can be adapted for growth in serum-free medium to optimize the ability to recover human monoclonal immunoglobulins of high purity.
[0083] MAbs produced by either means may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as FPLC or affinity chromatography. Fragments of the monoclonal antibodies of the disclosure can be obtained from the purified monoclonal antibodies by methods which include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, monoclonal antibody fragments encompassed by the present disclosure can be synthesized using an automated peptide synthesizer.
[0084] It also is contemplated that a molecular cloning approach may be used to generate monoclonals. For this, RNA can be isolated from the hybridoma line and the antibody genes obtained by RT-PCR and cloned into an immunoglobulin expression vector. Alternatively, combinatorial immunoglobulin phagemid libraries are prepared from RNA isolated from the cell lines and phagemids expressing appropriate antibodies are selected by panning using viral antigens. The advantages of this approach over conventional hybridoma techniques are that approximately 10.sup.4 times as many antibodies can be produced and screened in a single round, and that new specificities are generated by H and L chain combination which further increases the chance of finding appropriate antibodies.
[0085] Other U.S. patents, each incorporated herein by reference, that teach the production of antibodies useful in the present disclosure include U.S. Pat. No. 5,565,332, which describes the production of chimeric antibodies using a combinatorial approach; U.S. Pat. No. 4,816,567 which describes recombinant immunoglobulin preparations; and U.S. Pat. No. 4,867,973 which describes antibody-therapeutic agent conjugates.
[0086] B. Antibodies of the Present Disclosure
[0087] Antibodies according to the present disclosure may be defined, in the first instance, by their binding specificity, which in this case is for Chikungunya virus glycoprotein (GP). Those of skill in the art, by assessing the binding specificity/affinity of a given antibody using techniques well known to those of skill in the art, can determine whether such antibodies fall within the scope of the instant claims. In one aspect, there are provided monoclonal antibodies having clone-paired CDR's from the heavy and light chains as illustrated in Tables 3 and 4, respectively. Such antibodies may be produced by the clones discussed below in the Examples section using methods described herein.
[0088] In a second aspect, the antibodies may be defined by their variable sequence, which include additional framework regions. These are provided in Tables 1 and 2 that encode or represent full variable regions. Furthermore, the antibodies sequences may vary from these sequences, optionally using methods discussed in greater detail below. For example, nucleic acid sequences may vary from those set out above in that (a) the variable regions may be segregated away from the constant domains of the light and heavy chains, (b) the nucleic acids may vary from those set out above while not affecting the residues encoded thereby, (c) the nucleic acids may vary from those set out above by a given percentage, e.g., 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, (d) the nucleic acids may vary from those set out above by virtue of the ability to hybridize under high stringency conditions, as exemplified by low salt and/or high temperature conditions, such as provided by about 0.02 M to about 0.15 M NaCl at temperatures of about 50 C. to about 70 C., (e) the amino acids may vary from those set out above by a given percentage, e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, or (0 the amino acids may vary from those set out above by permitting conservative substitutions (discussed below). Each of the foregoing applies to the nucleic acid sequences set forth as Table 1 and the amino acid sequences of Table 2.
[0089] C. Engineering of Antibody Sequences
[0090] In various embodiments, one may choose to engineer sequences of the identified antibodies for a variety of reasons, such as improved expression, improved cross-reactivity or diminished off-target binding. The following is a general discussion of relevant techniques for antibody engineering.
[0091] Hybridomas may be cultured, then cells lysed, and total RNA extracted. Random hexamers may be used with RT to generate cDNA copies of RNA, and then PCR performed using a multiplex mixture of PCR primers expected to amplify all human variable gene sequences. PCR product can be cloned into pGEM-T Easy vector, then sequenced by automated DNA sequencing using standard vector primers. Assay of binding and neutralization may be performed using antibodies collected from hybridoma supernatants and purified by FPLC, using Protein G columns.
[0092] Recombinant full length IgG antibodies were generated by subcloning heavy and light chain Fv DNAs from the cloning vector into an IgG plasmid vector, transfected into 293 Freestyle cells or CHO cells, and antibodies were collected an purified from the 293 or CHO cell supernatant.
[0093] The rapid availability of antibody produced in the same host cell and cell culture process as the final cGMP manufacturing process has the potential to reduce the duration of process development programs. Lonza has developed a generic method using pooled transfectants grown in CDACF medium, for the rapid production of small quantities (up to 50 g) of antibodies in CHO cells. Although slightly slower than a true transient system, the advantages include a higher product concentration and use of the same host and process as the production cell line. Example of growth and productivity of GS-CHO pools, expressing a model antibody, in a disposable bioreactor: in a disposable bag bioreactor culture (5 L working volume) operated in fed-batch mode, a harvest antibody concentration of 2 g/L was achieved within 9 weeks of transfection.
[0094] Antibody molecules will comprise fragments (such as F(ab), F(ab).sub.2) that are produced, for example, by the proteolytic cleavage of the mAbs, or single-chain immunoglobulins producible, for example, via recombinant means. Such antibody derivatives are monovalent. In one embodiment, such fragments can be combined with one another, or with other antibody fragments or receptor ligands to form chimeric binding molecules. Significantly, such chimeric molecules may contain substituents capable of binding to different epitopes of the same molecule.
[0095] In related embodiments, the antibody is a derivative of the disclosed antibodies, e.g., an antibody comprising the CDR sequences identical to those in the disclosed antibodies (e.g., a chimeric, or CDR-grafted antibody). Alternatively, one may wish to make modifications, such as introducing conservative changes into an antibody molecule. In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
[0096] It also is understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. U.S. Pat. No. 4,554,101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. As detailed in U.S. Pat. No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: basic amino acids: arginine (+3.0), lysine (+3.0), and histidine (0.5); acidic amino acids: aspartate (+3.01), glutamate (+3.01), asparagine (+0.2), and glutamine (+0.2); hydrophilic, nonionic amino acids: serine (+0.3), asparagine (+0.2), glutamine (+0.2), and threonine (0.4), sulfur containing amino acids: cysteine (1.0) and methionine (1.3); hydrophobic, nonaromatic amino acids: valine (1.5), leucine (1.8), isoleucine (1.8), proline (0.51), alanine (0.5), and glycine (0); hydrophobic, aromatic amino acids: tryptophan (3.4), phenylalanine (2.5), and tyrosine (2.3).
[0097] It is understood that an amino acid can be substituted for another having a similar hydrophilicity and produce a biologically or immunologically modified protein. In such changes, the substitution of amino acids whose hydrophilicity values are within 2 is preferred, those that are within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.
[0098] As outlined above, amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
[0099] The present disclosure also contemplates isotype modification. By modifying the Fc region to have a different isotype, different functionalities can be achieved. For example, changing to IgG.sub.1 can increase antibody dependent cell cytotoxicity, switching to class A can improve tissue distribution, and switching to class M can improve valency.
[0100] Modified antibodies may be made by any technique known to those of skill in the art, including expression through standard molecular biological techniques, or the chemical synthesis of polypeptides. Methods for recombinant expression are addressed elsewhere in this document.
[0101] D. Single Chain Antibodies
[0102] A Single Chain Variable Fragment (scFv) is a fusion of the variable regions of the heavy and light chains of immunoglobulins, linked together with a short (usually serine, glycine) linker. This chimeric molecule retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of a linker peptide. This modification usually leaves the specificity unaltered. These molecules were created historically to facilitate phage display where it is highly convenient to express the antigen binding domain as a single peptide. Alternatively, scFv can be created directly from subcloned heavy and light chains derived from a hybridoma. Single chain variable fragments lack the constant Fc region found in complete antibody molecules, and thus, the common binding sites (e.g., protein A/G) used to purify antibodies. These fragments can often be purified/immobilized using Protein L since Protein L interacts with the variable region of kappa light chains.
[0103] Flexible linkers generally are comprised of helix- and turn-promoting amino acid residues such as alaine, serine and glycine. However, other residues can function as well. Tang et al. (1996) used phage display as a means of rapidly selecting tailored linkers for single-chain antibodies (scFvs) from protein linker libraries. A random linker library was constructed in which the genes for the heavy and light chain variable domains were linked by a segment encoding an 18-amino acid polypeptide of variable composition. The scFv repertoire (approx. 510.sup.6 different members) was displayed on filamentous phage and subjected to affinity selection with hapten. The population of selected variants exhibited significant increases in binding activity but retained considerable sequence diversity. Screening 1054 individual variants subsequently yielded a catalytically active scFv that was produced efficiently in soluble form. Sequence analysis revealed a conserved proline in the linker two residues after the V.sub.H C terminus and an abundance of arginines and prolines at other positions as the only common features of the selected tethers.
[0104] The recombinant antibodies of the present disclosure may also involve sequences or moieties that permit dimerization or multimerization of the receptors. Such sequences include those derived from IgA, which permit formation of multimers in conjunction with the J-chain. Another multimerization domain is the Gal4 dimerization domain. In other embodiments, the chains may be modified with agents such as biotin/avidin, which permit the combination of two antibodies.
[0105] In a separate embodiment, a single-chain antibody can be created by joining receptor light and heavy chains using a non-peptide linker or chemical unit. Generally, the light and heavy chains will be produced in distinct cells, purified, and subsequently linked together in an appropriate fashion (i.e., the N-terminus of the heavy chain being attached to the C-terminus of the light chain via an appropriate chemical bridge).
[0106] Cross-linking reagents are used to form molecular bridges that tie functional groups of two different molecules, e.g., a stabilizing and coagulating agent. However, it is contemplated that dimers or multimers of the same analog or heteromeric complexes comprised of different analogs can be created. To link two different compounds in a step-wise manner, hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.
[0107] An exemplary hetero-bifunctional cross-linker contains two reactive groups: one reacting with primary amine group (e.g., N-hydroxy succinimide) and the other reacting with a thiol group (e.g., pyridyl disulfide, maleimides, halogens, etc.). Through the primary amine reactive group, the cross-linker may react with the lysine residue(s) of one protein (e.g., the selected antibody or fragment) and through the thiol reactive group, the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).
[0108] It is preferred that a cross-linker having reasonable stability in blood will be employed. Numerous types of disulfide-bond containing linkers are known that can be successfully employed to conjugate targeting and therapeutic/preventative agents. Linkers that contain a disulfide bond that is sterically hindered may prove to give greater stability in vivo, preventing release of the targeting peptide prior to reaching the site of action. These linkers are thus one group of linking agents.
[0109] Another cross-linking reagent is SMPT, which is a bifunctional cross-linker containing a disulfide bond that is sterically hindered by an adjacent benzene ring and methyl groups. It is believed that steric hindrance of the disulfide bond serves a function of protecting the bond from attack by thiolate anions such as glutathione which can be present in tissues and blood, and thereby help in preventing decoupling of the conjugate prior to the delivery of the attached agent to the target site.
[0110] The SMPT cross-linking reagent, as with many other known cross-linking reagents, lends the ability to cross-link functional groups such as the SH of cysteine or primary amines (e.g., the epsilon amino group of lysine). Another possible type of cross-linker includes the hetero-bifunctional photoreactive phenylazides containing a cleavable disulfide bond such as sulfosuccinimidyl-2-(p-azido salicylamido) ethyl-1,3-dithiopropionate. The N-hydroxy-succinimidyl group reacts with primary amino groups and the phenylazide (upon photolysis) reacts non-selectively with any amino acid residue.
[0111] In addition to hindered cross-linkers, non-hindered linkers also can be employed in accordance herewith. Other useful cross-linkers, not considered to contain or generate a protected disulfide, include SATA, SPDP and 2-iminothiolane (Wawrzynczak & Thorpe, 1987). The use of such cross-linkers is well understood in the art. Another embodiment involves the use of flexible linkers.
[0112] U.S. Pat. No. 4,680,338, describes bifunctional linkers useful for producing conjugates of ligands with amine-containing polymers and/or proteins, especially for forming antibody conjugates with chelators, drugs, enzymes, detectable labels and the like. U.S. Pat. Nos. 5,141,648 and 5,563,250 disclose cleavable conjugates containing a labile bond that is cleavable under a variety of mild conditions. This linker is particularly useful in that the agent of interest may be bonded directly to the linker, with cleavage resulting in release of the active agent. Particular uses include adding a free amino or free sulfhydryl group to a protein, such as an antibody, or a drug.
[0113] U.S. Pat. No. 5,856,456 provides peptide linkers for use in connecting polypeptide constituents to make fusion proteins, e.g., single chain antibodies. The linker is up to about 50 amino acids in length, contains at least one occurrence of a charged amino acid (preferably arginine or lysine) followed by a proline, and is characterized by greater stability and reduced aggregation. U.S. Pat. No. 5,880,270 discloses aminooxy-containing linkers useful in a variety of immunodiagnostic and separative techniques.
[0114] E. Intrabodies
[0115] In a particular embodiment, the antibody is a recombinant antibody that is suitable for action inside of a cellsuch antibodies are known as intrabodies. These antibodies may interfere with target function by a variety of mechanism, such as by altering intracellular protein trafficking, interfering with enzymatic function, and blocking protein-protein or protein-DNA interactions. In many ways, their structures mimic or parallel those of single chain and single domain antibodies, discussed above. Indeed, single-transcript/single-chain is an important feature that permits intracellular expression in a target cell, and also makes protein transit across cell membranes more feasible. However, additional features are required.
[0116] The two major issues impacting the implementation of intrabody therapeutic are delivery, including cell/tissue targeting, and stability. With respect to delivery, a variety of approaches have been employed, such as tissue-directed delivery, use of cell-type specific promoters, viral-based delivery and use of cell-permeability/membrane translocating peptides. With respect to the stability, the approach is generally to either screen by brute force, including methods that involve phage display and may include sequence maturation or development of consensus sequences, or more directed modifications such as insertion stabilizing sequences (e.g., Fc regions, chaperone protein sequences, leucine zippers) and disulfide replacement/modification.
[0117] An additional feature that intrabodies may require is a signal for intracellular targeting. Vectors that can target intrabodies (or other proteins) to subcellular regions such as the cytoplasm, nucleus, mitochondria and ER have been designed and are commercially available (Invitrogen Corp.; Persic et al., 1997).
[0118] By virtue of their ability to enter cells, intrabodies have additional uses that other types of antibodies may not achieve. In the case of the present antibodies, the ability to interact with the MUC1 cytoplasmic domain in a living cell may interfere with functions associated with the MUC1 CD, such as signaling functions (binding to other molecules) or oligomer formation. In particular, it is contemplated that such antibodies can be used to inhibit MUC1 dimer formation.
[0119] F. Purification
[0120] In certain embodiments, the antibodies of the present disclosure may be purified. The term purified, as used herein, is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally-obtainable state. A purified protein therefore also refers to a protein, free from the environment in which it may naturally occur. Where the term substantially purified is used, this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.
[0121] Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest may be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity). Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing. Other methods for protein purification include, precipitation with ammonium sulfate, PEG, antibodies and the like or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques.
[0122] In purifying an antibody of the present disclosure, it may be desirable to express the polypeptide in a prokaryotic or eukaryotic expression system and extract the protein using denaturing conditions. The polypeptide may be purified from other cellular components using an affinity column, which binds to a tagged portion of the polypeptide. As is generally known in the art, it is believed that the order of conducting the various purification steps may be changed, or that certain steps may be omitted, and still result in a suitable method for the preparation of a substantially purified protein or peptide.
[0123] Commonly, complete antibodies are fractionated utilizing agents (i.e., protein A) that bind the Fc portion of the antibody. Alternatively, antigens may be used to simultaneously purify and select appropriate antibodies. Such methods often utilize the selection agent bound to a support, such as a column, filter or bead. The antibodies is bound to a support, contaminants removed (e.g., washed away), and the antibodies released by applying conditions (salt, heat, etc.).
[0124] Various methods for quantifying the degree of purification of the protein or peptide will be known to those of skill in the art in light of the present disclosure. These include, for example, determining the specific activity of an active fraction, or assessing the amount of polypeptides within a fraction by SDS/PAGE analysis. Another method for assessing the purity of a fraction is to calculate the specific activity of the fraction, to compare it to the specific activity of the initial extract, and to thus calculate the degree of purity. The actual units used to represent the amount of activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the expressed protein or peptide exhibits a detectable activity.
[0125] It is known that the migration of a polypeptide can vary, sometimes significantly, with different conditions of SDS/PAGE (Capaldi et al., 1977). It will therefore be appreciated that under differing electrophoresis conditions, the apparent molecular weights of purified or partially purified expression products may vary.
III. ACTIVE/PASSIVE IMMUNIZATION AND TREATMENT/PREVENTION OF CHIKUNGUNYA INFECTION
[0126] A. Formulation and Administration
[0127] The present disclosure provides pharmaceutical compositions comprising anti-Chikungunya virus antibodies and antigens for generating the same. Such compositions comprise a prophylactically or therapeutically effective amount of an antibody or a fragment thereof, or a peptide immunogen, and a pharmaceutically acceptable carrier. In a specific embodiment, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term carrier refers to a diluent, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a particular carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Other suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
[0128] The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical agents are described in Remington's Pharmaceutical Sciences. Such compositions will contain a prophylactically or therapeutically effective amount of the antibody or fragment thereof, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration, which can be oral, intravenous, intraarterial, intrabuccal, intranasal, nebulized, bronchial inhalation, or delivered by mechanical ventilation.
[0129] Active vaccines are also envisioned where antibodies like those that are disclosed are produced in vivo in a subject at risk of Chikungunya virus infection. Sequences for the E1 and E2 are listed as SEQ ID NOS: 253-276 in the appended sequence listing. Such vaccines can be formulated for parenteral administration, e.g., formulated for injection via the intradermal, intravenous, intramuscular, subcutaneous, or even intraperitoneal routes. Administration by intradermal and intramuscular routes are contemplated. The vaccine could alternatively be administered by a topical route directly to the mucosa, for example by nasal drops, inhalation, or by nebulizer. Pharmaceutically acceptable salts, include the acid salts and those which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
[0130] Passive transfer of antibodies, known as artificially acquired passive immunity, generally will involve the use of intravenous or intramuscular injections. The forms of antibody can be human or animal blood plasma or serum, as pooled human immunoglobulin for intravenous (IVIG) or intramuscular (IG) use, as high-titer human IVIG or IG from immunized or from donors recovering from disease, and as monoclonal antibodies (MAb). Such immunity generally lasts for only a short period of time, and there is also a potential risk for hypersensitivity reactions, and serum sickness, especially from gamma globulin of non-human origin. However, passive immunity provides immediate protection. The antibodies will be formulated in a carrier suitable for injection, i.e., sterile and syringeable.
[0131] Generally, the ingredients of compositions of the disclosure are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0132] The compositions of the disclosure can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
IV. ANTIBODY CONJUGATES
[0133] Antibodies of the present disclosure may be linked to at least one agent to form an antibody conjugate. In order to increase the efficacy of antibody molecules as diagnostic or therapeutic agents, it is conventional to link or covalently bind or complex at least one desired molecule or moiety. Such a molecule or moiety may be, but is not limited to, at least one effector or reporter molecule. Effector molecules comprise molecules having a desired activity, e.g., cytotoxic activity. Non-limiting examples of effector molecules which have been attached to antibodies include toxins, anti-tumor agents, therapeutic enzymes, radionuclides, antiviral agents, chelating agents, cytokines, growth factors, and oligo- or polynucleotides. By contrast, a reporter molecule is defined as any moiety which may be detected using an assay. Non-limiting examples of reporter molecules which have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, photoaffinity molecules, colored particles or ligands, such as biotin.
