Methods for diagnosis and treatment of concussion or brain injury
09921230 ยท 2018-03-20
Assignee
Inventors
Cpc classification
International classification
Abstract
This invention relates to compositions and methods for diagnosing and treating concussion/mTBI.
Claims
1. A method for identifying concussion or traumatic brain injury in a subject, comprising (1) providing a plasma sample from a subject suspected to comprise a concussion or traumatic brain injury; (2) performing a reaction in vitro by contacting said plasma sample with an antibody to yield a complex comprising said antibody and a protein selected from the group consisting of copeptin, matrix metallopeptidase 9 (MMP9), lectin, galactose binding, soluble 3 (LGALS3), and occludin (OCLN), wherein said antibody comprises a plurality of antibodies comprising a first antibody that binds to copeptin, a second antibody that binds to MMP9, a third antibody that binds to LGALS3, and a fourth antibody that binds to OCLN; (3) detecting said complex, wherein a decrease in the level of said complex comprising copeptin compared to a normal control and an increase in the level of said complex comprising MMP9, LGALS3, or OCLN compared to a normal control indicates concussion or traumatic brain injury in said subject wherein said subject has a Glasgow Coma Scale (GCS) score of 13-15.
2. The method of claim 1, wherein said plasma sample is derived from said subject within about 0.1 to about 8 hours of a head injury.
3. The method of claim 1, wherein said antibody comprises a polyclonal antibody or a monoclonal antibody.
4. The method of claim 1, wherein said antibody is bound to a solid support.
5. The method of claim 4, wherein said solid support comprises a strip, a glass, a silicon, a polymer, a bead, or a nanoparticle.
6. The method of claim 1, wherein said complex is identified by a detectable moiety.
7. The method of claim 6, wherein said detectable moiety comprises a fluorescent marker selected from the group consisting of fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, p-phthaldehyde and fluorescamine, and 152 Eu; or wherein the detectable moiety comprises a chemiluminescent compound selected from the group consisting of luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
8. The method of claim 1, wherein said traumatic brain injury comprises isolated traumatic brain injury.
9. The method of claim 1, wherein said plasma sample is derived from said subject within about 1 to 8 hours of a head injury.
10. The method of claim 1, wherein said plasma sample is derived from said subject within about 12 hours of a head injury.
11. The method of claim 1, wherein said plasma sample is derived from said subject within about 24 hours of a head injury.
12. A method for identifying concussion or traumatic brain injury in a subject, comprising (1) providing a plasma sample from a subject suspected of comprising a concussion or traumatic brain injury; (2) performing a reaction in vitro by contacting said plasma sample with an antibody to yield a complex comprising said antibody and a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN, wherein said antibody comprises a plurality of antibodies comprising antibodies for at least three of said proteins; and (3) detecting said complex, wherein a decrease in the level of said complex comprising copeptin compared to a normal control or an increase in the level of said complex comprising MMP9, LGALS3, or OCLN compared to a normal control indicates concussion or traumatic brain injury in said subject wherein said subject has a Glasgow Coma Scale (GCS) score of 13-15.
13. A method of treating concussion or mild traumatic brain injury (mTBI), comprising: (1) providing a test sample from a subject, wherein said test sample comprises a bodily fluid; (2) performing a reaction in vitro by contacting said test sample with a binding agent to yield a complex comprising said binding agent and a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN; (3) detecting said complex; wherein a decrease in the level of said complex comprising copeptin compared to a normal control and an increase in the level of said complex comprising MMP9, LGALS3, or OCLN compared to a normal control indicates concussion or traumatic brain injury in said subject wherein said subject has a Glasgow Coma Scale (GCS) score of 13-15; (4) administering to said subject a therapeutically effective amount of a compound that modulates the activity or level of said complex, thereby treating said subject.
14. The method of claim 13, wherein said compound comprises a MMP9 selective inhibitor.
15. The method of claim 14, wherein said MMP9 selective inhibitor comprises 2-[[(4-phenoxyphenyl)sulfonyl]methyl]-Thiirane (SB-3CT) prodrug or a pharmaceutically acceptable salt, ester, metabolite, polymorph or solvate thereof.
16. The method of claim 13, wherein said compound comprises an LGALS3 selective inhibitor.
17. The method of claim 16, wherein said LGALS3 selective inhibitor comprises N-acetyllactosamine, a glycomimetic compound, or a pharmaceutically acceptable salt, ester, prodrug, metabolite, polymorph or solvate thereof.
18. A method of treating concussion or traumatic brain injury in a subject, comprising administrating to said subject a therapeutically effective amount of an LGALS3 selective inhibitor.
19. A method for identifying concussion or traumatic brain injury in a subject, comprising (1) providing a test sample from said subject, wherein said test sample comprises a bodily fluid; (2) performing a reaction in vitro by contacting said test sample with a binding agent to yield a complex comprising said binding agent and a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN, wherein said binding agent comprises a plurality of binding agents comprising a first binding agent that binds to copeptin, a second binding agent that binds to MMP9, a third binding agent that binds to LGALS3, and a fourth binding agent that binds to OCLN; (3) detecting said complex, wherein a decrease in the level of said complex comprising copeptin compared to a normal control and an increase in the level of said complex comprising MMP9, LGALS3, or OCLN compared to a normal control indicates concussion or traumatic brain injury in said subject, wherein said subject has a Glasgow Coma Scale (GCS) score of 13-15 and wherein said method further comprising administering to the subject a therapeutically effective amount of a MMP9 selective inhibitor or an LGALS3 selective inhibitor.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
DETAILED DESCRIPTION
(5) The invention described herein addresses the failure to date of any routine tests to objectively, quickly and accurately diagnose mild traumatic brain injury (mTBI)/concussion. Mild TBI (also known as concussion or minor brain injury or minor head injury or isolated concussion) is the most prevalent TBI (as demonstrated in Table 4), and it is often missed at time of initial injury. 15% of people with mild TBI have symptoms that last one year or more. Mild TBI is defined as the result of the forceful motion of the head or impact causing a brief change in mental status (confusion, disorientation or loss of memory) or loss of consciousness for less than 30 minutes. Common symptoms of mTBI include: fatigue, headaches, visual disturbances, memory loss, poor attention, sleep disturbances, dizziness, loss of balance, irritability-emotional disturbances, feelings of depression, seizure, nausea, loss of smell, sensitivity to light and sounds, mood changes, getting lost or confused, and slowness in thinking.
(6) Unlike previously reported tests, which utilized proteins released from damaged neurons or glia (their expression levels are low and/or the assays used for their detection are complicated), the diagnostic test described herein for concussion/mTBI was developed based on a unique combination of plasma biomarkers with high accuracy. Surprisingly, such high accuracy is not affected by underlying disease that the subject is suffering from (such as asthma, heart disease, hypertension, etc.), further demonstrating the great specificity and sensitivity of these biomarkers in identifying mTBI. Blood plasma is a non-naturally occurring processed sample derived from blood, e.g., obtained by venipuncture, and is usually prepared by spinning a tube of fresh blood containing an anticoagulant in a centrifuge until the blood cells fall to the bottom of the tube. The blood plasma is then poured or drawn off.
(7) Standard protocols are used to prepare a plasma sample. An illustrative protocol is described herein: collecting whole blood into commercially available anticoagulant-treated tubes e.g., EDTA-treated (lavender tops) or citrate-treated (light blue tops); and removing cells by centrifugation for 10 minutes at 1,000-2,000g using a refrigerated centrifuge. Centrifugation for 15 minutes at 2,000g depletes platelets in the plasma sample. The resulting supernatant is designated plasma. Following centrifugation, it is important to immediately transfer the liquid component (plasma) into a clean polypropylene tube using a Pasteur pipette. The samples should be maintained at 2-8 C. while handling. If the plasma is not analyzed immediately, the plasma should be apportioned into 0.5 ml aliquots, stored, and transported at 20 C. or lower. It is important to avoid freeze-thaw cycles. Samples which are hemolyzed, icteric, or lipemic can invalidate certain tests.
(8) The compositions and methods described herein utilize a unique combination of plasma biomarkers and binding agents to detect those biomarkers, and biomarker/binding agent complexes that allow for the diagnosis of concussion. Synthesis of key proteins (copeptin, MMP9, LGALS3, and OCLN) is altered in response to mTBI. This alteration results in changes in blood levels of these proteins, which are detectable using a variety of assays. At least two of the biomarkers are useful as targets for therapeutic intervention in mTBI. The approach described herein is diametrically different from traditional approach of identifying blood biomarkers for mTBI, which focuses on central nervous system (CNS)-derived proteins released by damaged brain cells.