[0134] Antibody conjugates are generally preferred for use as diagnostic agents. Antibody diagnostics generally fall within two classes, those for use in in vitro diagnostics, such as in a variety of immunoassays, and those for use in vivo diagnostic protocols, generally known as antibody-directed imaging. Many appropriate imaging agents are known in the art, as are methods for their attachment to antibodies (see, for e.g., U.S. Pat. Nos. 5,021,236, 4,938,948, and 4,472,509). The imaging moieties used can be paramagnetic ions, radioactive isotopes, fluorochromes, NMR-detectable substances, and X-ray imaging agents.
[0135] In the case of paramagnetic ions, one might mention by way of example ions such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and/or erbium (III), with gadolinium being particularly preferred. Ions useful in other contexts, such as X-ray imaging, include but are not limited to lanthanum (III), gold (III), lead (II), and especially bismuth (III).
[0136] In the case of radioactive isotopes for therapeutic and/or diagnostic application, one might mention astatine.sup.211, .sup.14carbon, .sup.51chromium, .sup.36chlorine, .sup.57cobalt, .sup.58cobalt, copper.sup.67, .sup.152Eu, gallium.sup.67, .sup.3hydrogen, iodine.sup.123, iodine.sup.125, iodine.sup.131, indium.sup.111, .sup.59iron, .sup.32phosphorus, rhenium.sup.186, rhenium.sup.188, .sup.75selenium, .sup.35sulphur, technicium.sup.99m and/or yttrium.sup.99. .sup.125I is often being preferred for use in certain embodiments, and technicium.sup.99m and/or indium.sup.111 are also often preferred due to their low energy and suitability for long range detection. Radioactively labeled monoclonal antibodies of the present disclosure may be produced according to well-known methods in the art. For instance, monoclonal antibodies can be iodinated by contact with sodium and/or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite, or an enzymatic oxidizing agent, such as lactoperoxidase. Monoclonal antibodies according to the disclosure may be labeled with technetium.sup.99m by ligand exchange process, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the antibody to this column. Alternatively, direct labeling techniques may be used, e.g., by incubating pertechnate, a reducing agent such as SNCl.sub.2, a buffer solution such as sodium-potassium phthalate solution, and the antibody. Intermediary functional groups which are often used to bind radioisotopes which exist as metallic ions to antibody are diethylenetriaminepentaacetic acid (DTPA) or ethylene diaminetetracetic acid (EDTA).
[0137] Among the fluorescent labels contemplated for use as conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5, 6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET, Tetramethylrhodamine, and/or Texas Red.
[0138] Another type of antibody conjugates contemplated in the present disclosure are those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate. Examples of suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose oxidase. Preferred secondary binding ligands are biotin and avidin and streptavidin compounds. The use of such labels is well known to those of skill in the art and are described, for example, in U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149 and 4,366,241.
[0139] Yet another known method of site-specific attachment of molecules to antibodies comprises the reaction of antibodies with hapten-based affinity labels. Essentially, hapten-based affinity labels react with amino acids in the antigen binding site, thereby destroying this site and blocking specific antigen reaction. However, this may not be advantageous since it results in loss of antigen binding by the antibody conjugate.
[0140] Molecules containing azido groups may also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter and Haley, 1983). In particular, 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al., 1985). The 2- and 8-azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al., 1989; King et al., 1989; Dholakia et al., 1989) and may be used as antibody binding agents.
[0141] Several methods are known in the art for the attachment or conjugation of an antibody to its conjugate moiety. Some attachment methods involve the use of a metal chelate complex employing, for example, an organic chelating agent such a diethylenetriaminepentaacetic acid anhydride (DTPA); ethylenetriaminetetraacetic acid; N-chloro-p-toluenesulfonamide; and/or tetrachloro-3-6-diphenylglycouril-3 attached to the antibody (U.S. Pat. Nos. 4,472,509 and 4,938,948). Monoclonal antibodies may also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate. Conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate. In U.S. Pat. No. 4,938,948, imaging of breast tumors is achieved using monoclonal antibodies and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl-3-(4-hydroxyphenyl)propionate.
[0142] In other embodiments, derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin, using reaction conditions that do not alter the antibody combining site are contemplated. Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference). Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region have also been disclosed in the literature (O'Shannessy et al., 1987). This approach has been reported to produce diagnostically and therapeutically promising antibodies which are currently in clinical evaluation.
V. IMMUNODETECTION METHODS
[0143] In still further embodiments, the present disclosure concerns immunodetection methods for binding, purifying, removing, quantifying and otherwise generally detecting Chikungunya virus and its associated antigens. While such methods can be applied in a traditional sense, another use will be in quality control and monitoring of vaccine and other virus stocks, where antibodies according to the present disclosure can be used to assess the amount or integrity (i.e., long term stability) of H1 antigens in viruses. Alternatively, the methods may be used to screen various antibodies for appropriate/desired reactivity profiles.
[0144] Some immunodetection methods include enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few. In particular, a competitive assay for the detection and quantitation of Chikungunya virus antibodies directed to specific parasite epitopes in samples also is provided. The steps of various useful immunodetection methods have been described in the scientific literature, such as, e.g., Doolittle and Ben-Zeev (1999), Gulbis and Galand 0993), De Jager et al. (1993), and Nakamura et al. (1987). In general, the immunobinding methods include obtaining a sample suspected of containing Chikungunya virus, and contacting the sample with a first antibody in accordance with the present disclosure, as the case may be, under conditions effective to allow the formation of immunocomplexes.
[0145] These methods include methods for purifying Chikungunya virus or related antigens from a sample. The antibody will preferably be linked to a solid support, such as in the form of a column matrix, and the sample suspected of containing the Chikungunya virus or antigenic component will be applied to the immobilized antibody. The unwanted components will be washed from the column, leaving the Chikungunya virus antigen immunocomplexed to the immobilized antibody, which is then collected by removing the organism or antigen from the column.
[0146] The immunobinding methods also include methods for detecting and quantifying the amount of Chikungunya virus or related components in a sample and the detection and quantification of any immune complexes formed during the binding process. Here, one would obtain a sample suspected of containing Chikungunya virus or its antigens, and contact the sample with an antibody that binds Chikungunya virus or components thereof, followed by detecting and quantifying the amount of immune complexes formed under the specific conditions. In terms of antigen detection, the biological sample analyzed may be any sample that is suspected of containing Chikungunya virus or Chikungunya virus antigen, such as a tissue section or specimen, a homogenized tissue extract, a biological fluid, including blood and serum, or a secretion, such as feces or urine.
[0147] Contacting the chosen biological sample with the antibody under effective conditions and for a period of time sufficient to allow the formation of immune complexes (primary immune complexes) is generally a matter of simply adding the antibody composition to the sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to Chikungunya virus or antigens present. After this time, the sample-antibody composition, such as a tissue section, ELISA plate, dot blot or Western blot, will generally be washed to remove any non-specifically bound antibody species, allowing only those antibodies specifically bound within the primary immune complexes to be detected.
[0148] In general, the detection of immunocomplex formation is well known in the art and may be achieved through the application of numerous approaches. These methods are generally based upon the detection of a label or marker, such as any of those radioactive, fluorescent, biological and enzymatic tags. Patents concerning the use of such labels include U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149 and 4,366,241. Of course, one may find additional advantages through the use of a secondary binding ligand such as a second antibody and/or a biotin/avidin ligand binding arrangement, as is known in the art.
[0149] The antibody employed in the detection may itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined. Alternatively, the first antibody that becomes bound within the primary immune complexes may be detected by means of a second binding ligand that has binding affinity for the antibody. In these cases, the second binding ligand may be linked to a detectable label. The second binding ligand is itself often an antibody, which may thus be termed a secondary antibody. The primary immune complexes are contacted with the labeled, secondary binding ligand, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes. The secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.
[0150] Further methods include the detection of primary immune complexes by a two-step approach. A second binding ligand, such as an antibody that has binding affinity for the antibody, is used to form secondary immune complexes, as described above. After washing, the secondary immune complexes are contacted with a third binding ligand or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes). The third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system may provide for signal amplification if this is desired.
[0151] One method of immunodetection uses two different antibodies. A first biotinylated antibody is used to detect the target antigen, and a second antibody is then used to detect the biotin attached to the complexed biotin. In that method, the sample to be tested is first incubated in a solution containing the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex. The antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex. The amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution containing the second step antibody against biotin. This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate. With suitable amplification, a conjugate can be produced which is macroscopically visible.
[0152] Another known method of immunodetection takes advantage of the immuno-PCR (Polymerase Chain Reaction) methodology. The PCR method is similar to the Cantor method up to the incubation with biotinylated DNA, however, instead of using multiple rounds of streptavidin and biotinylated DNA incubation, the DNA/biotin/streptavidin/antibody complex is washed out with a low pH or high salt buffer that releases the antibody. The resulting wash solution is then used to carry out a PCR reaction with suitable primers with appropriate controls. At least in theory, the enormous amplification capability and specificity of PCR can be utilized to detect a single antigen molecule.
[0153] A. ELISAs
[0154] Immunoassays, in their most simple and direct sense, are binding assays. Certain preferred immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful. However, it will be readily appreciated that detection is not limited to such techniques, and western blotting, dot blotting, FACS analyses, and the like may also be used.
[0155] In one exemplary ELISA, the antibodies of the disclosure are immobilized onto a selected surface exhibiting protein affinity, such as a well in a polystyrene microtiter plate. Then, a test composition suspected of containing the Chikungunya virus or Chikungunya virus antigen is added to the wells. After binding and washing to remove non-specifically bound immune complexes, the bound antigen may be detected. Detection may be achieved by the addition of another anti-Chikungunya virus antibody that is linked to a detectable label. This type of ELISA is a simple sandwich ELISA. Detection may also be achieved by the addition of a second anti-Chikungunya virus antibody, followed by the addition of a third antibody that has binding affinity for the second antibody, with the third antibody being linked to a detectable label.
[0156] In another exemplary ELISA, the samples suspected of containing the Chikungunya virus or Chikungunya virus antigen are immobilized onto the well surface and then contacted with the anti-Chikungunya virus antibodies of the disclosure. After binding and washing to remove non-specifically bound immune complexes, the bound anti-Chikungunya virus antibodies are detected. Where the initial anti-Chikungunya virus antibodies are linked to a detectable label, the immune complexes may be detected directly. Again, the immune complexes may be detected using a second antibody that has binding affinity for the first anti-Chikungunya virus antibody, with the second antibody being linked to a detectable label.
[0157] Irrespective of the format employed, ELISAs have certain features in common, such as coating, incubating and binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.
[0158] In coating a plate with either antigen or antibody, one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate will then be washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then coated with a nonspecific protein that is antigenically neutral with regard to the test antisera. These include bovine serum albumin (BSA), casein or solutions of milk powder. The coating allows for blocking of nonspecific adsorption sites on the immobilizing surface and thus reduces the background caused by nonspecific binding of antisera onto the surface.
[0159] In ELISAs, it is probably more customary to use a secondary or tertiary detection means rather than a direct procedure. Thus, after binding of a protein or antibody to the well, coating with a non-reactive material to reduce background, and washing to remove unbound material, the immobilizing surface is contacted with the biological sample to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, and a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or a third binding ligand.
[0160] Under conditions effective to allow immune complex (antigen/antibody) formation means that the conditions preferably include diluting the antigens and/or antibodies with solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline (PBS)/Tween. These added agents also tend to assist in the reduction of nonspecific background.
[0161] The suitable conditions also mean that the incubation is at a temperature or for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours or so, at temperatures preferably on the order of 25 C. to 27 C., or may be overnight at about 4 C. or so.
[0162] Following all incubation steps in an ELISA, the contacted surface is washed so as to remove non-complexed material. A preferred washing procedure includes washing with a solution such as PBS/Tween, or borate buffer. Following the formation of specific immune complexes between the test sample and the originally bound material, and subsequent washing, the occurrence of even minute amounts of immune complexes may be determined.
[0163] To provide a detecting means, the second or third antibody will have an associated label to allow detection. Preferably, this will be an enzyme that will generate color development upon incubating with an appropriate chromogenic substrate. Thus, for example, one will desire to contact or incubate the first and second immune complex with a urease, glucose oxidase, alkaline phosphatase or hydrogen peroxidase-conjugated antibody for a period of time and under conditions that favor the development of further immune complex formation (e.g., incubation for 2 hours at room temperature in a PBS-containing solution such as PBS-Tween).
[0164] After incubation with the labeled antibody, and subsequent to washing to remove unbound material, the amount of label is quantified, e.g., by incubation with a chromogenic substrate such as urea, or bromocresol purple, or 2,2-azino-di-(3-ethyl-benzthiazoline-6-sulfonic acid (ABTS), or H.sub.2O.sub.2, in the case of peroxidase as the enzyme label. Quantification is then achieved by measuring the degree of color generated, e.g., using a visible spectra spectrophotometer.
[0165] In another embodiment, the present disclosure contemplates the use of competitive formats. This is particularly useful in the detection of Chikungunya virus antibodies in sample. In competition based assays, an unknown amount of analyte or antibody is determined by its ability to displace a known amount of labeled antibody or analyte. Thus, the quantifiable loss of a signal is an indication of the amount of unknown antibody or analyte in a sample.
[0166] Here, the inventors propose the use of labeled Chikungunya virus monoclonal antibodies to determine the amount of Chikungunya virus antibodies in a sample. The basic format would include contacting a known amount of Chikungunya virus monoclonal antibody (linked to a detectable label) with Chikungunya virus antigen or particle. The Chikungunya virus antigen or organism is preferably attached to a support. After binding of the labeled monoclonal antibody to the support, the sample is added and incubated under conditions permitting any unlabeled antibody in the sample to compete with, and hence displace, the labeled monoclonal antibody. By measuring either the lost label or the label remaining (and subtracting that from the original amount of bound label), one can determine how much non-labeled antibody is bound to the support, and thus how much antibody was present in the sample.
[0167] B. Western Blot
[0168] The Western blot (alternatively, protein immunoblot) is an analytical technique used to detect specific proteins in a given sample of tissue homogenate or extract. It uses gel electrophoresis to separate native or denatured proteins by the length of the polypeptide (denaturing conditions) or by the 3-D structure of the protein (native/non-denaturing conditions). The proteins are then transferred to a membrane (typically nitrocellulose or PVDF), where they are probed (detected) using antibodies specific to the target protein.
[0169] Samples may be taken from whole tissue or from cell culture. In most cases, solid tissues are first broken down mechanically using a blender (for larger sample volumes), using a homogenizer (smaller volumes), or by sonication. Cells may also be broken open by one of the above mechanical methods. However, it should be noted that bacteria, virus or environmental samples can be the source of protein and thus Western blotting is not restricted to cellular studies only. Assorted detergents, salts, and buffers may be employed to encourage lysis of cells and to solubilize proteins. Protease and phosphatase inhibitors are often added to prevent the digestion of the sample by its own enzymes. Tissue preparation is often done at cold temperatures to avoid protein denaturing.
[0170] The proteins of the sample are separated using gel electrophoresis. Separation of proteins may be by isoelectric point (pI), molecular weight, electric charge, or a combination of these factors. The nature of the separation depends on the treatment of the sample and the nature of the gel. This is a very useful way to determine a protein. It is also possible to use a two-dimensional (2-D) gel which spreads the proteins from a single sample out in two dimensions. Proteins are separated according to isoelectric point (pH at which they have neutral net charge) in the first dimension, and according to their molecular weight in the second dimension.
[0171] In order to make the proteins accessible to antibody detection, they are moved from within the gel onto a membrane made of nitrocellulose or polyvinylidene difluoride (PVDF). The membrane is placed on top of the gel, and a stack of filter papers placed on top of that. The entire stack is placed in a buffer solution which moves up the paper by capillary action, bringing the proteins with it. Another method for transferring the proteins is called electroblotting and uses an electric current to pull proteins from the gel into the PVDF or nitrocellulose membrane. The proteins move from within the gel onto the membrane while maintaining the organization they had within the gel. As a result of this blotting process, the proteins are exposed on a thin surface layer for detection (see below). Both varieties of membrane are chosen for their non-specific protein binding properties (i.e., binds all proteins equally well). Protein binding is based upon hydrophobic interactions, as well as charged interactions between the membrane and protein. Nitrocellulose membranes are cheaper than PVDF, but are far more fragile and do not stand up well to repeated probings. The uniformity and overall effectiveness of transfer of protein from the gel to the membrane can be checked by staining the membrane with Coomassie Brilliant Blue or Ponceau S dyes. Once transferred, proteins are detected using labeled primary antibodies, or unlabeled primary antibodies followed by indirect detection using labeled protein A or secondary labeled antibodies binding to the Fc region of the primary antibodies.
[0172] C. Immunohistochemistry
[0173] The antibodies of the present disclosure may also be used in conjunction with both fresh-frozen and/or formalin-fixed, paraffin-embedded tissue blocks prepared for study by immunohistochemistry (IHC). The method of preparing tissue blocks from these particulate specimens has been successfully used in previous IHC studies of various prognostic factors, and is well known to those of skill in the art (Brown et al., 1990; Abbondanzo et al., 1990; Allred et al., 1990).
[0174] Briefly, frozen-sections may be prepared by rehydrating 50 ng of frozen pulverized tissue at room temperature in phosphate buffered saline (PBS) in small plastic capsules; pelleting the particles by centrifugation; resuspending them in a viscous embedding medium (OCT); inverting the capsule and/or pelleting again by centrifugation; snap-freezing in 70 C. isopentane; cutting the plastic capsule and/or removing the frozen cylinder of tissue; securing the tissue cylinder on a cryostat microtome chuck; and/or cutting 25-50 serial sections from the capsule. Alternatively, whole frozen tissue samples may be used for serial section cuttings.
[0175] Permanent-sections may be prepared by a similar method involving rehydration of the 50 mg sample in a plastic microfuge tube; pelleting; resuspending in 10% formalin for 4 hours fixation; washing/pelleting; resuspending in warm 2.5% agar; pelleting; cooling in ice water to harden the agar; removing the tissue/agar block from the tube; infiltrating and/or embedding the block in paraffin; and/or cutting up to 50 serial permanent sections. Again, whole tissue samples may be substituted.
[0176] D. Immunodetection Kits
[0177] In still further embodiments, the present disclosure concerns immunodetection kits for use with the immunodetection methods described above. As the antibodies may be used to detect Chikungunya virus or Chikungunya virus antigens, the antibodies may be included in the kit. The immunodetection kits will thus comprise, in suitable container means, a first antibody that binds to Chikungunya virus or Chikungunya virus antigen, and optionally an immunodetection reagent.