(9) The compositions and methods described herein constitute a combination of biomarkers, which includes, but is not limited to, four families of proteins: copeptin, galectin 3 (encoded by gene lectin, galactoside-binding, soluble, 3 (LGALS3)), matrix metalloproteinase 9 (MMP9), occludin (OCLN), and any combination thereof. The panel of these markers discriminates patients with mTBI from uninjured subjects. In 90% of mTBI patients, the plasma levels of at least two biomarkers are changed beyond the cutoff values, whereas 0% of uninjured controls have the plasma levels of two biomarkers changed. Furthermore, since in mTBI patients there is a positive correlation between two of these biomarkers (OCLN and LGALS3), these biomarkers permit a definite diagnosis of suspected concussion in the presence of orthopedic injuries (OI).
(10) Accordingly, provided herein is a method for identifying concussion or traumatic brain injury (e.g., mTBI or isolated concussion) in a subject. The method includes steps of (1) providing a test sample from a subject, where the sample includes a bodily fluid; (2) performing a reaction in vitro by contacting the test sample with a binding agent to yield a complex including the binding agent and a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN; and (3) detecting the complex. A decrease in the level of the complex including copeptin compared to a normal control or an increase in the level of the complex including MMP9, LGALS3, or OCLN compared to a normal control indicates concussion or traumatic brain injury in the subject.
(11) Two of the biomarkers described herein (MMP9 and LGALS3) also represent clinical targets, e.g., inhibition of MMP9 and LGALS3 leads to clinical improvement of a subject having been diagnosed with concussion.
(12) The invention here also provides at least two (2, 3, or 4) biomarker selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN for use in a method of diagnosing concussion or traumatic brain injury.
(13) In any method and use described herein, 2, 3, or 4 biomarkers can be detected. For example, at least two biomarkers selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN are detected (combinations include:
(14) copeptin and MMP9;
(15) copeptin and LGALS3;
(16) copeptin and OCLN;
(17) MMP9 and LGALS3;
(18) MMP9 and OCLN; or
(19) LGALS3 and OCLN).
(20) For example, at least three biomarkers selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN are detected for the methods (combinations include: copeptin, MMP9, and LGALS3; or copeptin, MMP9, OCLN; or MMP9, LGALS3, and OCLN).
(21) For example, all four biomarkers are detected for the methods and uses described herein.
(22) Biomarkers
(23) Copeptin
(24) Copeptin is a 39-amino acid peptide, which is a part of vasopressin prepro-hormone. Unlike vasopressin, this peptide is stable in plasma and is detected using ligands such as commercially available antibodies. In healthy individuals, the plasma levels of copeptin range between 1 and 12 pmol/L. Copeptin has been used as a diagnostic and prognostic marker for risk stratification in a variety of clinical situations, including myocardial infarction and heart failure, obstructive pulmonary disease, hemorrhagic and septic shock and stroke. In patients with severe TBI, the copeptin levels in plasma are significantly elevated and are strongly correlated with poor clinical outcome. In animals, vasopressin was found to play a critical role in the development and progression of secondary injury in severe TBI, consequently augmenting the loss of neural tissue. Plasma levels of copeptin in concussed patients were significantly lower than those observed in uninjured controls (
(25) The sequence of human copeptin provided below and is available on NCBI Accession No. NP_000481.2 GI:13259533.
(26) TABLE-US-00001 (SEQIDNO:1) 1 mpdtmlpacflgllafssacyfqncprggkramsdlelrqclpcgpggkgrcfgpsicca 61 delgcfvgtaealrcqeenylpspcqsgqkacgsggrcaafgvccndescvtepecregf 121 hrrarasdrsnatqldgpagalllrlvglagapepfepaqpday
(27) Exemplary regions or fragments of copeptin include residues 1-19 (signal peptide), residues 20-28; residues 32-124; residues 126-164; residues 39-116; and residues 20-164.
(28) MMP9
(29) MMP9 belongs to the family of enzymes involved in the breakdown of extracellular matrix. MMP9 has been considered a regulatory protein not only in wound repair and neovascularization, but also in neutrophil migration. This latter MMP9 action is most likely associated with the MMP9-mediated degradation of tight junction (TJ) proteins (e.g., OCLN). MMP9 activation is also associated with increased excitotoxicity, mitochondrial dysfunction, apoptosis, increased inflammatory response and astrogliosis. Selective inhibitors of MMP9 have been tested in several clinical trials unrelated to TBI, demonstrating their ability to reduce inflammation and infiltration of neutrophils and cytotoxic T-cells. The data described herein demonstrate an increase in plasma levels of MMP9 in concussed patients vs. uninjured control subjects (
(30) The sequence of human MMP9 is provided below and available on NCBI Accession No. NP_004985.2 GI:74272287.
(31) TABLE-US-00002 (SEQIDNO:2) 1 mslwqplvlvllvlgccfaaprqrqstivlfpgdlrtnitdrqlaeeylyrygytrvaem 61 rgeskslgpallllqkqlslpetgeldsatlkamrtprcgvpdlgrfqtfegdlkwhhhn 121 itywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgvaehgdgyp 181 fdgkdgllahafppgpgiqgdahfdddelwslgkgvvvptrfgnadgaachfpfifegrs 241 ysacttdgrsdglpwcsttanydtddrfgfcpserlytqdgnadgkpcqfpfifqgqsys 301 acttdgrsdgyrwcattanydrdklfgfcptradstvmggnsagelcvfpftflgkeyst 361 ctsegrgdgrlwcattsnfdsdkkwgfcpdqgyslflvaahefghalgldhssvpealmy 421 pmyrftegpplhkddvngirhlygprpepeprppttttpqptapptvcptgpptvhpser 481 ptagptgppsagptgpptagpstattvplspvddacnvnifdaiaeignqlylfkdgkyw 541 rfsegrgsrpqgpfliadkwpalprkldsvfeerlskklfffsgrqvwvytgasvlgprr 601 ldklglgadvaqvtgalrsgrgkmllfsgrrlwrfdvkaqmvdprsasevdrmfpgvpld 661 thdvfqyrekayfcqdrfywrvssrselnqvdqvgyvtydilqcped
(32) Exemplary regions or fragments of MMP9 include residues 1-19, residues 97-104, residues 107-707, residues 115-444, residues 224-271, residues 282-329, residues 341-388, residues 472-506, residues 514-704, residues 518-563, residues 564-608, residues 610-657, and residues 658-704.
(33) LGALS3
(34) LGALS3 is a -galactoside-binding lectin. When compared with uninjured subjects, the plasma levels of LGALS3 in patients with mTBI are significantly increased (
(35) The sequence of human LGALS3 is provided below and available on NCBI Accession No. CAG33178.1 GI:48145911.
(36) TABLE-US-00003 (SEQIDNO:3) 1 madnfslhdalsgsgnpnpqgwpgawgnqpagaggypgasypgaypgqappgaypgqapp 61 gaypgapgaypgapapgvypgppsgpgaypssggpsatgaypatgpygapagplivpynl 121 plpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrryivcntkldnn 181 wgreergsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisklgisgdi 241 dltsasytmi
(37) Exemplary regions or fragments of LGALS3 include residues 18-105, and residues 117-244.
(38) OCLN
(39) OCLN is a transmembrane protein localized between endothelial cells and is involved in regulating the permeability of blood vessels. The brain blood vessels are known for their tightness and impermeability to blood-borne molecules. This distinct feature of brain blood vessels is called the blood-brain barrier (BBB) and is associated with the presence of TJs between adjacent brain endothelial cells. Changes in the permeability of the Blood Brain Barrier (BBB) have adverse effects on brain function. OCLN is a substrate for MMP9. Both in ischemia and in severe TBI or spinal cord injury, MMP9 degrades OCLN, disrupting TJ complexes and increasing the leakiness of the BBB. This process results in neuroinflammation and neuronal damage. The data described herein demonstrate an increase in plasma levels of OCLN in concussed patients vs. uninjured controls (
(40) The sequence of human OCLN is provided below and available on NCBI Accession No. AAH29886.1 GI:20987418.
(41) TABLE-US-00004 (SEQIDNO:4) 1 mssrplespppyrpdefkpnhyapsndiyggemhvrpmlsqpaysfypedeilhfykwts 61 ppgvirilsmliivmciaifacvastlawdrgygtsllggsvgypyggsgfgsygsgygy 121 gygygygyggytdpraakgfmlamaafcfiaalvifvtsvirsemsrtrryylsviivsa 181 ilgimvfiativyimgvnptaqssgslygsqiyalcnqfytpaatglyvdqysyhycvvd 241 pqeaiaivlgfmiivafaliiffavktrrkmdrydksnilwdkehiydeqppnveewvkn 301 vsagtqdvpsppsdyvervdspmayssngkvndkrfypessykstpvpevvqelpltspv 361 ddfrqpryssggnfetpskrapakgragrskrteqdhyetdyttggescdeleedwirey 421 ppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreeseeymaaade 481 ynrlkqvkgsadykskknhckqlksklshikkmvgdydrqkt
(42) Exemplary regions or fragments of OCLN include residues 55-521, residues 58-263, and residues 420-519.