[0178] In certain embodiments, the Chikungunya virus antibody may be pre-bound to a solid support, such as a column matrix and/or well of a microtitre plate. The immunodetection reagents of the kit may take any one of a variety of forms, including those detectable labels that are associated with or linked to the given antibody. Detectable labels that are associated with or attached to a secondary binding ligand are also contemplated. Exemplary secondary ligands are those secondary antibodies that have binding affinity for the first antibody.
[0179] Further suitable immunodetection reagents for use in the present kits include the two-component reagent that comprises a secondary antibody that has binding affinity for the first antibody, along with a third antibody that has binding affinity for the second antibody, the third antibody being linked to a detectable label. As noted above, a number of exemplary labels are known in the art and all such labels may be employed in connection with the present disclosure.
[0180] The kits may further comprise a suitably aliquoted composition of the Chikungunya virus or Chikungunya virus antigens, whether labeled or unlabeled, as may be used to prepare a standard curve for a detection assay. The kits may contain antibody-label conjugates either in fully conjugated form, in the form of intermediates, or as separate moieties to be conjugated by the user of the kit. The components of the kits may be packaged either in aqueous media or in lyophilized form.
[0181] The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which the antibody may be placed, or preferably, suitably aliquoted. The kits of the present disclosure will also typically include a means for containing the antibody, antigen, and any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
VI. EXAMPLES
[0182] The following examples are included to demonstrate preferred embodiments. It should be appreciated by those of skill in the art that the techniques disclosed in the examples that follow represent techniques discovered by the inventors to function well in the practice of embodiments, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.
Example 1Materials and Methods
[0183] Isolation of Human mAbs.
[0184] PBMCs were obtained from a human 5 years after documented symptomatic CHKV infection in Sri Lanka. B cells were transformed in 384-well plates with EBV in the presence of CpG. The supernatants from the resulting B cell lymphoblastic cells lines were screened for the presence of human CHKV-specific binding antibodies by ELISA using live CHIKV vaccine strain 181/25 virus as antigen. Transformed B cells were collected and fused to a myeloma cell line, distributed into culture plates and expansion, and selected by growth in hypoxanthine-aminopterin-thymidine medium containing ouabain. Hybridomas were cloned by single-cell sorting. Supernatants from cloned hybridomas growing in serum-free medium were collected, purified and concentrated from clarified medium by protein G chromatography.
[0185] Neutralization Assays.
[0186] Purified IgG mAb proteins were tested for neutralizing activity using CHKV virus replicon particles (VRPs) or each of 4 live chikungunya viruses representing diverse genetic and geographic profile. A CHIKV VRP that encoded GFP was generated by development of a three-plasmid CHIKV replicon helper system based on a plasmid containing the full-length cDNA of the CHIKV strain SL15649 (GenBank: GU189061.1) genome sequence, using PCR-based cloning methodologies. VRP were incubated with mAb in dilutions then inoculated onto Vero 81 cell monolayers for 18 hrs; infected cells and total cells (identified with a nuclear marker) were identified with a fluorescence imaging system. To determine mAb breadth and neutralization potency, the inventors used four representative live virus strains with at least one representative from each CHIKV genotype, including one prototype virus from each of the three genotypes and also a strain from the current Caribbean outbreak. Neutralizing activity was determined in a focus reduction neutralization test. Serial dilutions of purified human mAbs were incubated with 100 focus-forming units of CHIKV at 37 C. for 1 hour. MAb-virus complexes were added to Vero cells in 96-well plates, and then plaques were detected after cell fixation using immunoperoxidase detection and quantified using an ImmunoSpot 5.0.37 macroanalyzer (Cellular Technologies Ltd). EC.sub.50 values were calculated using nonlinear regression analysis after comparison to wells inoculated with CHIKV in the absence of antibody.
[0187] E2 ELISA.
[0188] Recombinant CHIKV E2 ectodomain protein (corresponding to the CHIKV-LR2006 strain) was generated in E. coli and adsorbed to microtiter plates. Human mAbs were applied, then bound CHKV-specific mAbs were detected with biotin-conjugated goat anti-human IgG.
[0189] Competition Binding Assay.
[0190] The inventors identified groups of antibodies binding to the same major antigenic site by competing pairs of antibodies for binding to CHIKV-LR2006 E2 ectodomain protein containing a polyhistidine-tag attached to an Anti-Penta-His biosensor tip (ForteBio #18-5077) in an Octet Red biosensor (ForteBio).
[0191] Alanine Scanning Mutagenesis for Epitope Mapping.
[0192] A CHIKV envelope protein expression construct (strain S27, Uniprot Reference #Q8JUX5) with a C-terminal V5 tag was subjected to alanine-scanning mutagenesis to generate a comprehensive mutation library. Primers were designed to mutate each residue within the E2, 6K, and E1 regions of the envelope proteins (residues Y326 to H1248 in the structural polyprotein) to alanine; alanine codons were mutated to serine. In total, 910 CHIKV envelope protein mutants were generated. Loss of binding of mAbs to each construct was tested using an immunofluorescence binding assay, using cellular fluorescence detected with a high-throughput flow cytometer.
[0193] Mechanism of Neutralization.
[0194] MAbs were interacted with VRPs before or after attachment to Vero 81 cells, and then cells were stained, imaged, and analyzed as described for VRP neutralization assays to determine at what stage mAbs exerted the antiviral effect. Fusion from within and fusion from without assays were performed as detailed in Supplemental Experimental Procedures.
[0195] In Vivo Protection Studies in Mice.
[0196] Ifnar.sup./ mice were bred in pathogen-free animal facilities and infection experiments were performed in A-BSL3 facilities. Footpad injections were performed under anesthesia. For prophylaxis studies, human mAbs were administered by intraperitoneal injection to 6 week-old Ifnar.sup./ mice 1 day prior to subcutaneous inoculation in the footpad with 10 FFU of CHIKV-LR. For therapeutic studies, 10 FFU of CHIKV-LR was delivered 24, 48, or 60 hours prior to administration of a single dose of individual or combinations of human mAbs at specified doses.
[0197] Human Subject and Peripheral Blood Cell Isolation.
[0198] An otherwise healthy adult subject presented in October of 2006 with CHIKV infection. The symptoms of CHIKV infection coincided with return from a one-year visit to Sri Lanka, during which the patient spent time in urban areas (primarily Colombo), and rural settings, including rainforests and coastal areas. The patient experienced multiple insect bites over the course of the visit, but remained in good health throughout the stay. On return to the U.S., the subject presented to the primary care physician with a fever (102 F.) of three days duration. The patient reported the concurrent development of bilateral joint pain in elbows and fingers, and a raised, non-pruritic rash on the back and abdomen, accompanied by general body ache and headache. On presentation, he appeared to be well, and in no acute distress. A mild, blanching, papular rash extended across the back, chest and abdomen (see
[0199] Blood was drawn for a CBC, serologies and malaria smears, and the patient was discharged. The white blood cell count was 4.010.sup.4 cells/mm.sup.3, the hematocrit was 41% and platelet count was 180,000/mm.sup.3. The total lymphocyte count was 1.010.sup.4 cells/mm.sup.3. Malaria smears and serologies were negative, and the patient was diagnosed tentatively as having a viral illness of unknown etiology.
[0200] The patient returned to the clinic two weeks later, afebrile, but with persistent arthralgia, most prominent in the fingers. The patient described the pain and stiffness as no better, and perhaps worse, than during his previous visit. The patient reported that an outbreak of chikungunya was occurring in the area of previous travel. Blood was drawn and serum separated and sent to CDC for PCR and serological testing, which confirmed the diagnosis of chikungunya infection.
[0201] In April 2012, five and a half years after the index infection, peripheral blood mononuclear cells (PBMCs) were isolated by density gradient separation on Ficoll without known exposure to CHIKV or other arthritogenic alphaviruses in the intervening period while living in the United States. The cells were cryopreserved and stored in liquid nitrogen until study. The protocol for recruiting and collecting blood samples from subjects was approved by the Institutional Review Boards of the University of North Carolina at Chapel Hill and the Vanderbilt University Medical Center.
[0202] Generation of Human Hybridomas.
[0203] Cryopreserved PBMC samples were thawed rapidly at 37 C. and washed prior to transformation with Epstein-Barr virus, as described (Smith et al., 2012). Cultures were incubated at 37 C. with 5% CO.sub.2 for 10 days and screened for the presence of cells secreting CHIKV-specific antibodies in the supernatant using VRP neutralizing assays and an ELISA. The inventors performed two independent transformations using separate aliquots of the same blood sample.
[0204] In the first transformation, the inventors established 3,840 cultures (10384-well plates) containing an average of 42 transformed B cell colonies per culture, for an estimated total of about 161,000 individual B cell colonies. To screen for antibodies that display neutralizing activity against CHIKV under BSL2 conditions, the inventors developed a high-throughput fluorescence reduction neutralization assay using CHIKV replicon particles (VRPs) that express green fluorescent protein as a reporter. VRPs are virions that display the native viral glycoproteins but lack the full-length viral genome and thus are incapable of generating infectious progeny (Vander Veen et al., 2012). The inventors used VRPs derived from strain SL15649 (Morrison et al., 2011), which was isolated from Sri Lanka in 2006. SL15649 is contemporaneous to the strain that infected the donor and is likely very similar in sequence. From this experiment, the inventors identified 160 B cell cultures with supernatants that mediated neutralization at 90% inhibition, suggesting a frequency of 0.099% virus-specific B cells per total B cells (1 in 1,000). A total of 60 of these lines inhibited at a level of >98%, and in the secondary screen, supernatants from 58 of the 60 lines contained antibodies that bound in ELISA to cell-culture-produced CHIKV (strain 181/25) captured on an immunoassay plate. The inventors selected 35 of the 58 lines with the highest neutralizing and binding activity for hybridoma fusion, identified 22 hybridomas with virus-binding supernatants after fusion and plating, and successfully isolated 14 clones for further study. In the second transformation, the inventors established 1,536 cultures (4384-well plates) containing an average of 38 transformed B cell colonies per culture, for an estimated total of about 58,000 individual B cell colonies tested, suggesting a virus-specific B cell frequency of 0.1% (again, 1 in 1,000). In this experiment, they used a primary screen of ELISA binding to CHIKV strain 181/25 without a prior neutralizing test. The inventors identified 60 lines with ELISA optical density signal greater than four times the background level, selected the 30 B cell lines with the highest optical density signal in ELISA for fusion, identified 18 hybridomas with virus-binding supernatants after fusion and plating, and successfully isolated 16 clones for further study.
[0205] Fusion with Myeloma Cells.
[0206] Cells from wells with supernatants capable of neutralizing CHIKV infectivity were fused with HMMA2.5 non-secreting myeloma cells as described (Smith et al., 2012). Resultant hybridomas were selected by growth in hypoxanthine-aminopterin-thymidine (HAT) medium containing ouabain, biologically cloned by single-cell FACS using a FACSAria III cell sorter (BD Biosciences), and expanded.
[0207] Human mAb Production and Purification.
[0208] Wells containing hybridomas producing CHIKV-specific antibodies were cloned by three rounds of limiting dilution or with a ClonePix device (Molecular Devices) according to the manufacturer's instructions. Once individual clones were obtained, each hybridoma was expanded until 50% confluent in 75 cm.sup.2 flasks. For antibody expression, cells were collected with a cell scraper, washed in serum-free medium (GIBCO Hybridoma-SFM from Invitrogen, 12045084), and divided equally into four 225 cm.sup.2 flasks (Corning, 431082) containing 250 mL serum-free medium. Cells were incubated for 21 days before medium was clarified by centrifugation and passed through a 0.2 m sterile filter. Antibodies were purified from clarified medium by protein G chromatography (GE Life Sciences, Protein G HP Columns).
[0209] Cells.
[0210] BHK-21 cells (ATCC CCL-10) were maintained in alpha minimal essential medium (MEM; Gibco) supplemented to contain 10% fetal bovine serum (FBS) and 10% tryptose phosphate (Sigma). Vero 81 cells (ATCC CCL-81) were maintained in MEM supplemented to contain 5% FBS. Medium for all cells was supplemented to contain 0.29 mg/mL L-glutamine (Gibco), 100 U/mL penicillin (Gibco), 100 g/mL streptomycin (Gibco), and 500 ng/mL amphotericin B. Cells were maintained at 37 C. in a humidified atmosphere of 5% CO.sub.2.
[0211] Generation of CHIKV VRP Plasmid Constructs.
[0212] A three-plasmid CHIKV replicon helper system was derived from a plasmid containing the full-length cDNA of the CHIKV strain SL15649 (GenBank: GU189061.1) genome sequence using PCR-based cloning methodologies. A CHIKV replicon genome was constructed using a two-step process that involved the generation of an intermediate cloning vector with the CHIKV full-length structural cassette substituted with a multiple cloning site (MCS). Enhanced green fluorescent protein (eGFP) was subcloned into the multiple cloning site of this plasmid to generate pMH41 (CHIKV SL15649 eGFP replicon). The construction of a two-plasmid helper system included a multi-step cloning process that first involved the generation of a full-length structural gene helper plasmid via removal of the majority (6,891 nt) of the CHIKV non-structural cassette. The full-length structural cassette was further subdivided into two constructs, pMH38 (CHIKV SL15649 capsid helper), which is comprised of the capsid gene sequence followed by a unique AvrII restriction site, and pMH39 (CHIKV SL15649 glycoprotein helper), which contains an in-frame deletion of the capsid RNA-binding domain followed by the intact envelope glycoprotein (E3-E1) coding sequence.
[0213] Recombinant CHIKV p62-E1 Production.
[0214] A plasmid containing CHIKV p62 (i.e., E3 [aa S1-R64]-E2 [aa S1-E361]-16 amino acid linker-E1 [aa Y1-Q411] followed by a His tag) (Voss et al., 2010) was transfected into 293F cells using 293fectin reagent (Invitrogen). After 72 hours incubation, the supernatant was removed, and the cells were cultured for an additional 72 hours. The pooled supernatants were loaded onto a nickel agarose bead column (GoldBio) and eluted with imidazole. The protein was further purified using a Superdex 5200 gel filtration column (GE Life Sciences). Fractions containing the CHIKV p62-E1 protein were pooled, frozen, and stored at 80 C.
[0215] Generation of CHIKV Strain SL15649-Derived VRP Stocks.
[0216] VRP stocks were recovered from recombinant CHIKV plasmids in a certified biological safety level 3 (BSL3) facility in biological safety cabinets in accordance with protocols approved by the Vanderbilt University Department of Environment, Health, and Safety and the Vanderbilt Institutional Biosafety Committee. The three SL15649 replicon system plasmids were linearized by digestion with NotI-HF, purified by phenol-chloroform extraction, and used as templates in transcription reactions using an mMessage mMachine SP6 transcription kit (Life Technologies) to produce capped, full-length RNA transcripts in vitro. Viral RNA transcripts were introduced into BHK21 cells by electroporation using a GenePulser electroporator. Culture supernatants containing VRPs were collected 24 hours after electroporation; supernatants were clarified by centrifugation at 855g for 20 min, aliquoted, and stored at 80 C. VRP stocks were evaluated for propagation-competent recombinant virus by serial passage of 20% of the stock and 10% of passage 1 culture supernatant using Vero 81 cells, which were examined for cytopathic effect (CPE) 72 hours after infection. Stocks were considered to have passed this safety test when CPE was not detected in the final passage. Stocks were then removed from the BSL3 laboratory.
[0217] VRP Neutralization and GFP Reporter Assay.
[0218] Vero 81 cells (2.2510.sup.3 cells/well) were seeded into wells of 384-well plates and incubated at 37 C. for 24 hours. Neat hybridoma supernatant or serial dilutions of purified mAbs were incubated with VRPs at an MOI of 5 infectious units/cell in virus dilution buffer (VDB; RPMI medium containing 20 mM HEPES supplemented to contain 1% FBS) at 37 C. for 1 hour and then adsorbed to cells. Cells were incubated at 37 C. for 18 hours, stained with Hoechst stain to label nuclei, and imaged using an ImageXpress Micro XL imaging system (Molecular Devices) at the Vanderbilt High-Throughput Screening Facility. Total and CHIKV-infected cells (marked by GFP expression) were quantified using MetaXpress software (Molecular Devices) in two fields of view per well. For each antibody, EC.sub.50 values with 95% confidence intervals were determined using nonlinear regression to fit separate logistic growth curves using the R statistics program (R.C. Team, 2014).
[0219] Virus Stocks Prepared as Antigen for ELISA.
[0220] The infectious clone plasmid for CHIKV vaccine strain 181/25 (Levitt et al., 1986 and Mainou et al., 2013) was linearized with NotI-HF and transcribed in vitro using an mMessage mMachine SP6 transcription kit (Life Technologies). Viral RNA was introduced into BHK21 cells by electroporation. Culture supernatants were harvested 24 hours later, clarified by centrifugation at 855g for 20 min, aliquoted, and stored at 80 C.
[0221] Virus Capture ELISA for Hybridoma Screening.
[0222] Antibody binding to virus particles was performed by coating assay plates with purified mouse mAb CHK-187 (Pal et al., 2013), prepared at 1 g/mL in 0.1 M Na.sub.2CO.sub.3 and 0.1 M NaHCO.sub.3 pH 9.3 binding buffer, was used to coat ELISA plates (Nunc 242757) and incubated at 4 C. overnight. After incubating plates for 1 hour with blocking buffer (1% powdered milk and 2% goat serum in PBS with Tween 20 [PBS-T]), plates were washed five times with PBS-T and incubated with 25 L of culture supernatant from BHK21 cell monolayers infected with CHIKV vaccine strain 181/25. After incubation at room temperature for 1 hour, plates were washed ten times with PBS, and 10 L of B cell culture supernatant was added into 25 L/well of blocking buffer. Plates were incubated at room temperature for 1 hour prior to washing five times with PBS-T. A secondary antibody conjugated to alkaline phosphatase (goat anti-human Fc; Meridian Life Science, W99008A) was applied at a 1:5,000 dilution in 25 L/well of blocking buffer, and plates were incubated at room temperature for 1 hour. Following five washes with PBS-T, phosphatase substrate solution (1 mg/mL phosphatase substrate in 1 M Tris aminomethane [Sigma, S0942]) was added at 25 L/well, and plates were incubated at room temperature for 2 hours before determining the optical density at 405 nm using a Biotek plate reader.
[0223] CHIKV-Specific Control Human mAbs.
[0224] In some assays, two previously described human CHIKV-specific mAbs, 5F10 and 8B10 (Wailer et al., 2011), were used as positive controls. These mAbs were expressed in 293F cells (Invitrogen) following transfection with an IgG1 expression plasmid (Lonza) containing a sequence-optimized cDNA of the 5F10 and 8B10 antibody variable gene regions based on sequences provided by Cheng-I Wang and Alessandra Nardin (Singapore Immunology Network, A*STAR, Singapore).
[0225] ELISA for mAb Binding to E2 Protein.