(43) Protein Release by Dying Brain Cells
(44) Prior research on biomarkers for mTBI/concussion has been focused on proteins released by dying brain cells, such as neurons and glia. In principle, the blood levels of these proteins are expected to reflect the extent of cellular damage in the brain. Based on the data available in the literature, the following proteins have been considered as potential blood biomarkers for mTBI. 1) S100Bthe peripheral sources of S100B have also been identified, raising the concern about its specificity for CNS injury. In addition, the commercially available essays frequently have low sensitivity, which makes it difficult to generate reproducible results. 2) Neuron-specific enolase-NSE-initially thought of as CNS-specific marker has been discovered to be produced by a variety of peripheral cells, including erythrocytes and platelets. This also indicates that the way the blood samples are collected and handled is critical to properly assess NSE levels. 3) Glial fibrillary acidic protein breakdown products GFAP-BP 4) Ubiquitin C-terminal hydrolase L1 UCHL1 5) Calpain-cleaved II-spectrin N-terminal fragment SNTF 6) Total tauit has recently been reported that the plasma levels of total tau could distinguish concussed patients from uninjured controls, though patients with OI were not included in this study.
(45) GFAP-BP and UCHL1 appear to allow for differentiation between mTBI patients, uninjured controls, and the subjects with OI. Nevertheless, some overlap in serum concentrations of these biomarkers in mTBI and OI patients has been reported, raising concern about the claims of their high specificity for mTBI. The major weakness of these biomarkers is that their blood levels are very low, necessitating the employment of detection assays that are highly sensitive, complex, time-consuming, and costly. Therefore, these assays are unlikely to be easily implemented in emergency departments for routine diagnosis of mTBI. Furthermore, unlike our biomarkers, these proteins could not be targeted therapeutically.
(46) Synthesis of Protein Following Brain Injury-Reliable Marker(s) for Identifying Concussion
(47) A unique combination of plasma biomarkers reliably diagnose concussion at an early time point after a potential brain injurious event, e.g., 1, 5, 10, 30, 50, 60 minutes; 1.5, 2, 5, 6, 8, 12, 24, 36, 48 hours; 1.5, 3, 5, 7, 10, 15, 30, 45, 60 days after a potential brain injurious event. Levels of proteins whose synthesis is altered as a consequence of concussion are measured. These biomarkers (copeptin, MMP9, LGALS3, OCLN) are readily detected using standard immunoassays, which are utilized for clinical use. In contrast, in traditional approach, the levels of proteins released by dying brain cells are measured in blood. Because of small neuronal damage associated with concussion/mTBI, the levels of these proteins in peripheral blood are exceedingly low and, therefore, difficult to measure. This represents one of the major obstacles for the implementation of these traditional biomarkers in clinical practice. Unlike proteins released by dying brain cells, markers identified by the data described herein represent targets for therapeutic intervention.
(48) Because the plasma levels of these biomarkers are readily detectable with standard ELISA technique, rapid microfluidic immunoassays are suitable for point-of-care testing in emergency departments or other relevant environments.
(49) Binding Agents for Biomarkers
(50) Binding agents used in the methods described herein can be an antibody or a fragment thereof, a detectable protein or a fragment thereof or a nucleic acid molecule.
(51) As used herein, the term antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, F.sub.ab, F.sub.ab and F.sub.(ab)2 fragments, and an F.sub.ab expression library. By specifically bind or immunoreacts with is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react (i.e., bind) with other polypeptides or binds at much lower affinity (K.sub.d>10.sup.6) with other polypeptides.
(52) The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one light (about 25 kDa) and one heavy chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a J region of about 12 or more amino acids, with the heavy chain also including a D region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ea., 2nd ed. Raven Press, N.Y. (1989)). The variable regions of each light/heavy chain pair form the antibody binding site.
(53) The term monoclonal antibody (MAb) or monoclonal antibody composition, as used herein, refers to a population of antibody molecules that contain only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population. MAbs contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.
(54) In general, antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG.sub.1, IgG.sub.2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.
(55) The term antigen-binding site or binding portion refers to the part of the immunoglobulin molecule that participates in antigen binding. The antigen binding site is formed by amino acid residues of the N-terminal variable (V) regions of the heavy (H) and light (L) chains. Three highly divergent stretches within the V regions of the heavy and light chains, referred to as hypervariable regions, are interposed between more conserved flanking stretches known as framework regions, or FRs. Thus, the term FR refers to amino acid sequences which are naturally found between, and adjacent to, hypervariable regions in immunoglobulins. In an antibody molecule, the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as complementarity-determining regions, or CDRs. The assignment of amino acids to each domain is in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk J. Mol. Biol. 196:901-917 (1987), Chothia et al. Nature 342:878-883 (1989).
(56) As used herein, the term epitope includes any protein determinant capable of specific binding to an immunoglobulin, an scFv, or a T-cell receptor. The term epitope includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. An antibody is said to specifically bind an antigen when the dissociation constant is 1 M; preferably 100 nM and most preferably 10 nM.
(57) Antibodies can be produced according to any method known in the art. For example, monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256:495. In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. The immunizing agent will typically include a full length protein or a fragment thereof. Generally, either peripheral blood lymphocytes (PBLs) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (see pp. 59-103 in Goding (1986) Monoclonal Antibodies: Principles and Practice Academic Press). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
(58) In some examples the antibodies to an epitope for an interested protein as described herein or a fragment thereof are humanized antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab, F(ab)2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al. 1986. Nature 321:522-525; Riechmann et al. 1988. Nature 332:323-329; Presta. 1992. Curr. Op. Struct. Biol. 2:593-596). Humanization can be essentially performed following methods of Winter and co-workers (see, e.g., Jones et al. 1986. Nature 321:522-525; Riechmann et al. 1988. Nature 332:323-327; and Verhoeyen et al. 1988. Science 239:1534-1536), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (e.g., U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
(59) In another examples the antibodies to an epitope of an interested protein as described herein or a fragment thereof are human antibodies. Human antibodies can also be produced using various techniques known in the art, including phage display libraries (Hoogenboom and Winter. 1991. J. Mol. Biol. 227:381-388; Marks et al. 1991. J. Mol. Biol. 222:581-597) or the preparation of human monoclonal antibodies (e.g., Cole et al. 1985. Monoclonal Antibodies and Cancer Therapy Liss; Boerner et al. 1991. J. Immunol. 147(1):86-95). Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in most respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, e.g., in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al. 1992. Bio/Technology 10:779-783; Lonberg et al. 1994. Nature 368:856-859; Morrison. 1994. Nature 368:812-13; Fishwild et al. 1996. Nature Biotechnology 14:845-51; Neuberger. 1996. Nature Biotechnology 14:826; Lonberg and Huszar. 1995. Intern. Rev. Immunol. 13:65-93. U.S. Pat. No. 6,719,971 also provides guidance to methods of generating humanized antibodies.
(60) Exemplary antibodies against human copeptin protein include, but are not limited to, antibodies obtained from antibodies-online (e.g., Cat. No. ABIN109870, Cat. No. ABIN2238057, Cat. No. ABIN796775, and more can be found at its website www.antibodies-online.com), antibodies obtained from ThermoFisher Scientific (e.g., Cat. No. PA5-19788, Cat. No. PA5-25471; Cat. No. 710321, and more can be found at its website www.thermofisher.com), antibodies obtained from R&D systems (e.g., MAB6077), any commercially available antibodies against copeptin, and any antibodies that are generated by known method in the art utilizing the full-length protein or a fragment of human copeptin (e.g., residues 1-19, residues 20-28; residues 32-124; residues 126-164; residues 39-116; residues 20-164, any fragment or full length of SEQ ID NO 1).
(61) Exemplary antibodies against human MMP9 protein include, but are not limited to, antibodies obtained from Novus Biologicals (e.g., MAB911, AF911, NBP1-57940, and more from novusbio.com), antibodies obtained from boster bio (e.g., PA1357, and more can be found at its website bosterbio.com), antibodies obtained from R&D systems (e.g., MAB911, AF911, and more from rndsystems.com), any commercially available antibodies against human MMP9, and any antibodies that are generated by known method in the art utilizing the full-length protein or a fragment of human MMP9 (e.g., residues 1-19, residues 97-104, residues 107-707, residues 115-444, residues 224-271, residues 282-329, residues 341-388, residues 472-506, residues 514-704, residues 518-563, residues 564-608, residues 610-657, residues 658-704, any fragment or full length of SEQ ID NO 2).
(62) Exemplary antibodies against human LGALS3 protein include, but are not limited to, antibodies obtained from EMD Millipore (e.g., MABT51, MAB4033, AB10541, and more from emdmillipore.com), antibodies obtained from origene (e.g., TA506395, and more can be found at its website oregene.com), antibodies obtained from cell signaling technology (e.g., #12733, and more from rndsystems.com), any commercially available antibodies against human LGALS3, and any antibodies that are generated by known method in the art utilizing the full-length protein or a fragment of human LGALS3 (e.g., residues 18-105, residues 117-244, any fragment or full length of SEQ ID NO 3).