[0226] Recombinant CHIKV E2 ectodomain protein (corresponding to the CHIKV-LR2006 strain) was generated in E. coli as described (Pal et al., 2013) and adsorbed to microtiter plates (100 L of a 2 g/mL E2 protein solution in 0.1 M Na.sub.2CO.sub.3, 0.1 M NaHCO.sub.3, and 0.1% NaN.sub.3 [pH 9.3]) at 4 C. overnight. Plates were rinsed three times with PBS containing 0.05% Tween-20, and incubated at 37 C. for 1 hour with blocking buffer (PBS, 0.05% Tween-20, and 2% [w/v] of BSA). Primary human mAb (diluted to 10 g/mL in blocking buffer) was added to wells at room temperature for 1 hour. Plates were rinsed three times with PBS containing 0.05% Tween-20, and secondary antibody (biotin-conjugated goat anti-human IgG (H and L chains) with minimal cross-reactivity to mouse serum proteins (Jackson ImmunoResearch Laboratories) diluted 1/20,000 in blocking buffer) and streptavidin-conjugated horseradish peroxidase (diluted in PBS with 0.05% Tween-20; Vector Laboratories) were added sequentially, each at room temperature for 1 hour with plate rinsing in between steps. After four rinses with PBS, plates were incubated at room temperature with 100 L of TMB (3,3,5,5-tetramethylbenzidine) chromogenic substrate solution (Dako) for 5 min, and the reaction was stopped by addition of 2 N H2504. Product intensity was determined using an ELISA plate reader at an optical density of 450 nm.
[0227] Affinity Measurements by Surface Plasmon Resonance.
[0228] Interactions of purified human mAbs and CHIKV proteins were analyzed kinetically using a Biacore T100 instrument as described (Austin et al., 2012). For the intact IgG with soluble CHIKV p62-E1, anti-human IgG antibodies (GE Life Sciences) were immobilized onto a Series S CMS chip and used to capture anti-CHIKV or control (hu-WNV E16) antibodies. The CHIKV p62-E1 was injected over the surface at 65 pt/min for 180 sec and allowed to dissociate for 1000 sec before regeneration with 3 M MgCl.sub.2 between cycles. Some antibodies did not bind to the monomeric E1 protein, therefore the inventors tested them for binding to VLPs. For the kinetic measurements with the CHIKV VLP, anti-mouse IgG antibodies (GE Life Sciences) were immobilized to capture a set of mouse anti-CHIKV antibodies with sub-nanomolar affinities, which were in turn used to capture the CHIKV VLPs. Anti-CHIKV IgG or Fab was injected over the chip surface at 65 L/min for 180 sec and allowed to dissociate for 1000 sec before regeneration with 10 mM glycine pH 1.7 between cycles. All data were processed using the Biacore Evaluation Software (Version 1.1.1) and a global 1:1 Langmuir fit of the curves. Results were obtained from at least three independent experiments.
[0229] Virus Strains Used in Focus Reduction Neutralization Tests.
[0230] To determine mAb breadth and neutralization potency, the inventors used four representative strains with at least one representative from each CHIKV genotype, including one prototype virus from each of the three genotypes and also a strain from the current Caribbean outbreak. Strain LR2006 _OPY1 (LR) (CHIKV East/Central/South African [ECSA] genotype) was provided by Stephen Higgs (Manhattan, Kans.). Strain NI 64 IbH 35 (West African genotype) and strains RSU1 and 99659 (Asian genotype; isolated in 2014 from a subject in the British Virgin Islands (Lanciotti & Valadere, 2014)) were provided by Robert Tesh (World Reference Center for Emerging Viruses and Arboviruses, Galveston, Tex.).
[0231] Focus Reduction Neutralization Test (FRNT) with Infectious CHIKV.
[0232] Serial dilutions of purified human mAbs were incubated with 100 focus-forming units (FFU) of CHIKV at 37 C. for 1 hour. MAb-virus complexes were added to Vero cells in 96-well plates. After 90 min incubation, cells were overlaid with 1% (w/v) methylcellulose in Modified Eagle Media (MEM) supplemented to contain 2% FBS. Cells were incubated for 18 hours and fixed with 1% paraformaldehyde in PBS. Cells were incubated sequentially with 500 ng/mL of murine CHK-11 (Pal et al., 2013) and horseradish peroxidase (HRP)-conjugated goat anti-mouse IgG in PBS supplemented to contain 0.1% saponin and 0.1% bovine serum albumin (BSA). CHIKV-infected foci were visualized using TrueBlue peroxidase substrate (KPL) and quantified using an ImmunoSpot 5.0.37 macroanalyzer (Cellular Technologies Ltd). EC.sub.50 values were calculated using nonlinear regression analysis after comparison to wells inoculated with CHIKV in the absence of antibody.
[0233] Biolayer Interferometry Competition Binding Assay.
[0234] CHIKV-LR2006 E2 ectodomain protein containing a polyhistidine-tag (20 g/mL) was immobilized onto Anti-Penta-His biosensor tips (ForteBio #18-5077) for 2 min. After determining the baseline signal in kinetics buffer (KB, 1PBS, 0.01% BSA and 0.002% Tween 20) for 1 min, biosensor tips were immersed into wells containing primary antibody at a concentration of 100 g/mL for 5 min and then immersed into wells containing competing mAbs at a concentration of 100 g/mL for 5 min. The percent binding of the competing mAb in the presence of the first mAb was determined by comparing the maximal signal of the competing mAb applied after the initial mAb complex to the maximal signal of competing mAb alone. Antibodies were judged to compete for binding to the same site if maximum binding of the competing mAb was reduced to <30% binding affinity alone. Antibodies were considered non-competing if maximum binding of the competing mAb was >70% of non-competed binding. A level of 30-70% of non-competed binding was considered intermediate competition.
[0235] Mutagenesis Epitope Mapping.
[0236] A CHIKV envelope protein expression construct (strain S27, Uniprot Reference #Q8JUX5) with a C-terminal V5 tag was subjected to alanine-scanning mutagenesis to generate a comprehensive mutation library. Primers were designed to mutate each residue within the E2, 6K, and E1 regions of the envelope proteins (residues Y326 to H1248 in the structural polyprotein) to alanine; alanine codons were mutated to serine (Fong et al., 2014). In total, 910 CHIKV envelope protein mutants were generated (98.5% coverage), sequence confirmed, and arrayed into 384-well plates. HEK-293T cells were transfected with the CHIKV mutation library in 384-well plates and incubated for 22 hours. Cells were fixed in 4% paraformaldehyde (Electron Microscopy Sciences) in PBS plus calcium and magnesium (PBS+/+) and stained with purified mAbs at 0.25 to 1.0 g/mL or purified Fab fragments at 2.5 g/mL diluted in 10% normal goat serum (NGS; Sigma). Primary antibody concentrations were determined using an independent immunofluorescence titration curve against wild-type CHIKV envelope proteins to ensure that signals were within the linear range of detection. Antibodies were detected using 3.75 g/mL AlexaFluor488-conjugated secondary antibody (Jackson ImmunoResearch Laboratories) in 10% NGS. Cells were washed twice with PBS without magnesium and calcium (PBS /) and resuspended in Cellstripper (Cellgro) with 0.1% BSA (Sigma). Mean cellular fluorescence was detected using a high-throughput flow cytometer (HTFC, Intellicyt). Antibody reactivity against each mutant clone was calculated relative to wild-type protein reactivity by subtracting the signal from mock-transfected controls and normalizing to the signal from wild-type-transfected controls. Amino acids were identified as required for mAb binding if the corresponding alanine mutant did not react with the test mAb but did react with other CHIKV antibodies. This counter-screen strategy facilitates the exclusion of mutants that are misfolded or have an expression defect (Christian et al., 2013, Paes et al., 2009 and Selvarajah et al., 2013). Amino acids required for antibody binding were visualized on the CHIKV envelope protein crystal structure (monomer PDB ID #3N41 and trimer PDB ID #2XFB) using PyMol software.
[0237] Pre- and Post-Attachment Neutralization Assays.
[0238] Vero 81 cells (ATCC CCL-81; 7.510.sup.3 cells/well) were seeded into wells of 96-well plates and incubated at 37 C. for 24 hours. For pre-attachment assays, dilutions of mAb were prepared at 4 C. in virus dilution buffer (VDB) and pre-incubated with VRPs at 4 C. for 1 hour. Antibody-virus complexes were added to pre-chilled Vero 81 cells at 4 C. for 1 hour. Non-adsorbed virus was removed by three washes with VDB, and cells were incubated in complete medium at 37 C. for 18 hours. The post-attachment assay was performed similarly, except that an equivalent MOI of VRPs was first adsorbed to Vero 81 cells at 4 C. for 1 hour, unbound VRPs were removed by three washes with virus dilution buffer, and cells were incubated with pre-chilled VDB containing serial dilutions of mAb at 4 C. for 1 hour. Unbound mAbs were removed by three washes with VDB, and cells were incubated in complete medium at 37 C. for 18 hours. Cells were stained, imaged, and analyzed as described for VRP neutralization assays, with four fields of view per well, yielding a total of 800 to 1,000 cells analyzed for GFP expression per sample.
[0239] Fusion Inhibition Assays.
[0240] Virus fusion with the plasma membrane was assessed using an FFWO assay (Edwards & Brown, 1986). Vero 81 cells (3.7510.sup.3 cells/well) were seeded into wells of 96-well plates and incubated at 37 C. for 24 hours. Cells were washed once with binding medium (RPMI 1640 supplemented to contain 1% FBS, 25 mM HEPES [pH 7.4] and 20 mM NH.sub.4Cl to prevent infection through endosomal fusion) and incubated in binding medium at 4 C. for 15 min. Inoculum containing VRPs was diluted in binding medium and incubated with cells at 4 C. for 1 hour. Unbound VRPs were removed by two washes with binding medium. Serial dilutions of mAbs in VDB were incubated with cells at 4 C. for 1 hour, and unbound mAb was removed by two washes with VDB. FFWO was induced by the addition of pre-warmed fusion medium (RPMI 1640, 1% FBS, 25 mM HEPES, and 30 mM succinic acid at pH 5.5) at 37 C. for 2 min. In parallel wells, control medium (RPMI 1640, 1% FBS, 25 mM HEPES at pH 7.4) was added at 37 C. for two min. The medium was removed and cells were incubated in DMEM supplemented to contain 5% FBS, 20 mM NH.sub.4Cl (to ensure that infection occurred only through pH-dependent plasma membrane fusion), and 25 mM HEPES [pH 7.4]). At 18 hours post infection, cells were stained, imaged, and analyzed as described, with four fields of view per well, yielding a total of 800-1,000 cells analyzed for GFP expression per sample.
[0241] In Vivo Protection Studies in Mice.
[0242] This study was carried out in strict accordance with the recommendations in the Guide for the Care and Use of Laboratory Animals of the National Institutes of Health. The protocols were approved by the Institutional Animal Care and Use Committee at Washington University School of Medicine (Assurance Number: A3381-01). Ifnar.sup./ mice were bred in pathogen-free animal facilities at Washington University School of Medicine, and infection experiments were performed in A-BSL3 facilities with the approval of the Washington University Animal Studies Committee. Footpad injections were performed under anesthesia that was induced and maintained with ketamine hydrochloride and xylazine. For prophylaxis studies, human mAbs were administered by intraperitoneal injection to 6 week-old Ifnar.sup./ mice 1 day prior to subcutaneous inoculation in the footpad with 10 FFU of CHIKV-LR diluted in HBSS with 1% heat-inactivated FBS. For therapeutic studies, 10 FFU of CHIKV-LR was delivered 24, 48, or 60 hours prior to administration of a single dose of individual or combinations of human mAbs at specified doses.
Example 2Results
[0243] Isolation of CHIKV-Specific Human mAbs.
[0244] The inventors isolated a panel of mAbs from a single individual who acquired CHIKV infection in Sri Lanka in 2006 and presented with fever, arthralgias, and rash (
[0245] Assessment of mAb Neutralization.
[0246] Eighteen of the mAbs exhibited neutralizing activity against Asian CHIKV strain SL15649-GFP virus reporter particles (VRPs) with EC.sub.50 values <40 ng/mL, with eleven exhibiting ultrapotent inhibitory activity (defined as EC.sub.50 values <10 ng/mL, Table 5). Four mAbs possessed weak inhibitory activity (EC.sub.50 values in the 0.1 to 5 g/mL range), and eight of the mAbs had no inhibitory activity at the highest concentration tested (EC.sub.50 values >10 g/mL).
[0247] Breadth of Neutralizing Activity.
[0248] The inventors determined the EC.sub.50 values for each antibody against representative infectious CHIKV strains of the East/Central/South African (ECSA) genotype (LR2006 OPY1 [LR] strain), the West African genotype (NI 64 IbH 35 strain), and the Asian genotype (RSU1 and 99659 [2014 Caribbean] strains) using a high-throughput focus reduction neutralization test (FRNT) (Pal et al., 2013). Twenty-five of the mAbs exhibited neutralizing activity against at least one CHIKV strain (EC.sub.50 values <10 g/mL), with eight mAbs exhibiting neutralization in a potent range (EC.sub.50 values between 10-99 ng/mL), and thirteen mAbs exhibiting neutralization in an ultrapotent range (EC.sub.50 values <10 ng/mL) (Table 5). For comparative purposes, the inventors also tested the previously reported human mAbs 5F10 and 8B10 against viruses of all three genotypes, and in every case the EC.sub.50 values were >100 ng/mL (range 161-1337). In most cases, the mAbs the inventors isolated exhibited relatively similar neutralizing activity against virus from all three genotypes. Six mAbs (2B4, 2H1, 4J21, 4N12, 5M16, and 9D14) inhibited viruses from all three genotypes with ultrapotent activity (EC.sub.50 values <10 ng/mL). These data indicate that a single individual can develop multiple CHIKV-specific antibodies that are ultrapotent and broadly neutralizing.
[0249] Binding to E2 Protein.
[0250] The CHIKV E2 protein is a dominant target of murine (Goh et al., 2013; Lum et al., 2013), nonhuman primate (Kam et al., 2014), and human (Fong et al., 2014; Kam et al., 2012a; Kam et al., 2012b; Selvarajah et al., 2013) humoral responses. The inventors tested the human mAbs for binding to a monomeric form of the ectodomain of E2 protein expressed in E. coli (Pal et al., 2013). Nine mAbs bound strongly to the E2 ectodomain, six exhibited moderate binding, one bound weakly, and 14 failed to bind above background (Table 5). The capacity to bind purified E2 protein in vitro did not correlate directly with neutralizing potency (Table 5). A subset of 17 human mAbs was tested using a surface plasmon resonance assay for binding to the p62-E1 protein derived from mammalian cells (Voss et al., 2010). All mAbs bound in the nM range, with K.sub.D values from 0.5 to 20 nM. Differences in binding kinetics did not correlate with antigenic specificity or functional activity (Table S1).
[0251] Competition-Binding Studies.
[0252] To identify non-overlapping antigenic regions in recombinant E2 protein recognized by different neutralizing mAbs, the inventors used a quantitative competition-binding assay. For comparison, they also evaluated four previously described murine mAbs (CHK-84, CHK-88, CHK-141, and CHK-265) (Pal et al., 2013) and the previously described human mAb 5F10 (Wailer et al., 2011) (
[0253] Epitope Mapping Using Alanine-Scanning Mutagenesis.
[0254] The inventors used an alanine-scanning mutagenesis library coupled with cell-based expression and flow cytometry to identify amino acids in E2 and E1 proteins of CHIKV strain S27 (ECSA genotype) required for antibody binding (Fong et al., 2014) (
[0255] Structural Analysis of Antigenic Regions.
[0256] A large and diverse number of the surface residues in domains A and B and the arches are contacted by at least one of the mAbs (
[0257] Mechanism of Neutralization.
[0258] The inventors conducted pre- and post-attachment neutralization assays using mAbs displaying a range of inhibitory activities. As expected, all five mAbs tested neutralized infection efficiently when pre-incubated with VRPs (
[0259] Fusion-from-without (FFWO) assay testing of five of the ultrapotently neutralizing mAbs (3E23, 4B8, 4J21, 5M16, or 9D14) revealed that all inhibited fusion (Edwards and Brown, 1986). As expected, when virions pre-treated with mAbs were incubated continuously with medium buffered at neutral pH, little to no infection was observed (FIG. 2B). In the absence of antibody treatment, a short pulse of acidic pH-buffered medium resulted in infected cells, indicating fusion between the viral envelope and plasma membrane. Notably, all five human mAbs inhibited plasma membrane fusion and infection, with mAb 9D14 exhibiting the greatest potency in this assay. These studies suggest that ultrapotently neutralizing mAbs block CHIKV fusion.
[0260] MAb Prophylaxis In Vivo.
[0261] The inventors tested a subset of mAbs exhibiting diverse levels of neutralizing activity (Table 7) in a lethal infection model with 6-week-old, highly immunodeficient Ifnar.sup./ mice. Mice were pre-treated with a single 50 g dose (3 mg/kg) of human anti-CHIKV mAbs or a West Nile virus-specific isotype control mAb (WNV hE16) 24 hours before subcutaneous injection with a lethal dose of CHIKV-LR2006. All mice treated with the isotype control mAb succumbed to infection by 4 days post-inoculation. Pretreatment with mAbs 4B8, 4J21, or 5M16 completely protected Ifnar.sup./ mice, whereas treatment with mAbs 3E23 or 9D14 partially protected the infected animals, with 67% survival rates (
[0262] MAb Post-Exposure Therapy In Vivo.
[0263] Ifnar.sup./ mice were inoculated with a lethal dose of CHIKV-LR2006 and then administered a single 50 g (3 mg/kg) dose of representative mAbs 24 hours following virus inoculation. Therapeutic administration of these mAbs provided complete protection, whereas the isotype-control mAb provided no protection (
[0264] Analogously, studies were performed in WT mice to assess the effects of human mAbs on CHIKV acute and chronic arthritis. MAbs were administered on day 1 or 3 after infection and viral burden or RNA was analyzed at D3, 5 or 28 after infection. Depending on the tissue and time examined either 1H12 or 4J14 provide the most significant virological protection. 4N12 also provided significant protection in these assays.
[0265] Combination mAb Therapy In Vivo.