(63) Exemplary antibodies against human OCLN protein include, but are not limited to, antibodies obtained from antibodies online (e.g., ABIN687337, ABIN657822, ABIN337048 and more from antibodies-online.com), antibodies obtained from Sigma (e.g., SAB1406198, and more can be found at its website sigmaaldrich.com), antibodies obtained from Thermo Scientific (e.g., PA5-20755, and more from pierce-antibodies.com), any commercially available antibodies against human OCLN, and any antibodies that are generated by known method in the art utilizing the full-length protein or a fragment of human OCLN (e.g., residues 55-521, residues 58-263, residues 420-519, any fragment or full length of SEQ ID NO 4).
(64) Therapeutic Applications
(65) Also provided herein is a method of treating concussion or traumatic brain injury by modulating the activity or level of a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN.
(66) For example, the method includes steps of (1) providing a test sample from a subject, where the sample includes a bodily fluid; (2) performing a reaction in vitro by contacting the test sample with a binding agent to yield a complex including the binding agent and a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN; (3) detecting the complex, where a decrease in the level of the complex including copeptin compared to a normal control and an increase in the level of the complex including MMP9, LGALS3, or OCLN compared to a normal control indicates concussion or traumatic brain injury in the subject; and (4) administering to the subject identified as having concussion or traumatic brain injury a therapeutically effective amount of a compound that modulates the activity or level of the complex (e.g., an MMP9 selective inhibitor or an LGALS3 selective inhibitor), thereby treating the subject.
(67) In some cases, the method includes administrating to a subject having concussion or mTBI a therapeutically effective amount of an MMP9 selective inhibitor and/or an LGALS3 selective inhibitor.
(68) One exemplary MMP9 inhibitor is 2-[[(4-phenoxyphenyl)sulfonyl]methyl]-Thiirane (SB-3CT), SB-3CT prodrug or its pharmaceutically acceptable salt, ester, prodrug, metabolite, polymorph or solvate thereof (e.g., p-OH SB-3CT).
(69) The structure of SB-3CT is:
(70) ##STR00001##
(71) The structure of SB-3CT prodrug is:
(72) ##STR00002##
(73) SB-3CT prodrug is metabolized primarily by hydroxylation at the para position of the terminal phenyl ring (p-OH SB-3CT) and this derivative is a more potent gelatinase inhibitor compared with the parent compound, having the following structure:
(74) ##STR00003##
(75) Exemplary LGALS3 selective inhibitors include, but are not limited to, N-acetyllactosamine, a glycomimetic compound, or a pharmaceutically acceptable salt, ester, prodrug, metabolite, polymorph or solvate thereof.
(76) N-acetyllactosamine has the following structure:
(77) ##STR00004##
(78) Exemplary N-acetyllactosamine derivatives include, but are not limited to, the following compounds:
(79) TABLE-US-00005 glycomimetic compound Structure 1
(80) Exemplary N-acetyllactosamine derivatives include, but are not limited to, the following compounds:
(81) TABLE-US-00006
(82) The term therapeutically effective amount, as used herein, refers to an amount of a pharmaceutical agent to treat or ameliorate an identified disease or condition (i.e., concussion/mTBI), or to exhibit a detectable therapeutic or inhibitory effect, such as alleviation or amelioration of symptoms (e.g., amnesia, nausea, vomiting, headache, diplopia, dizziness, sleepiness, confusion, and/or disorientation/sensation of fogginess). The effect can be detected by any assay method known in the art. The precise effective amount for a subject will depend upon the subject's body weight, size, and health; the nature and extent of the condition; and the therapeutic selected for administration. Therapeutically effective amounts for a given situation can be determined by routine experimentation that is within the skill and judgment of the clinician.
(83) The invention here also provides a method of treating concussion or traumatic brain injury by administering an inhibitor of MMP9 and/or an inhibitor of LGALS3. In some embodiments, the method does not comprise administering an inhibitor of copeptin or OCLN.