[0266] Given the possibility of resistance selection in vivo in animals treated with a single anti-CHIKV mAb (Pal et al., 2013), the inventors tested whether a combination of two anti-CHIKV human mAbs could protect mice against lethal challenge. They chose pairs of neutralizing mAbs based on the potency of individual mAbs in vitro. Ifnar.sup./ mice were administered a single combination antibody treatment dose (250 g of each, total of 28 mg/kg) of the most effective mAbs 60 hours after inoculation. Although some mAb combinations ([4J21+2H1] and [4J21+5M16]) provided little or no protection, others ([4J21+4N12]) resulted in a 63% survival rate at this very late time point (
TABLE-US-00001 TABLE S1 Kinetics of human CHIKV antibodies binding antigen measured by SPR ka kd CHKV MAb Ligand (10.sup.6 M1s1) (10.sup.4 s1) KD (nM) t.sub.1/2 (min) 5M16 p62-E1 1.09 0.02 1.13 0.02 1.03 0.01 102 2 5M16 Fab VLP 1.19 0.01 0.84 0.13 7.07 1.05 137 21 4J21 p62-E1 1.19 0.02 0.62 0.05 0.54 0.31 186 11 4J21 Fab VLP 1.58 0.03 14.2 0.29 9.00 0.03 8 0.2 3E23 p62-E1 3.18 2.43 2.67 0.87 6.11 1.41 43 19 3E23 Fab VLP 0.203 0.03 3.93 0.40 19.6 3.16 29 3 4B8 p62-E1 2.98 2.98 5.06 1.10 5.57 1.10 23 5 4B8 Fab VLP 0.60 0.04 3.33 0.30 5.60 0.46 35 3 5N23 p62-E1 2.98 0.75 2.40 0.66 0.87 0.37 48 17 1L1 p62-E1 0.88 0.44 2.73 0.36 3.79 2.10 42 6 2C2 p62-E1 1.54 0.65 6.08 1.45 4.59 2.32 19 6 2D12 p62-E1 17.5 1.64 5.41 3.97 0.49 0.08 13 4 4N12 p62-E1 1.24 0.02 1.18 0.01 0.95 0.02 98 1 5O14 p62-E1 0.79 0.02 9.11 0.19 1.15 0.01 .sup.13 0.3 9D14 p62-E1 2.70 0.90 2.82 0.14 1.13 0.40 41 2 8G18 p62-E1 3.90 0.21 1.88 0.11 0.48 0.02 62 3 4J14 p62-E1 1.61 0.47 15.3 2.52 9.94 2.54 8 1 5F p62-E1 2.61 0.04 50.9 0.75 19.5 0.2 2 0.03 3A2 p62-E1 2.12 0.02 10.1 0.12 4.78 0.08 .sup.11 0.1 1M9 p62-E1 1.86 0.99 3.98 0.26 2.48 0.99 29 2 3B4 p62-E1 2.91 0.09 1.56 0.11 0.54 0.02 74 5 6B p62-E1 0.99 0.03 2.74 0.10 2.77 0.18 42 2 6E22 p62-E1 0.48 0.02 2.0 0.13 4.22 0.42 58 4 Values for ka, kd, KD are means standard deviations. KD = kd/ka; t.sub.1/2 = (ln(2)/kd)/60.
Example 3Discussion
[0267] The inventors report the isolation of a diverse panel of naturally-occurring human mAbs from a single individual, the majority of which recognize the CHIKV E2 protein and display remarkable neutralizing activity in vitro and therapeutic efficacy in vivo. As a class, the most inhibitory antibodies also exhibited broad activity, neutralizing viruses from all three CHIKV genotypes, including a strain currently circulating in the Caribbean. The majority of human CHIKV-specific mAbs isolated in this study neutralized the virus at concentrations less than 100 ng/mL, and many exhibited inhibitory activity at less than 10 ng/mL. This activity is greater than the inventors have observed in previous studies of human mAbs against other pathogenic human viruses, including H1, H2, H3, or H5 influenza viruses (Hong et al., 2013; Krause et al., 2012; Krause et al., 2011a; Krause et al., 2011b; Krause et al., 2010; Thornburg et al., 2013; Yu et al., 2008), dengue viruses (Messer et al., 2014; Smith et al., 2013a; Smith et al., 2014; Smith et al., 2013b; Smith et al., 2012), and others. The potency of many human CHIKV mAbs is comparable to or exceeds that of best-in-class murine neutralizing CHIKV mAbs (Fong et al., 2014; Fric et al., 2013; Pal et al., 2013; Wailer et al., 2011), which were generated after iterative boosting and affinity maturation. Most other neutralizing human mAbs against CHIKV are substantially less potent (Fong et al., 2014; Selvarajah et al., 2013; Warter et al., 2011). A single previously reported human CHIKV-specific mAb (IM-CKV063) displays activity comparable to the ultrapotent neutralizing mAbs reported here (Fong et al., 2014).
[0268] The inventors observed a diversity of epitope recognition patterns in E2 by the different neutralizing CHIKV mAbs tested. Fine epitope mapping with alanine-substituted CHIKV glycoproteins showed that recognition of three structural regions in E2 is associated with mAb-mediated neutralization: domain A, which contains the putative RBD (Sun et al., 2013; Voss et al., 2010), domain B, which contacts and shields the fusion loop in E1 (Voss et al., 2010), and arches 1 and 2 of the -ribbon connector, which contains an acid-sensitive region and links domains A and B (Voss et al., 2010). Of the antibodies mapped to epitopes in E2, the bulk (those in competition groups 1 and 2) preferentially recognized sites in domain A and arches 1 and 2, whereas a smaller group (in competition group 3) recognized sites in domain B. These data suggest that surface-exposed regions in domain A and the arches are dominant antigenic sites that elicit human neutralizing antibody responses. The inventors conclude that the highly conserved region in domain A and arch 2 might elicit a broadly protective immune response and serve as an attractive candidate for epitope-focused vaccine design.
[0269] Remarkably, almost a quarter of surface-exposed residues in the critical E2 domains appear to be engaged by one or more mAbs from a single individual. The existence of functionally diverse binding modes on the major antigenic sites is implied by two observations: (a) some mAbs bound to similar epitopes but exhibited inhibitory activity that varied by several orders of magnitude and (b) there was little correlation between neutralization capacity and affinity of binding to E2 protein. Seven of the most potently neutralizing human mAbs (2H1, 3E23, 4B8, 4J21, 4N12, 5M16, and 9D14) inhibited CHIKV infection at a step following attachment, likely via prevention of pH-dependent structural changes, which prevents nucleocapsid penetration into the cytoplasm (Kielian et al., 2010).
[0270] As therapeutic efficacy in mice appears to predict treatment outcomes in experimentally-induced infection and arthritis in nonhuman primates (Pal et al., 2013; Pal et al., 2014), the data here suggest that prophylaxis of humans with CHIKV-specific human mAbs would prevent infection. Given concerns about selection of resistant variants with monotherapy (Pal et al., 2013), combination therapy using ultrapotent neutralizing antibodies that target different regions of E2 may be desirable. Patient populations at markedly increased risk of severe disease could be targeted during outbreaks, including those with serious underlying medical conditions (e.g., late-term pregnant women, the immunocompromised, and the elderly). Further clinical testing is planned to determine whether neutralizing human mAbs can prevent or ameliorate established joint disease in humans.
TABLE-US-00002 TABLE1 NUCLEOTIDESEQUENCESFORANTIBODYVARIABLEREGIONS SEQ Clone VariableSequenceRegion IDNO: 1H12 CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG 2 heavy AAGGTCTCCTGCAAGGCCTCTGGTTACAGCTTTACCAGCTACGGTATCAGCTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCACTTAC AAAGGTTACACACAGTATGCACAGAACTTCCAGGGCAGAGTCACCATCACCACA GACACACCCGCGACTACAGTCTATATGGAGCTGAGGAGCCTGAGATCTGACGAC ACGGCCGTGTATTACTGCGCGAGAGTTCTTTCCGAGACTGGTTATTTCTACTAC TACTACTACGGTATGGACGTCTGGGGCCAAGGGACCCTGGTCACCGTCTCCTCA 1H12 CAGGCTGTGGTGACTCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTC 3 light ACCATCTCCTGTACTGGGAGCAGCTCCAACATCGGGGCAGATTATAATGTACAC TGGTACCAGCTGCTTCCAGGAACAGCCCCCAAACTCCTCATCTATGGTAACACC AATCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCA GCCTCCCTGGCCATCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGC CAGTCCTATGACAGCAGCCTGAGTGCTTCGGTATTCGGCGGAGGGACCAAACTG ACCGTCCTAG 2B4 caggtgcagctggtgcaatctgggtctgagttgaagaagcctgggGCCTCAGTG 4 heavy AAGGTCTCCTGCAAGGCTTCTGGATACAGTTTCACTAGCTATTCTATCAACTGG GTGCGACAGGCCCCTGGACAAGGGCCTGAGTGGATGGGATGGATCGACACCAAC ACTGGGAACCCAACCTATGCCCAGGACTTCGCAGGACGGTTTGTCTTCTCCTTG GACACCTCTGTCACCACGGCATATCTGCAGATCAGCAGCCTAAAGGCTGGGGAC ACTGCCGTTTATTACTGTGCAACATATTATGTTGACCTTTGGGGGAGTTATCGC CAAGACTACTACGGTATGGACGTCTGGGGCCAC 2B4 cagtctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtc 5 light accatCTCTTGTTCTGGAGGGAGCTCCAACATCGGGAGTAATCCTGTAAATTGG TACCAGATGGTCCCAGGAACGGCCCCCAAACTCCTCCTCTATACTAATAATCAG CGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCC TCCCTGGCCATCAATGGACTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCA GTATGGGATGACAGCCTGAGTGGCCGTTGGGTGTTCGGCGGAGGGACCAAGGTG ACCGTCCTA 2H1 CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG 6 heavy AGGGTCTCCTGCAAGGCGTCTGGTTACACCTTTACCAGTTATGGTATCAGCTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCACTTAC AATGGTGACACAAACTATGCACAGAAGTTCCAGGGCAGAGTCACCTTGACAACA GAGACATCCACGAGCACAGCCTACATGGAGCTGAGGCGCCTGAGATCTGACGAC ACGGCCGTTTACTACTGTGCGAGAGATTTTGAATTTCCCGGAGATTGTAGTGGT GGCAGCTGCTACTCCAGGTTCATCTACCAGCACAACGACATGGACGTCTGGGGC CACGGGACCCTGGTCACCGTCTCCTCAGCAAGC 2H1 CAGGCTGTGGTGACTCAGCCGCCCTCAGTGTCTGCGGCCCCAGGACAGAAGGTC 7 light ACCATCTCCTGCTCTGGAAGCAGCTCCAACATTGGGAATCATTATGTATCCTGG TACCAGCACCTCCCGGGAACAGCCCCCAAACTCCTCATTTATGACAATTATAAG CGACCCTCAGTGATTCCTGACCGATTCTCTGCCTCCAAGTCTGGCGCGTCAGCC ACCCTGGGCATCATCGGACTCCAGACTGGGGACGAGGCCGATTATTACTGCGGA ACATGGGATAGCAGCCTGAGTGCTGTGGTATTCGGCGGAGGGACCAAGCTGACC GTCCTA 3E23 CAGGTGCAGCTGGTGCAGTCGGGCCCAGGACTGGTGAAGCCTTCGGACACCCTG 8 heavy TCCCTCACCTGCAGTGTCTCAAGTGACGCCCTCCGCAGCAGGAGTTATTACTGG GGCTGGGTCCGCCAGCCCCCCGGGAAGGGATTGGAGTGGATTGGGACTGTCTCT TATAGTGGGGGCACCTACTACAACCCGTCCCTCCAGAGTCGAGTCACCGTGTCG GTGGACACGTCCAAGAACCACTTCTCCCTGAGGTTGAACTCTGTGACCGCCGCA GACGCGGCTGTTTATTACTGTGCGAGATCTTATTTCTATGATGGCAGTGGTTAC TACTACCTGAGCTACTTTGACTCCTGGGGCCAGGGAACCCTGGTCACCGTCTCC TCA 3E23 CAGGCTGTGGTGACTCAGGAGCCCTCACTGACTGTGTCCCCAGGAGGGACAGTC 9 light ACTCTCACCTGTGCTTCCAGCACTGGAGCAGTCACCAGTGGTCACTATCCAAAC TGGTTCCAGCAGAAACCTGGACAACCACCCAGGGCCCTGATTTATAGCACAGAC AACAAGCACTCCTGGACCCCTGCCCGGTTCTCAGGCTCCCTCCTAGGGGTCAAG GCTGCCCTGACACTGTCAGATGTACAGCCTGAGGACGAGGCTGACTATTACTGC CTGCTCCATTTTGGTGGTGTCGTGGTCTTCGGCGGAGGGACCAAGCTGACCGTC CTA 3N23 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTG 10 heavy AGACTCTCCTGTGCAGTGTCTGGATTCACCTTCAGTAACTATGCCATGCACTGG GTCCGCCAGGCTCCAGGCAAGGGGCTGGACTGGGTGGCAGTTATATGGTATGAT GGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGA GACAATTCCAAGAACACGCTGTATCTGCAAGTGAACAGCCTGAGAGCCGAGGAC ACGGCTGTGTATTACTGTGCGAGGGGTGACTACGTTCTTGACTACTGGGGCCAG GGAACCCTGGTCACCGTCTCCTCA 3N23 GACATTGTGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGA 11 light GTCACCATCAGTTGCCGGGCCAGTCAGAGCATTCCCAGCTATTTAAATTGGTAT CAACAGAAACCAGGGAAAGCCCCTAAGGTCCTGATCTATGCTACATCCACTTTG GAAGCTGGGGTCCCATCACGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACT CTCACCATCACCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAG AGTTACAATACGGGGATATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAA 4J14 CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTG 12 heavy AAGGTCTCCTGCAAGGCTTCTGGAGGCACTTCCAGCACTTATGCTATCAGCTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGCAGCATCCCTGTC TTTGCTACAGTAAACTACGCACAGAAGTTCCAGGGCAGACTCACGATTACCGCG GACGAATCCACGAGCACAGTTTACATGGAACTGAGCAGCCTGAGATCTGAGGAC ACGGCCGTTTATTTCTGTGCGAGCCCCTATTGTAGTAGTATGAACTGCTATACG ACCTTTTACTACTTTGACTTCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 4J14 CAGGCTGTGGTGACTCAGCCTGCCTCCGTGTTTGGGTTTCCTGGACAGTCGATC 13 light ACCATCTCCTGCACTGGAACCAGCAGTGACTTTGGTACTTATAACTATGTCTCT TGGTACCAGCAACACCCAGGCCAAGCCCCCAAACTCATGATTTTTGATGTCAGT AATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACG GCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTTCTTATTACTGC AGCTCCTATACAAGCGGCAGCACTCTCTACGGCGGAGGGACCAAGCTGACCGTC CTG 4J21 CAGGTGCAGCTGGTGCAGTCTGGGTCTGAGTTGAAGAAGCCTGGGGCCTCAGTG 14 heavy AAGGTTTCCTGCAAGGCTTCTGGATACAGTTTCACTAGCTATTCTATCAACTGG GTGCGACAGGCCCCTGGACAAGGGCCTGAGTGGATGGGATGGATCGACACCAAC ACTGGGAACCCAACCTATGCCCAGGACTTCGCAGGACGGTTTGTCTTCTCCTTG GACACCTCTGTCACCACGGCATATCTGCAGATCAGCAGCCTAAAGGCTGGGGAC ACTGCCGTTTATTACTGTGCAACATATTATGTTGACCTTTGGGGGAGTTATCGC CAAGACTACTACGGTATGGACGTCTGGGGCCACGGGACCCTGGTCACCGTCTCC TCA 4J21 CAGTCTGTGGTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGGCAGGGGGTC 15 light ACCATCTCTTGTTCTGGAGGGAGCTCCAACATCGGGAGTAATCCTGTAAATTGG TACCAGATGGTCCCAGGAACGGCCCCCAAACTCCTCCTCTATACTAATAATCAG CGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCC TCCCTGGCCATCAATGGACTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCA GTATGGGATGACAGCCTGAGTGGCCGTTGGGTGTTCggcggagggaccaagctg accgtccta 4N12 CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG 16 heavy AAGGTCTCCTGCAAGGTTTCCGGATACATCCTCAGTAAATTATCCGTGCACTGG GTGCGACAGGCTCCTGGAAAAGGACTTGAATGGATGGGAGGTTCTGAACGTGAA GATGGCGAAACAGTCTACGCACAGAAGTTCCAGGGCAGAATCAGCTTGACCGAG GACACATCTATAGAGACAGCCTACATGGAGCTGAGCAGCCTGAGTTCTGAGGAC ACGGCCGTGTATTATTGTGCAACAGGAGGCTTCTGGAGTATGATTGGGGGAAAT GGAGTGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 4N12 CAGGCTGTGGTGACTCAGTCTCCATCGTCCCTGCCTGCATCTGTAGGAGACAGG 17 light GTCACCATCACTTGCCGGGCAAGTCAGGACATTAGAAATAATTTAGGCTGGTAT CAGCAGAAACCAGGGAAAGCCCCTGAGCGCCTGATCTATGGAACCTCCAATTTG CAGAGTGGGGTCCCGTCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACT CTCACAATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAG CATAATAGTTACCCTCCCACGTTCGGCCGCGGGACCAAGGTGGAAATCAAA 5M16 CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG 18 heavy AGAGTTTCCTGCAAGGCATCTGGGTACACCTTCACCAGTTACTTTATGCACTGG GTGCGACAGGCCCCTGGACAAGGACTTGAGTGGATGGCGATAACTTATCCTGGT GGTGGTAGCCCATCCTACGCACCGCAGTTCCAGGGCAGACTCACCATGACCGAC GACACGTCCGCGACCACAGTCTACATGGACCTGAGTGACCTGACTTCTAAAGAC ACGGCCGTGTATTACTGTGCGAGAGGTGCCCACCGTTCCATTGGGACGACCCCC CTTGACTCGTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGCAAGCTTCAAG GG 5O14 CAGGTGCAGCTGGTGCAGTCTGGGGGACGCGTGGTCCAGGCTGGGAGGTCCCTG 19 heavy AGACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTATGTATGGCGTCCACTGG GTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGAATGAT GGATCTAAAGAATACTATGGAGACTCCGTGAAGGGCCGATTCACCATCTCCAGA GACAATTCCAGGAACACGTTGTATCTGCAAATGAACAGCCTGAGAGTCGACGAC ACGGCAGTGTATTTTTGTGCGAGAGATGGAATTCCTGACCCTGAACGCGGTGAC TACGGGGGCTTGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 5O14 CAGACTGTGGTGACTCAGTTTCCATCCTCCCCGTTTGCATCTGTAGGAGACGGA 20 light GTCACCATCACTTGCCGGGCAAGGCAGAGCATTAGCAGTTATGTTAATTGGTAT CAGCAGAAACCAGGGAAAGCCCCTAAGCTCCTGATTTACGCTACATCCAGTTTG CAAAGTGGGGTCCCATCAAGGTTCAGTGGCAGTGGATATGGGACAGATTTCACT CTCACCATCAGCGGTCTGCAACCTGAAGATTTTGCAACATACTACTGTCAACAG AGTTACAGTTTTCCTCGAACGTTCGGCCAAGGGACCAAGGTGGAAATCAAAC 8G18 CAGGTGCAGCTGGTGCAGTCTGGGGCTCAGGTGAAGAAGCCTGGGTCCTCGGTG 21 heavy AAGGTCTCCTGCAAGCCCTCTGGAGGCACCTTCAACAACAATGGGATCAGTTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGCATCGTCCCGAAC TTTGGAACCCCAACCTATGGACAAGACTTCCAGGGCAGAGTCACGATCACCGCG GACGAATCTACGAGCACAGTCTTCTTGGAGCTGACCAGACTGAGATCTGACGAC ACGGCCGTTTATTTCTGTGCGCGAGGTCGCACGGCGGTGACTCCGATGCAATTG GGTTTACAGTTCTACTTTGACTTCTGGGGCCGGGGAACCCTGGTCACCGTCTCC TCA 8G18 cagactgtggtgactCAGGAGCCCTCACTGACTGTGTCCCCAGGAGGGACAGTC 22 light ACTCTCACCTGTTCTGCCAACAGTGGAGCAGTCACCAGTGATTACTATCCAAAC TGGTTCCAGCAGAAACCTGGACAAGCACCCAGGGCACTGATTTATAGTGCAAGC AACAAATTCTCCTGGACGCCTGCCCGGTTCTCAGGCTCCCTCCTTGGGGGCAAA GCTGCCCTGACACTGTCAGGTGCGCAGCCTGAGGACGAGGCTGAGTATTACTGC CTGGTCTACTCTGGTGATGGTGTGGTTTTCGGCGGAGGGACCAAGCTGACCGTC C 1I9 CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCCGGGGCCTCAGTG 23 heavy AAGGTCTCCTGCAAGACTTCTGGATATACGTTCACCGACAACTCTGTACACTGG GTGCGACAGGCCCCTGGACAAGGGTTTGAGTGGATGGGACGGATCAACCCTAAC ACTGGTGTCTCAACTTCTGCCCAGAAGTTTCAGGGCAGGGTCACCATGACCAGG GACACGTCCATCAGCACAACCTACATGGAGCTGAGCAGTTTGAGATCTGACGAC ACGGCCGTCTATTACTGTGCGAGAGAGGAGAACGATAGTAGTGGGTATTACCTT TGGGGTCAGGGAACCCTGGTCACCGTCTCCTCA 1I9 CAGATTGTGGTGACTCAGTCTCCATCCTCCCTGTTTGCATCTGTAGGAGACAGA 24 light GTCACCATCACTTGCCGGGCAAGTCAGAGCATTAGCACCTATTTAAATTGGTAT CAGCAAAAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGCTGCATCCAGTTTG GAGAGTGGGGTCCCATCAAGGTTCGGTGGCAGTAGATCTGGGACAGATTTCACT CTCACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACTTACTACTGTCAACAG AGTTACAGGACCCCGTGGACGTTCGGCCAAGGGACCAAGGTGGACATCAAA 1L1 CAGGTGCAGCTGGTGCAGTCTGGTCCTACGCTGGTGAAACCCACACAGACCCTC 25 heavy ACGCTGACCTGCACCTTCTCTGGGTTCTCACTCAGTATTAGTGGAGTGGGTGTG GGCTGGATCCGTCAGCCCCCAGGAAAGGCCCTGGAGTGGCTTGCACTCATTTAT TGGGATGATGATAAGCGCTACAGCCCATCTCTGAAGAGCAGGCTCACCATCACC AAGGACACCTCCGAAAACCAGGTGGTCCTTACAATGACCAACATGGACCCTGTG GACACAGCCACATATTACTGTGCACACAGTATGACTAAAGGCGGGGCTATCTAT GGTCAGGCCTACTTTGAATACTGGGGCCAGGGAACCCTGGTC 1L1 CCATCTCCTGCACTGGAACCAGACAGTGACGTTGGTGGTTATAACTATGTCTCC 26 light TGGTACCAACAACACCCAGGCAAAGCCCCCAAACTCATCATTTATGATGTCACT GATCGGCCCTCAGGGGTTTCTAATCGCTTCTCTGCCTCCAAGTCTGCCAACACG GCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGC AGCTCATATACAAGCAGCAGCACTCTGGTTTTCGGCGGAGGGACCAAGCTGACC GTCCTA 1M9 caggtccagctggtacagtctggggctgaggtgaagaagcctggGGCCTCAGTG 27 heavy AAGGTCTCCTGCAAGGTTTCCGGATACACCCTCACTGAATTATCCATGCACTGG GTGCGACAGGCTCCTGGAAAAGGCCTAGAGTGGATGGGAGGTTTTGAGCCTGAA GATGGTGAAACAATCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCGAG GACACATCTAGAGACACAGCCTACATGGAGCTGAGTAGCCTGAGATCTGAGGAC ACGGCCGTCTATTACTGTACAACAGATCAGGTCTACTATCGTTCGGGGAGTTAT TCTGGATATGTTGACTACTGGGGCCAGGGAACCCTGGTC 1O5 caggtccagctggtgcagtctggggctgaggtgaagaagcctgggtCCTCAGTG 28 heavy AAGGTCTCCTGCAAGGCTTCTGGACGCACCTTCAGCAGCTATGTTATCAGCTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTCTG TTTGGTACAGCAAACTACGCACAGAAATTCCAGGGCAGAGTCACGATTACCGCG GACGAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGACGAC ACGGCCGTCTATTACTGTGCGAGGGGCGCCCAGCTATATTACAATGATGGTAGT GGTTACATTTTTGACTACTGGGGCCAGGGAGCCCTGGTC 1O6 CAGGTGCAGCTGGTGCAGTCTGGGCCTGAGGTGAAGAAGCCTGGGACCTCAGTG 29 heavy AAGGTCTCCTGCAAGGCTTCTGGATTCAGCTTTATTAGCTCTGCTGTGCAGTGG GTGCGACAGGCTCGTGGACAACGCCTTGAGTGGATAGGATGGATCGTCGTTGCC AGTGCTAACACAAACTACGCACAGAAGTTCCGGGAAAGAGTCACCATTACTAGG GACATGTCCACAAACACAGCCTATATGGAACTGACCAGCCTGAGATCCGAGGAC ACGGCCGTTTATTACTGTGCGGCAGAGCACCGGTCCCCTTGTAGTGGTGGTGAT AGCTGCTACAGTCTCTACTACGGTATGGACGTCTGGGGCCAAGGGACCCTGGTC ACCGTCTCCTCA 2A2 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTTCCGCCTGGGGGGTCCCTG 30 heavy AGACTGTCCTGTACAGCCTCTGGATTCACCGTTAGTAACTATGGCATGAGCTGG GTCCGCCAGACTCCAGGGAAGGGGCTGGAGTGGGTCTCAACTATTAGTACTAGT AGTGGTAGAACATTCTACGCAGACTCCGTGGAGGGCCGGTTCACCATCTCCGGA GACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGTCGAAGAC ACGGCCGTATATTACTGTGCGAAAGGCCCGTTCGGGGGCGACTTTGACTACTGG GGCCAGGGAACCCTGGTCACCGTCTCCTCA 2A2 CAGGCTGTGGTGACTCAGTCTCCAGCCACCCTGTCTTTGTCTCCAGGGGAAAGA 31 light GCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTGCCATCTACTTAGCCTGGTAT CAACAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGATGCATCCAACAGG GCCACTGGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACT CTCACCATCAGCAGCCTAGAGCCTGAAGATTTTGCAGTTTATTACTGTCAGCAG CGTGGCAACTGGCAGTACACTTTTGGCCAGGGGACCAAACTGGAGATCAAA 2C2 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCCTGGTACAGCCTGGCAGGTCCCTG 32 heavy ACACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGTTTATGCCATGCACTGG GTCCGGCAAGCTCCAGGGAAGGGCTTGGAGTGGGTCGCAGGTATTAGTTGGAAT AGTGGTAGCGTAGGCTATGCGGACTCTATGAAGGGCCGATTCACCATCTCCAGA GACAACGCCAAGAACTCCCTGTATCTGCAAATTAACAGTCTGAGAGCTGAGGAC ACGGCCTTATATTACTGTGCAAAAGCATTCTGGTTCGGGGAGTTATCGGGTTAC GGTATGGACGTCTGGGGCCAAGGGACCCTGGTCACCGTCTCCTCA 2C2 CAGGCTGTGGTGACTCAGCCTCCCTCCGCGTCCGGGTTTCCTGGACAGTCAGTC 33 light ACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTAGTTATAACTATGTCTCC TGGTACCAACAGCACCCAGGCAAAGCCCCCAAACTCATAATTTATGCGGTCACT AGGCGGCCCTCAGGGGTCCCTGAGCGCTTCTCTGGCTCCAAGTCTGGCAACACG GCCTCCCTGACCGTCTCTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGC ACCTCATATGCAGGCAACAACAAGGATGTCTTCGGAACTGGGACCAAGGTCACC GTCCTA 2D12 CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTG 34 heavy AAGGTCTCCTGCAAGGCTTCTGGTTACAGCTTTAACATCTATGGTATCAGCTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTAC AATGGTAACACAAACTATGCACAGAAACTCCAGGGCAGAGTCACCATGACCACA GACACATCCACGAGCACAGCCTACATGGAACTGAGGAGCCTGAGATCTGACGAC ACGGCCGTGTATTACTGTGCGAGACCACTTTGGGGGGAATTTTACTATGATATC TGGGGCCAAGGGACCCTGGTCACCGTCTCCTCA 2D12 CAGGCTGTGGTGACTCAGTCTCCAGGCACCCTGTCCTTGTCTCCAGGGGAAAGA 35 light GCCACCCTCTCTTGCAGGGCCAGTCAGAGTGTTAGCAGCGGGTACTCAGCCTGG TACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAAA AGGGCCGCTGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTC ACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAG CTGTTTGCTACCTCACCTCCGCCCTTCGGCCAAGGGACACGACTGGAGATTAAA 3A2 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTG 36 heavy AGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAATTATGTTATGGAGTGG GTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATCATATGAT GGAAGCAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGA GACAATTCCAAGAACACGTTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGAC ACGGCTGTGTATTACTGTGCGAGATCAGAGTGGGAGTCTTCCTATGGTTCGGGG AATTATTATACAGATTACTTCTACTACTACGCTATGGACGTCTGGGGCCCAGGG ACCCTGGTCACCGTCTCCTCA 3A2 CAGGCTGTGGTGACTCAGTCTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCG 37 light GCCTCCATCTCCTGCAGGTCTAATCAGAGCCTCCTGCGTGGTATTAGATACAAC TATTTGGATTGGTACCTGCAGAAACCAGGGCAGTCTCCACAGCTCCTGATCTAT TTGGGTTCTAATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATCA GCCACAGATTTTACACTGAAAATCAGCAGAGTGGAGGCTGAGGATGTTGGGGTT TATTACTGCATGCAAGCTCTACAAACTCCTACCACCTTCGGCCAAGGGACACGA CTGGAGATTAAA 3B4 CAGGTGCAGCTGGAGGAGTCTGGTCCTACGCTGGTGAAACCCACACAGACCCTC 38 heavy ACGCTGACCTGTTCCTTCTCTGGGTTCTCACTCACCACTACTGGAGTGACTGTG GGCTGGATCCGTCAGCCCCCAGGAAAGGCCTTGGAGTGGCTTGCACTCATTTAT TGGGATGATGATAAGCGCTACAGCCCATCTCTGAAGAGCAGGCTCACCATCACC AAGGACACCTCCAAAAACCAGGTGGTCCTTACCATGACCAACATGGACCCTGTG GACACTGCCACATATTACTGTGCGCACTCCACCGGCTACTATGATAGTAGTGGC TATCGAGGGGCCCTTGATGCTTTTGCTGTCTGGGGCCAAGGGACCCTGGTCACC GTCTCCTCA 3B4 CAGATTGTGGTGACTCAGTTTCCAGACTCCCCGGCTGTGTCTTTGGGCGAGAGG 39 light GCCACCATCAACTGCAAGTCCAGCCAGAGTGTTTTATACCACTCCAACAATAAA AACTACTTAGCTTGGTACCAGCAGAAACCAGGACAGCCTCCTAACCTGCTCATT TACTGGGCATCTGCCCGACAATCCGGGGTCCCTGACCGATTCAGTGGCAGCGGG TCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGGCTGAAGATGTGGCA GTTTATTACTGTCAGCAATATTATAGTACTCCGTACACTTTTGGCCAGGGGACC AAGCTGGAGATCAAA 3E23 CAGGTGCAGCTGGTGCAGTCGGGCCCAGGACTGGTGAAGCCTTCGGACACCCTG 40 heavy TCCCTCACCTGCAGTGTCTCAAGTGACGCCCTCCGCAGCAGGAGTTATTACTGG GGCTGGGTCCGCCAGCCCCCCGGGAAGGGATTGGAGTGGATTGGGACTGTCTCT TATAGTGGGGGCACCTACTACAACCCGTCCCTCCAGAGTCGAGTCACCGTGTCG GTGGACACGTCCAAGAACCACTTCTCCCTGAGGTTGAACTCTGTGACCGCCGCA GACGCGGCTGTTTATTACTGTGCGAGATCTTATTTCTATGATGGCAGTGGTTAC TACTACCTGAGCTACTTTGACTCCTGGGGCCAGGGAACCCTGGTCACCGTCTCC TCA 3E23 CAGGCTGTGGTGACTCAGGAGCCCTCACTGACTGTGTCCCCAGGAGGGACAGTC 41 light ACTCTCACCTGTGCTTCCAGCACTGGAGCAGTCACCAGTGGTCACTATCCAAAC TGGTTCCAGCAGAAACCTGGACAACCACCCAGGGCCCTGATTTATAGCACAGAC AACAAGCACTCCTGGACCCCTGCCCGGTTCTCAGGCTCCCTCCTAGGGGTCAAG GCTGCCCTGACACTGTCAGATGTACAGCCTGAGGACGAGGCTGACTATTACTGC CTGCTCCATTTTGGTGGTGTCGTGGTCTTCGGCGGAGGGACCAAGCTGACCGTC CTA 3H5 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTG 42 heavy AGACTCTCCTGTTCAACGTCTGGATTCACCTTCAGGATGTATGGCATGCACTGG GTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCCGTTATTTTTAACGAT GGAGTTAAGAAATATTATGGAGACGCCGTGAAGGGCCGATTCACCGTCTCCAGA GACAATTCCAGGAACACCCTGTATCTGGAAATGAAAAGCCTGAGAGTCGACGAC ACGGCTGCCTACTACTGTGCGAGAGACGGGATTCCTGACCCCGAACGCGGTGAC TACGGGGGCTTGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 3H5 CAGACTGTGGTGACTCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACACA 43 light GTCACCATCACTTGCCGGGCAAGTCAGAGCATTACCAGTTATTTAAACTGGTAT CAGCAGAAACCAGGAAAAGCCCCAAAGCTCCTCATCTATGCTACATCCAGTTTG CAAAGTGGGCTCCCCTCAAGGTTCAGTGGCAGTGGCTATGGGACAGAATTCACT CTCACCATCAGTGGTCTGCAACCTGAAGATTTTGCAACATACTACTGTCAACAG AGTTACAGTTTTCCTCGAACGTTCGGCCAAGGGACCAAGGTGGAAATGGATA 3I21 CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTG 44 heavy AGACTCTCCTGTGCAACCTCTGGATTCATCTTTGATGATTATGCCATGTACTGG GTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAAT AGTGGAAACATAGCCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGA GACAACGCCAAGAACTCCCTGTATTTGGAAATGAACAGTCTGAGAGCTGAGGAC ACGGCCTTGTATTACTGTGTAAAAGATCTTTACGGGTACGATATTTTGACTGGT AATGGATATGATTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 3I21 CAGGCTGTGGTGACTCAGTCTTCACTCTCCCTGCCCGTCACCCCTGGAGAGCCG 45 light GCCTCCATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCAAAGTAATGGATACAAC TATTTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTAT TTGGGTTCTAATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATCA GGCACAGATTTTACACTGAAAATCAGCAGAGTGGAGGCTGAGGATGTTGGGGTT TATTACTGCATGCAAGCTCTACAAACTCCTCCGACGTTCGGCCAAGGGACCAAG GTGGAAATCAA 3K11 CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTG 46 heavy AAGGTCCCCTGCAAGGCTTCTGGAGACACCCTCAGTTACTACGGAATCACTTGG GTGCGACGGGCCCCTGGACAAGGGCTTGAGTGGATGGGACAGATCATCCCTTTC TTTGCTACAACAATCTCCGCACAGAAGTTCCAGGGCAGACTCACCATGACCGCG GAAGAATCCACGAGCACTGGCTACATGGAGCGCACATTTTACATGGACTTGAGT AGCCTTAGACCTGAGGACACGGCCGTATACTACTGTGCGGGGGGCTACTATGGT TCGGGGAGTTCGGGCGACTACGGTTTGGACGTCTGGGGCCAAGGGACCCTGGTC ACCGTCTCCTCA 3K11 CAGGCTGTGGTGACTCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTC 47 light ACCATCTCCTGCACTGGGAGCAGCTCCAACATCGGGGCAGGTTATGATGTAAAC TGGTACCAGCAGCTTCCAGGAACAGCCCCCAAACTCCTCATCTATGGTAACAAC AATCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCA GCCTCCCTGGCCATCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGC CAGTCCTATGACAGCAGCCTGAGTGGTTCGGGAGTCTTCGGAACTGGGACCGAG GTCACCGTCCTA 4B8 CAGGTGCAGCTGGTGCAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTG 48 heavy TCCCTGACGTGCGCTGTTTCTGGTGACTCCATCGGCAGTAGAAGTTTCTACTGG GGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGAAGTATCTAT TATAATGGGACCACCTACTACAAGCCGTCCCTCAAGAGTCGAGTCACCATATCC CTAGACACGTCCAAGAACCAGTTCTCCCTGAGGCTGAGCTCTCTGACCGCCACA GACACGGGTGTCTATTACTGTGCGCGGGCGCCAACCTACTGTAGTCCTTCCAGC TGCGCAGTTCACTGGTACTTCAATCTCTGGGGCCGTGGCACCCTGGTCACCGTC TCCTCA 4B10 CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGCTGAAGAAGCCTGGGGCCTCAGTG 49 heavy AAGGTCTCCTGCAAGGCTTCTGGTTACATATTTACCAAATATGGTATCAGTTGG CTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGGTGGGATGGATCAGCGCTTAC AATGAAAACACAAACTATGCAGAGAAGTTCCAGGGCAGAGTCACCTTGACCACA GATGCATCCACGAGCACGGCCTACATGGAGCTGAGGAACCTGAGATCTGACGAC ACGGCCGTATACTTCTGTGCGAGAGAAGTCTGGTTCGCGGAGTATATTTACTGG GGCCAGGGAACCCTGGTCACCGTCTCCTCA 8E22 CAGGCTGTGGTGACTCAGGAGCCCTCACTGACTGTGTCCCCAGGAGGGACAGTC 50 light ACTCTCACCTGTTCTGCCAACAGTGGAGCAGTCACCAGTGATTACTATCCAAAC TGGTTCCAGCAGAAACCTGGACAAGCACCCAGGGCACTGATTTATAGTGCAAGC AACAAATTCTCCTGGACGCCTGCCCGGTTCTCAGGCTCCCTCCTTGGGGGCAAA GCTGCCCTGACACTGTCAGGTGCGCAGCCTGAGGACGAGGCTGAGTATTACTGC CTGGTCTACTCTGGTGATGGTGTGGTTTTCGGCGGAGGGACCAAGCTGACCGTC CTAA 9A11 CAGTCTGTGGTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATC 51 light ACCATCTCCTGCACTGGAACCAGCAGTGACGTTGGTGCTTATAACTATGTCTCC TGGTACCAACAACACCCAGGCAAAGCCCCCAAACTCGTGATTTATGATGTCGCT AATCGGCCCTCAGGGATTTCTGACCGCTTCTCTGGCTCCAAGTCTGGCAACACG GCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGC GGCTCATATACCAGCGACGTCTCGCCGGTTTTCAGCGGGGGGACCAAGCTGACC GTCCTCA 9D14 CAGGTGCAGCTGGTGCAGTCTGGGTCTGAGTTGAAGAAGCCTGGGGCCTCAGTG 52 heavy AAGCTTTCCTGCAAGGCTTCTGGATACACCTTCACAAGTCATCCTATGAATTGG GTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACACCAAG ACTGGGAACCTAACTTATGCCCAGGGCTTCACAGGACGGTTTGTCTTCTCCTTG GACACCTCTGTCAGGACGGCGTATCTGCAGATCAGCGGCCTAAAGGCTGAGGAC ACTGCCATTTATTACTGTGCGAGAGATGAGTATAGTGGCTACGATTCGGTAGGG GTGTTCCGTGGTTCTTTTGACGACTTCTACGGTATGGACGTCTGGGGCCAAGGG ACCCTGGTCACCGTCTCCTCA
TABLE-US-00003 TABLE2 PROTEINSEQUENCESFORANTIBODYVARIABLEREGIONS SEQ Clone VariableSequence IDNO: 1H12 QVQLVQSGAEVKKPGASVKVSCKASGYSFTSYGISWVRQAPGQGLEWMG 53 heavy WISTYKGYTQYAQNFQGRVTITTDTPATTVYMELRSLRSDDTAVYYCAR VLSETGYFYYYYYGMDVWGQGTLVTVSS 1H12 QAVVTQPPSVSGAPGQRVTISCIGSSSNIGADYNVHWYQLLPGTAPKLL 54 light IYGNINRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLS ASVFGGGTKLTVL 2B4 QVQLVQSGSELKKPGASVKVSCKASGYSFTSYSINWVRQAPGQGPEWMG 55 heavy WIDTNIGNPTYAQDFAGRFVFSLDTSVITAYLQISSLKAGDTAVYYCAT YYVDLWGSYRQDYYGMDVWGH 2B4 QSVLIQPPSASGTPGQRVTISCSGGSSNIGSNPVNWYQMVPGTAPKLLL 56 light YTNNQRPSGVPDRFSGSKSGTSASLAINGLQSEDEADYYCAVWDDSLSG RWVFGGGTKVTVL 2H1 QVQLVQSGAEVKKPGASVRVSCKASGYTFTSYGISWVRQAPGQGLEWMG 57 heavy WISTYNGDTNYAQKFQGRVILTTETSTSTAYMELRRLRSDDTAVYYCAR DFEFPGDCSGGSCYSRFIYQHNDMDVWGHGTLVTVSSAS 2H1 QAVVTQPPSVSAAPGQKVTISCSGSSSNIGNHYVSWYQHLPGTAPKLLI 58 light YDNYKRPSVIPDRFSASKSGASATLGIIGLQTGDEADYYCGTWDSSLSA VVFGGGTKLTVL 3E23 QVQLVQSGPGLVKPSDILSLICSVSSDALRSRSYYWGWVRQPPGKGLEW 59 heavy IGTVSYSGGTYYNPSLQSRVTVSVDTSKNHFSLRLNSVTAADAAVYYCA RSYFYDGSGYYYLSYFDSWGQGTLVTVSS 3E23 QAVVTQEPSLTVSPGGIVTLICASSTGAVISGHYPNWFQQKPGQPPRAL 60 light IYSTDNKHSWTPARFSGSLLGVKAALTLSDVQPEDEADYYCLLHFGGVV VFGGGTKLTVL 3N23 QVQLVQSGGGVVQPGRSLRLSCAVSGFTFSNYAMHWVRQAPGKGLDWVA 61 heavy VIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQVNSLRAEDTAVYYCAR GDYVLDYWGQGTLVTVSS 3N23 DIVMTQSPSSLSASVGDRVTISCRASQSIPSYLNWYQQKPGKAPKVLIY 62 light ATSTLEAGVPSRFSGSGSGTDFTLTITSLQPEDFATYYCQQSYNTGIFT FGPGTKVDIK 4J14 QVQLVQSGAEVKKPGSSVKVSCKASGGTSSTYAISWVRQAPGQGLEWMG 63 heavy GSIPVFATVNYAQKFQGRLTITADESTSTVYMELSSLRSEDTAVYFCAS PYCSSMNCYTTFYYFDFWGQGTLVTVSS 4J14 QAVVTQPASVFGFPGQSITISCTGTSSDFGTYNYVSWYQQHPGQAPKLM 64 light IFDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEASYYCSSYTSGST LYGGGTKLTVL 4J21 QVQLVQSGSELKKPGASVKVSCKASGYSFTSYSINWVRQAPGQGPEWMG 65 heavy WIDINTGNPTYAQDFAGRFVFSLDTSVTTAYLQISSLKAGDTAVYYCAT YYVDLWGSYRQDYYGMDVWGHGTLVTVSS 4J21 QSVVTQPPSVSGTPGQGVTISCSGGSSNIGSNPVNWYQMVPGTAPKLLL 66 light YTNNQRPSGVPDRFSGSKSGTSASLAINGLQSEDEADYYCAVWDDSLSG RWVFGGGTKLTVL 4N12 QVQLVQSGAEVKKPGASVKVSCKVSGYILSKLSVHWVRQAPGKGLEWMG 67 heavy GSEREDGETVYAQKFQGRISLTEDTSIETAYMELSSLSSEDTAVYYCAT GGFWSMIGGNGVDYWGQGTLVTVSS 4N12 QAVVTQSPSSLPASVGDRVTITCRASQDIRNNLGWYQQKPGKAPERLIY 68 light GTSNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPPTF GRGTKVEIK 5M16 QVQLVQSGAEVKKPGASVRVSCKASGYTFTSYFMHWVRQAPGQGLEWMA 69 heavy ITYPGGGSPSYAPQFQGRLTMTDDTSATTVYMDLSDLTSKDTAVYYCAR GAHRSIGTTPLDSWGQGTLVTVSSASFK 5O14 QVQLVQSGGRVVQAGRSLRLSCAASGFTFSMYGVHWVRQAPGKGLEWVA 70 heavy VIWNDGSKEYYGDSVKGRFTISRDNSRNTLYLQMNSLRVDDTAVYFCAR DGIPDPERGDYGGLDYWGQGTLVTVSS 5O14 QTVVTQFPSSPFASVGDGVTITCRARQSISSYVNWYQQKPGKAPKLLIY 71 light ATSSLQSGVPSRFSGSGYGTDFILTISGLQPEDFATYYCQQSYSFPRIF GQGTKVE1K 8G18 QVQLVQSGAQVKKPGSSVKVSCKPSGGTFNNNGISWVRQAPGQGLEWMG 72 heavy GIVPNFGTPTYGQDFQGRVTITADESTSTVFLELTRLRSDDTAVYFCAR GRTAVTPMQLGLQFYFDFWGRGTLVTVSS 8G18 QTVVTQEPSLTVSPGGIVTLICSANSGAVISDYYPNWFQQKPGQAPRAL 73 light IYSASNKFSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCLVYSGDGV VFGGGTKLTV 1I9 QVQLVQSGAEVKKPGASVKVSCKTSGYTFTDNSVHWVRQAPGQGFEWMG 74 heavy RINPNTGVSTSAQKFQGRVTMTRDTSISTTYMELSSLRSDDTAVYYCAR EENDSSGYYLWGQGTLVTVSS 1I9 QIVVTQSPSSLFASVGDRVTITCRASQSISTYLNWYQQKPGKAPKLLIY 75 light AASSLESGVPSRFGGSRSGTDFTLTISSLQPEDFATYYCQQSYRTPWTF GQGTKVDIK 1L1 QVQLVQSGP.TLVKPTQTLTLTCTFSGFSLSISGVGVGWIRQPPGKALE 76 heavy WLALIYWDDDKRYSPSLKSRLTITKDTSENQVVLTMTNMDPVDTATYYC AHSMTKGGAIYGQAYFEYWGQGTLV 1L1 PSPALEPDSDVGGYNYVSWYQQHPGKAPKLIIYDVTDRPSGVSNRFSAS 77 light KSANTASLTISGLQAEDEADYYCSSYTSSST 1M9 QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMG 78 heavy GFEPEDGETIYAQKFQGRVIMTEDTSRDTAYMELSSLRSEDTAVYYCIT DQVYYRSGSYSGYVDYWGQGTLV 1O5 QVQLVQSGAEVKKPGSSVKVSCKASGRTFSSYVISWVRQAPGQGLEWMG 79 heavy GIIPLFGTANYAQKFQGRVTITADESTSTAYMELSSLRSDDTAVYYCAR GAQLYYNDGSGYIFDYWGQGALV 1O6 QVQLVQSGPEVKKPGTSVKVSCKASGFSFISSAVQWVRQARGQRLEWIG 80 heavy WIVVASANTNYAQKFRERVTITRDMSTNTAYMELTSLRSEDTAVYYCAA EHRSPCSGGDSCYSLYYGMDVWGQGTLVTVSS 2A2 QVQLVQSGGGLVPPGGSLRLSCTASGFTVSNYGMSWVRQTPGKGLEWVS 81 heavy TISTSSGRTFYADSVEGRFTISGDNSKNTLYLQMNSLRVEDTAVYYCAK GPFGGDFDYWGQGTLVTVSS 2A2 QAVVTQSPATLSLSPGERATLSCRASQSVAIYLAWYQQKPGQAPRLLIY 82 light DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRGNWQYTF GQGTKLEIK 2C2 QVQLVQSGGGLVQPGRSLTLSCAASGFTFDVYAMHWVRQAPGKGLEWVA 83 heavy GISWNSGSVGYADSMKGRFTISRDNAKNSLYLQINSLRAEDTALYYCAK AFWFGELSGYGMDVWGQGTLVTVSS 2C2 QAVVTQPPS.ASGFPGQSVTISCTGTSSDVGSYNYVSWYQQHPGKAPKL 84 light IIYAVTRRPSGVPERFSGSKSGNTASLTVSGLQAEDEADYYCTSYAGNN KDVFGTGTKVTVL 2D12 QVQLVQSGAEVKKPGASVKVSCKASGYSFNIYGISWVRQAPGQGLEWMG 85 heavy WISAYNGNTNYAQKLQGRVIMITDTSTSTAYMELRSLRSDDTAVYYCAR PLWGEFYYDIWGQGTLVTVSS 2D12 QAVVTQSPGTLSLSPGERATLSCRASQSVSSGYSAWYQQKPGQAPRLLI 86 light YGASKRAAGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQLFATSPPP FGQGTRLEIK 3A2 QVQLVQSGGGVVQPGRSLRLSCAASGFTFSNYVMEWVRQAPGKGLEWVA 87 heavy VISYDGSNKYYADSVK.GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RSEWESSYGSGNYYTDYFYYYAMDVWGPGTLVTVSS 3A2 QAVVTQSPLSLPVTPGEPASISCRSNQSLLRGIRYNYLDWYLQKPGQSP 88 light QLLIYLGSNRASGVPDRFSGSGSATDFTLKISRVEAEDVGVYYCMQALQ TPTTFGQGTRLEIK 3B4 QVQLEESGPTLVKPTQTLTLICSFSGFSLITTGVTVGWIRQPPGKALEW 89 heavy LALIYWDDDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCA HSTGYYDSSGYRGALDAFAVWGQGTLVTVSS 3B4 QIVVTQFPDSPAVSLGERATINCKSSQSVLYHSNNKNYLAWYQQKPGQP 90 light PNLLIYWASARQSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYY STPYTFGQGTKLEIK 3E23 QVQLVQSGPGLVKPSDILSLICSVSSDALRSRSYYWGWVRQPPGKGLEW 91 heavy IGTVSYSGGTYYNPSLQSRVTVSVDTSKNHFSLRLNSVTAADAAVYYCA RSYFYDGSGYYYLSYFDSWGQGTLVTVSS 3E23 QAVVTQEPS.LTVSPGGTVTLICASSTGAVTSGHYPNWFQQKPGQPPRA 92 light LIYSTDNKHSWTPARFSGSLLGVKAALTLSDVQPEDEADYYCLLHFGGV VVFGGGTKLTVL 3H5 QVQLVQSGGGVVQPGRSLRLSCSTSGFTFRMYGMHWVRQAPGKGLEWVA 93 heavy VIFNDGVKKYYGDAVKGRFTVSRDNSRNTLYLEMKSLRVDDTAAYYCAR DGIPDPERGDYGGLDYWGQGTLVTVSS 3H5 QTVVTQSPSSLSASVGDTVTITCRASQSITSYLNWYQQKPGKAPKLLIY 94 light ATSSLQSGLPSRFSGSGYGTEFTLTISGLQPEDFATYYCQQSYSFPRTF GQGTKVEMD 3I21 QVQLVQSGGGLVQPGRSLRLSCATSGFIFDDYAMYWVRQAPGKGLEWVS 95 heavy GISWNSGNIAYADSVKGRFTISRDNAKNSLYLEMNSLRAEDTALYYCVK DLYGYDILTGNGYDYWGQGTLVTVSS 3I21 QAVVTQSSLSLPVTPGEPASISCRSSQSLLQSNGYNYLDWYLQKPGQSP 96 light QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQ TPPTFGQGTKVEIK 3K11 QVQLVQSGAEVKKPGSSVKVPCKASGDTLSYYGITWVRRAPGQGLEWMG 97 heavy QIIPFFATTISAQKFQGRLTMTAEESTSTGYMERTFYMDLSSLRPEDTA VYYCAGGYYGSGSSGDYGLDVWGQGTLVTVSS 3K11 QAVVTQPPS.VSGAPGQRVTISCIGSSSNIGAGYDVNWYQQLPGTAPKL 98 light LIYGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSL SGSGVFGTGTEVTVL 4B8 QVQLVQSGPGLVKPSETLSLTCAVSGDSIGSRSFYWGWIRQPPGKGLEW 99 heavy IGSIYYNGTTYYKPSLKSRVTISLDTSKNQFSLRLSSLTATDTGVYYCA RAPTYCSPSSCAVHWYFNLWGRGTLVTVSS 4B10 QVQLVQSGAELKKPGASVKVSCKASGYIFTKYGISWLRQAPGQGLEWVG 100 heavy WISAYNENTNYAEKFQGRVILTTDASTSTAYMELRNLRSDDTAVYFCAR EVWFAEYIYWGQGTLVTVSS 9A11 QSVVTQPASVSGSPGQSITISCTGTSSDVGAYNYVSWYQQHPGKAPKLV 101 light IYDVANRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCGSYTSDVS PVFSGGTKLTVL 9D14 QVQLVQSGSELKKPGASVKLSCKASGYTFTSHPMNWVRQAPGQGLEWMG 102 heavy WINTKIGNLTYAQGFTGRFVFSLDTSVRTAYLQISGLKAEDTAIYYCAR DEYSGYDSVGVFRGSFDDFYGMDVWGQGTLVTVSS
TABLE-US-00004 TABLE3 CDRHEAVYCHAINSEQUENCES Anti- CDRH1 CDRH2 CDRH3 body (SEQIDNO:) (SEQIDNO:) (SEQIDNO:) 1H12 GYSFTSYG ISTYKGYT ARVLSETGYFYY (103) (104) YYYGMDV (105) 2B4 GYSFTSYS IDTNTGNP ATYYVDLWGSYR (106) (107) QDYYGMDV (108) 2H1 GYTFTSYG ISTYNGDT ARDFEFPGDCSG (109) (110) GSCYSRFIYQHN DMDV (111) 3E23 SDALRSRSYY VSYSGGT ARSYFYDGSGYY (112) (113) YLSYFDS (114) 3N23 GFTFSNYA IWYDGSNK ARGDYVLDY (115) (116) (117) 4J14 GGTSSTYA SIPVFATV ASPYCSSMNCYT (118) (119) TFYYFDF (120) 4J21 GYSFTSYS IDTNTGNP ATYYVDLWGSYR (121) (122) QDYYGMDV (123) 4N12 GYILSKLS SEREDGET ATGGFWSMIGGN (124) (125) GVDY (126) 5M16 GYTFTSYF TYPGGGSP ARGAHRSIGTTP (127) (128) LDS (129) 5O14 GFTFSMYG IWNDGSKE ARDGIPDPERGD (130) (131) YGGLDY (132) 8G18 GGTFNNNG IVPNFGTP ARGRTAVTPMQL (133) (134) GLQFYFDF (135) 1I9 GYTFTDNS INPNTGVS AREENDSSGYYL (136) (137) (138) 1L1 GFSLSISGVG IYWDDDK AHSMTKGGAIYG (139) (140) QAYFEY (141) 1M9 GYTLTELS FEPEDGET TTDQVYYRSGSY (142) (143) SGYVDY (144) 1O5 GRTFSSYV IIPLFGTA ARGAQLYYNDGS (145) (146) GYIFDY (147) 1O6 GFSFISSA IVVASANT AAEHRSPCSGGD (148) (149) SCYSLYYGMDV (150) 2A2 GFTVSNYG ISTSSGRT AKGPFGGDFDY (151) (152) (153) 2C2 GFTFDVYA ISWNSGSV AKAFWFGELSGY (154) (155) GMDV (156) 2D12 GYSFNIYG ISAYNGNT ARPLWGEFYYDI (157) (158) (159) 3A2 GFTFSNYV ISYDGSNK ARSEWESSYGSG (160) (161) NYYTDYFYYYAM DV (162) 3B4 GFSLTTTGVT IYWDDDK AHSTGYYDSSGY (163) (164) RGALDAFAV (165) 3E23 SDALRSRSYY VSYSGGT ARSYFYDGSGYY (166) (167) YLSYFDS (168) 3H5 GFTFRMYG IFNDGVKK ARDGIPDPERGD (169) (170) YGGLDY (171) 3I21 GFIFDDYA ISWNSGNI VKDLYGYDILTG (172) (173) NGYDY (174) 3K11 GDTLSYYG IIPFFATT TAVYYCAGGYYG (175) (176) SGSSGDYGLDV (177) 4B8 GDSIGSRSFY IYYNGTT ARAPTYCSPSSC (178) (179) AVHWYFNL (180) 4B10 GYIFTKYG ISAYNENT AREVWFAEYIY (181) (182) (183) 9D14 GYTFTSHP INTKTGNL ARDEYSGYDSVG (184) (185) VFRGSFDDFYGM DV (186)
TABLE-US-00005 TABLE4 CDRLIGHTCHAINSEQUENCES Anti- CDRL1 CDRL2 CDRL3 body (SEQIDNO:) (SEQIDNO:) (SEQIDNO:) 1H12 SSNIGADYN GNT QSYDSSLSASV (187) (188) (189) 2B4 SSNIGSNP TNN AVWDDSLSGRWV (190) (191) (192) 2H1 SSNIGNHY DNY GTWDSSLSAVV (193) (194) (195) 3E23 TGAVTSGHY STD LLHFGGVVV (196) (197) (198) 3N23 QSIPSY ATS QQSYNTGIFT (199) (200) (201) 4J14 SSDFGTYNY DVS SSYTSGSTLYGGG (202) (203) (204) 4J21 SSNIGSNP TNN AVWDDSLSGRWV (205) (206) (207) 4N12 QDIRNN GTS LQHNSYPPT (208) (209) (210) 5O14 QSISSY ATS QQSYSFPRT (211) (212) (213) 8G18 SGAVTSDYY SAS LVYSGDGVV (214) (215) (216) 1I9 QSISTY AAS QQSYRTPWT (217) (218) (219) 1L1 DSDVGGYNY DVT SSYTSSSTLV (220) (221) (222) 2A2 QSVAIY DAS QQRGNWQYT (223) (224) (225) 2C2 SSDVGSYNY AVT TSYAGNNKDV (226) (227) (228) 2D12 QSVSSGY GAS QLFATSPPP (229) (230) (231) 3A2 QSLLRGIRYNY LGS MQALQTPTT (232) (233) (234) 3B4 QSVLYHSNNKNY WAS QQYYSTPYT (235) (236) (237) 3E23 TGAVTSGHY STD LLHFGGVVV (238) (239) (240) 3H5 QSITSY ATS QQSYSFPRT (241) (242) (243) 3I21 QSLLQSNGYNY LGS MQALQTPPT (244) (245) (246) 3K11 SSNIGAGYD GNN QSYDSSLSGSGV (247) (248) (249) 9A11 SSDVGAYNY DVA GSYTSDVSPV (250) (251) (252)
TABLE-US-00006 TABLE 5 CHARACTERISTICS OF CHIKUNGUNYA VIRUS- SPECIFIC HUMAN MONOCLONAL ANTIBODIES ELISA Neutralization binding against CHIKV VRP IgG / to E2 (strain SL15649).sup.4 sub- light ectodomain EC.sub.50 in ng/mL.sup.5 mAb.sup.1 class.sup.2 chain.sup.2 (10 g/mL).sup.3 [95% confidence interval] 2H1 IgG2 ++ 8 [6-10] 4N12 IgG2 8 [7-10] 2B4 IgG1 ++ 14 [11-17] 4J21 IgG1 ++ 5 [4-6] 5M16 IgG1 +++ 5 [4-6] 9D14 IgG1 +++ 6 [5-7] 1H12 IgG1 +++ 17 [14-20] 8E22 IgG1 ++ 17 [14-19] 8G18 IgG1 ++ 17 [14-19] 10N24 IgG1 21 [17-26] 8I4 IgG1 +++ 8 [5-14] 3N23 IgG1 25 [21-30] 5O14 IgG1 +++ 38 [30-47] 4J14 IgG1 ++ 23 [20-26] 3E23 IgG2 11 [9-13] 1L1 IgG1 +/ 18 [15-22] 3B4 IgG3 > 4B8 IgG1 +++ 0.6 [0.4-0.8] 4G20 IgG1 95 [60-160] 1O5 IgG1 138 [110-170] 1O6 IgG3 5,200 [4,100-6,600] 2L5 NT NT 4,600 [2,400-9,500] 3A2 IgG1 +++ 1,300 [830-1,900] 5F19 IgG1 +++ > 1M9 IgG1 > 1I9 IgG1 > 4B10 IgG1 > 2C2 IgG1 > 2D12 IgG1 > 5N23 IgG1 +++ > murine IgG2c 3 [2-4] CHK-152 .sup.1Order of antibodies reflects the level of potency degree and breadth of the antibodies in neutralization assays against clinical CHIKV isolates of diverse genotypes. .sup.2Immunoglobulin isotype, subtype, and light chain use were determined by ELISA. NT indicates not tested due to poor growth of B cell line. .sup.3() denotes no detectable binding [OD < 0.1]; (+/) denotes weak binding [OD 0.31-0.499]; (++) denotes moderate binding [OD 0.5-0.99]; (+++) denotes strong binding [OD > 1.0]. .sup.4Values shown represent combined data from two or more independent experiments. .sup.5Concentration (ng/mL) at which 50% of virus was neutralized (EC.sub.50). (>) indicates EC.sub.50 value is greater than the highest mAb concentration tested (10 g/ml). N.D. = Not Done.
TABLE-US-00007 TABLE 6 MAJOR ANTIGENIC SITES OF CHIKUNGUNYA VIRUS- SPECIFIC HUMAN MONOCLONAL ANTIBODIES Mutagenesis mapping Competition E2 residues for binding group which reduced for purified E2 binding was noted mAb.sup.1 E2 protein.sup.2 Domain.sup.3 when altered to alanine 2H1 Low binding E2-DA R80, T116 4N12 NT Arch D250 2B4 Low binding NoReduct ## 4J21 Low binding NoReduct 5M16 2 Arch G253 9D14 2 NoReduct 1H12 1/2 DA/B, Arch T58, D59, D60, R68, D71, I74, D77, T191, N193, K234 8E22 Low binding DA, Arch H62, W64, R68, H99, D117, I255 8G18 Low binding DA H62, W64, D117 10N24 NT DA, B W64, D71, R80, T116, D117, I121, N187, I190 8I4 NSF Ab DB, Arch M171, Q184, I190, N193, V197, R198, Y199, G209, L210, K215, K234, V242, I255 3N23 NT DA, Arch D60, R68, G98, H170, M171, K233, K234 5O14 2 NoReduct 4J14 Low binding DA/B D63, W64, T65, R80, I121, A162, N193 3E23 NT DA W64 1L1 Low binding Arch G253 3B4 NT DB V192, Q195 4B8 2 NoReduct 4G20 NT DB D174, R198, Y199, K215 1O5 NT DA W64, T65 1O6 2 DA R80 2L5 NT NoReduct 3A2 3 DB I190, R198, Y199, G209, L210, T212 5F19 4 DA H18 1M9 NT DA, Arch R36, H62, R80, Q146, E165, E166, N231, D250, H256 1I9 NT E2 Inconclusive 4B10 NT NoReduct 2C2 NT NoReduct Inconclusive 2D12 NT E2 Inconclusive 5N23 1 DA, Arch E24, D117, I121 murine NT E2-DA, E2-DB D59, W235, A11, M74, CHK-152 G194, N193, T212, H232.sup.4 .sup.1Order of antibodies reflects the level of potency degree and breadth of the antibodies in neutralization assays against clinical CHIKV isolates of diverse genotypes. .sup.2Values shown represent combined data from two independent experiments. Low binding indicates incomplete mAb binding to E2 on biosensor for assessing competition. NT indicates not tested since Ab did not bind E2 ectodomain in ELISA; NSF Ab indicates insufficient supply of mAb. .sup.3NotReact indicates that the mAb did not react against the wild-type envelope proteins and could not be tested in this system. NoReduct indicates the mAb did bind to the wild-type E proteins, but no reduction was noted reproducibly for any mutant. DA indicates domain A; DB indicates domain B; Arch indicates either arch 1, arch 2, or both. .sup.4Residues identified by contacts with mAb in a previous cryo-EM reconstruction.
TABLE-US-00008 TABLE 7 IN VITRO NEUTRALIZING POTENCY AND BREADTH OF CHIKUNGUNYA VIRUS-SPECIFIC HUMAN MONOCLONAL ANTIBODIES Neutralization against CHKV against indicated genotype and strain* EC.sub.50, ng/mL.sup.2 (95% confidence interval) West African genotype ECSA genotype Asian genotype NI 64 IbH 35 LR2006 OPY1 2014 Caribbean mAb.sup.1 strain (LR) strain RSUI strain 99659 strain 2H1 3.7 (3.3-4.3) 5.6 (4.9-6.3) 5.9 (5.3-6.7) 5.5 (4.7-6.5) 4N12 2.5 (2.0-3.1) 4.0 (3.3-5.0) 6.5 (5.7-7.3) 7.3 (5.9-9.2) 2B4 3.2 (2.8-3.7) 5.6 (4.6-6.7) 6.5 (5.6-7.7) 7.0 (6.0-8.2) 4J21 5.2 (4.3-6.4) 7.4 (6.6-8.3) 7.7 (7.0-8.6) 7.2 (5.3-9.8) 5M16 6.0 (5.5-6.6) 5.9 (5.0-6.8) 8.4 (6.7-10.4) 11.7 (9.7-14.1) 9D14 2.1 (1.6-2.7) 2.9 (2.3-3.7) 6.3 (4.7-8.4) 86.0 (31.5-235) 1H12 3.0 (2.5-3.5) 7.5 (6.7-8.4) 11.7 (9.3-14.8) 11.6 (8.2-16.2) 8E22 8.2 (7.0-9.7) 7.2 (6.4-8.3) 42.5 (30.8-58.5) 138.9 (64.7-298) 8G18 4.7 (4.1-5.3) 7.3 (6.3-8.4) 34.9 (24.9-48.9) 52.4 (24.1-114) 10N24 7.9 (6.9-9.0) 9.5 (8.2-11.0) 15.9 (13.2-19.2) 23.6 (18.3-30.5) 8I4 6.9 (3.8-12.3) 6.2 (4.5-8.4) 153 (78-299) > 3N23 6.0 (5.0-7.2) 10.1 (8.9-11.5) 14.1 (11.6-17.1) 8.7 (7.0-10.9) 5O14 6.7 (5.5-8.3) 12.1 (10.9-13.5) 17.3 (14.2-21.1) 6.2 (5.3-7.2) 4J14 12.9 (11.2-15.0) 17.7 (16.1-19.4) 23.1 (20-27) 23.0 (18.5-28.4) 3E23 19.4 (15.2-25.0) 18.7 (16.3-21.5) 36.0 (30.3-42.9) 38.0 (30.3-47.5) 1L1 18.6 (15.5-22.4) 24.2 (21.3-27.5) 34.3 (29-40.7) N.D. 3B4 18.7 (10.7-32.8) 29.6 (18.7-46.8) 271 (144-511) N.D. 4B8 22.8 (12.4-41.8) 28.1 (19.8-39.9) 234 (142-386) N.D. 4G20 22.3 (17.3-29.0) 34.9 (28.2-43.8) 131.4 (88.5-195) N.D. 1O5 30.1 (22.6-35.3) 37.6 (32.6-43.4) 48.9 (37.8-63.2) N.D. 1O6 61.7 (50.8-74.8) 57.5 (48.8-68.1) N.D. N.D. 2L5 1,076 (748-1,548) 2,361 (1,460-3,819) 5,632 (3,904-8,128) N.D. 3A2 1,566 (1,111-2,207) 1,396 (952-2,046) > N.D. 5F19 > 9,064 (2,911-28,249) > N.D. 1M9 > > 6,187 (2,795-13,709) N.D. 1I9 > > > N.D. 4B10 > > > N.D. 2C2 > > > N.D. 2D12 > > > N.D. 5N23 > > > N.D. murine CHK-152 .sup.1Order of antibodies reflects the level of potency degree and breadth of the antibodies in neutralization assays against clinical CHIKV isolates of diverse genotypes. .sup.2Concentration (ng/mL) at which 50% of virus was neutralized (EC.sub.50). (>) indicates EC.sub.50 value is greater than the highest mAb concentration tested (10 g/ml). N.D. = Not Done.
[0271] All of the compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this disclosure have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the disclosure as defined by the appended claims.
VII. REFERENCES
[0272] The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. [0273] Antibodies: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988. [0274] Abbondanzo et al., Am. J. Pediatr. Hematol. Oncol., 12(4), 480-489, 1990. [0275] Allred et al., Arch. Surg., 125(1), 107-113, 1990. [0276] Atherton et al., Biol. of Reproduction, 32, 155-171, 1985. [0277] Austin et al., PLoS Pathog 8, e1002930, 2012. [0278] Brehin, et al., Virology 371:185-195, 2008. [0279] Brown et al., J. Immunol. Meth., 12; 130(1):111-121, 1990. [0280] Campbell, In: Monoclonal Antibody Technology, Laboratory Techniques in Biochemistry and Molecular Biology, Vol. 13, Burden and Von Knippenberg, Eds. pp. 75-83, [0281] Amsterdam, Elsevier, 1984. [0282] Capaldi et al., Biochem. Biophys. Res. Comm., 74(2):425-433, 1977. [0283] CDC, Chikungunya in the Americas. (Atlanta, Ga.: US Department of Health and Human Services). world-wide-web at cdc.gov/chikungunya/geo/americas.html, 2014. [0284] CDC, Chikungunya virus (Atlanta, Ga.: US Department of Health and Human Services). world-wide-web at cdc.gov/media/releases/2013/p1218-chikungunyas.html, 2013. [0285] Christian et al., Proc Natl Acad Sci USA, 110:18662-18667, 2013. [0286] Chu et al., Deciphering the protective role of adaptive immunity to CHIKV/IRES a novel candidate vaccine against Chikungunya in the A129 mouse model. Vaccine 31:3353-3360, 2013. [0287] Couderc et al., J. Infect. Dis. 200, 516-523, 2009. [0288] De Jager et al., Semin. Nucl. Med. 23(2), 165-179, 1993. [0289] Dholakia et al., J. Biol. Chem., 264, 20638-20642, 1989. [0290] Doolittle and Ben-Zeev, Methods Mol. Biol., 109:215-237, 1999. [0291] Edwards & Brown, J. Gen. Virol. 67 (Pt 2), 377-380, 1986. [0292] Edwards et al., J. Gen. Virol. 67 (Pt 2), 377-380, 1986. [0293] Fong et al., J. Virol. 88:14364-14379, 2014. [0294] Fric et al., J. Infect. Dis. 207:319-322, 2013. [0295] Gefter et al., Somatic Cell Genet., 3:231-236, 1977. [0296] Goh et al., Clin. Immunol. 149:487-497, 2013. [0297] Gulbis and Galand, Hum. Pathol. 24(12), 1271-1285, 1993. [0298] Guo et al., Sci. Transl. Med. 3:99 ra85, 2001. [0299] Hallengard, et al., J. Virol. 88:13333-13343, 2014. [0300] Hawman et al., J. Virol. 87, 13878-13888, 2013. [0301] Hong et al., J. Virol. 87:12471-12480, 2013. [0302] Kam et al., EMBO Mol. Med. 4, 330-343, 2012b. [0303] Kam et al., J. Virol. 86, 13005-13015, 2012a. [0304] Kam et al., PLoS One 9, e95647, 2014. [0305] Khatoon et al., Ann. of Neurology, 26, 210-219, 1989. [0306] Kielian et al., Viruses 2:796-825, 2010. [0307] King et al., J. Biol. Chem., 269, 10210-10218, 1989. [0308] Kohler and Milstein, Eur. J. Immunol., 6, 511-519, 1976. [0309] Kohler and Milstein, Nature, 256, 495-497, 1975. [0310] Krause et al., J. Immunol. 187:3704-3711, 2011b. [0311] Krause et al., J. Virol. 84:3127-3130, 2010. [0312] Krause et al., J. Virol. 85:10905-10908, 2011a. [0313] Krause et al., J. Virol. 86:6334-6340, 2012. [0314] Kyte and Doolittle, J. Mol. Biol., 157(1):105-132, 1982. [0315] Lanciotti & Valadere, Emerg Infect Dis 20, 2014. [0316] Lee et al., PLoS Pathog. 7:e1002390, 2011. [0317] Levitt et al., Vaccine 4, 157-162, 1986. [0318] Lum et al., J. Immunol. 190:6295-6302, 2013. [0319] Mainou et al., MBio 4, 2013. [0320] Masrinoul et al., Virology 464-465, 111-117, 2014. [0321] Messer et al., Proc. Natl. Acad. Sci. U.S.A 111:1939-1944, 2014. [0322] Morrison et al., Am J Pathol, 178:32-40, 2011. [0323] Nakamura et al., In: Enzyme Immunoassays: Heterogeneous and Homogeneous Systems, [0324] Chapter 27, 1987. [0325] O'Shannessy et al., J. Immun. Meth., 99, 153-161, 1987. [0326] Paes et al., J. Am. Chem. Soc., 131:6952-6954, 2009. [0327] Pal et al., J. Virol. 88:8213-8226, 2014. [0328] Pal et al., PLoS Pathog 9, e1003312, 2013. [0329] Persic et al., Gene 187:1, 1997 [0330] Potter and Haley, Meth. Enzymol., 91, 613-633, 1983. [0331] Remington's Pharmaceutical Sciences, 15th Ed., 3:624-652, 1990. [0332] R.C. Team, R Foundation for Statistical Computing, Vienna, Austria, 2014. [0333] Schilte et al., PLoS Negl. Trop. Dis. 7:e2137, 2013. [0334] Selvarajah et al., PLoS Negl. Trop. Dis. 7:e2423, 2013. [0335] Sissoko et al., PLoS Negl. Trop. Dis. 3:e389, 2009. [0336] Smith et al., J. Virol. 86, 2665-2675, 2012. [0337] Smith et al., J. Virol. 88, 12233-12241, 2014. [0338] Smith et al., J. Virol., 86:2665-2675, 2012. [0339] Smith et al., MBio 4, e00873-00813, 2013a. [0340] Smith et al., J. Infect. Dis. 207, 1898-1908, 2013b. [0341] Staples et al., Clin. Infect. Dis., 49, 942-948, 2009. [0342] Sun et al., Elife, 2:e00435, 2013. [0343] Sun et al., J. Steroid Biochem., 26(1):83-92, 1987. [0344] Sun et al., J. Virol., 88:2035-2046, 2014. [0345] Tang et al., J. Biol. Chem., 271:28324-28330, 1996. [0346] Thornburg et al., J. Clin. Invest., 123:4405-4409, 2013. [0347] U.S. Pat. No. 3,817,837 [0348] U.S. Pat. No. 3,850,752 [0349] U.S. Pat. No. 3,939,350 [0350] U.S. Pat. No. 3,996,345 [0351] U.S. Pat. No. 4,196,265 [0352] U.S. Pat. No. 4,275,149 [0353] U.S. Pat. No. 4,277,437 [0354] U.S. Pat. No. 4,366,241 [0355] U.S. Pat. No. 4,472,509 [0356] U.S. Pat. No. 4,554,101 [0357] U.S. Pat. No. 4,680,338 [0358] U.S. Pat. No. 4,816,567 [0359] U.S. Pat. No. 4,867,973 [0360] U.S. Pat. No. 4,938,948 [0361] U.S. Pat. No. 5,021,236 [0362] U.S. Pat. No. 5,141,648 [0363] U.S. Pat. No. 5,196,066 [0364] U.S. Pat. No. 5,563,250 [0365] U.S. Pat. No. 5,565,332 [0366] U.S. Pat. No. 5,856,456 [0367] U.S. Pat. No. 5,880,270 [0368] Vander Veen et al., Anim Health Res Rev, 13:1-9, 2012. [0369] Voss et al., Nature, 468:709-712, 2010. [0370] Voss et al., Nature, 468:709-712, 2010. [0371] Wailer et al., J. Immunol., 186:3258-3264, 2011. [0372] Wailer et al., J. Immunol., 186:3258-3264, 2011. [0373] Wawrzynczak & Thorpe, In: Immunoconjugates, Antibody Conjugates In Radioimaging And Therapy Of Cancer, Vogel (Ed.), NY, Oxford University Press, 28, 1987. [0374] Yu et al., Nature 455:532-536, 2008.