(84) As used herein, the phrase pharmaceutically acceptable refers to those compounds, anions, cations, materials, compositions, carriers, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
(85) A pharmaceutical composition is a formulation containing the compounds of the present invention in a form suitable for administration to a subject. In one embodiment, the pharmaceutical composition is in bulk or in unit dosage form. The unit dosage form is any of a variety of forms, including, for example, a capsule, an IV bag, a tablet, a single pump on an aerosol inhaler or a vial. The quantity of active ingredient (e.g., a formulation of the disclosed compound or salt, hydrate, solvate or isomer thereof) in a unit dose of composition is an effective amount and is varied according to the particular treatment involved. One skilled in the art will appreciate that it is sometimes necessary to make routine variations to the dosage depending on the age and condition of the patient. The dosage will also depend on the route of administration. A variety of routes are contemplated, including oral, pulmonary, rectal, parenteral, transdermal, subcutaneous, intravenous, intramuscular, intraperitoneal, inhalational, buccal, sublingual, intrapleural, intrathecal, intranasal, and the like. Dosage forms for the topical or transdermal administration of a compound of this invention include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. In one embodiment, the active compound is mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants that are required.
(86) In therapeutic applications, the dosages of the pharmaceutical compositions used in accordance with the invention vary depending on the agent, the age, weight, and clinical condition of the recipient patient, and the experience and judgment of the clinician or practitioner administering the therapy, among other factors affecting the selected dosage. Generally, the dose should be sufficient to result in slowing, and preferably regressing, the growth of the tumors and also preferably causing complete regression of the cancer. Dosages can range from about 0.01 mg/kg per day to about 5000 mg/kg per day. In preferred aspects, dosages can range from about 1 mg/kg per day to about 1000 mg/kg per day. In an aspect, the dose will be in the range of about 0.1 mg/day to about 50 g/day; about 0.1 mg/day to about 25 g/day; about 0.1 mg/day to about 10 g/day; about 0.1 mg to about 3 g/day; or about 0.1 mg to about 1 g/day, in single, divided, or continuous doses (which dose may be adjusted for the patient's weight in kg, body surface area in m.sup.2, and age in years).
(87) As used herein, pharmaceutically acceptable salts refer to derivatives of the compounds of the present invention wherein the parent compound is modified by making acid or base salts thereof. Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines, alkali or organic salts of acidic residues such as carboxylic acids, and the like. The pharmaceutically acceptable salts include the conventional non-toxic salts or the quaternary ammonium salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. For example, such conventional non-toxic salts include, but are not limited to, those derived from inorganic and organic acids selected from 2-acetoxybenzoic, 2-hydroxyethane sulfonic, acetic, ascorbic, benzene sulfonic, benzoic, bicarbonic, carbonic, citric, edetic, ethane disulfonic, 1,2-ethane sulfonic, fumaric, glucoheptonic, gluconic, glutamic, glycolic, glycollyarsanilic, hexylresorcinic, hydrabamic, hydrobromic, hydrochloric, hydroiodic, hydroxymaleic, hydroxynaphthoic, isethionic, lactic, lactobionic, lauryl sulfonic, maleic, malic, mandelic, methane sulfonic, napsylic, nitric, oxalic, pamoic, pantothenic, phenylacetic, phosphoric, polygalacturonic, propionic, salicyclic, stearic, subacetic, succinic, sulfamic, sulfanilic, sulfuric, tannic, tartaric, toluene sulfonic, and the commonly occurring amine acids, e.g., glycine, alanine, phenylalanine, arginine, etc.
(88) The compounds of the present invention can also be prepared as esters, for example, pharmaceutically acceptable esters. For example, a carboxylic acid function group in a compound can be converted to its corresponding ester, e.g., a methyl, ethyl or other ester. Also, an alcohol group in a compound can be converted to its corresponding ester, e.g., acetate, propionate or other ester.
(89) The compounds of the present invention can also be prepared as prodrugs, for example, pharmaceutically acceptable prodrugs. The terms pro-drug and prodrug are used interchangeably herein and refer to any compound which releases an active parent drug in vivo. Since prodrugs are known to enhance numerous desirable qualities of pharmaceuticals (e.g., solubility, bioavailability, manufacturing, etc.), the compounds of the present invention can be delivered in prodrug form. Thus, the present invention is intended to cover prodrugs of the presently claimed compounds, methods of delivering the same and compositions containing the same. Prodrugs are intended to include any covalently bonded carriers that release an active parent drug of the present invention in vivo when such prodrug is administered to a subject. Prodrugs in the present invention are prepared by modifying functional groups present in the compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compound. Prodrugs include compounds of the present invention wherein a hydroxy, amino, sulfhydryl, carboxy or carbonyl group is bonded to any group that may be cleaved in vivo to form a free hydroxyl, free amino, free sulfhydryl, free carboxy or free carbonyl group, respectively.
(90) Examples of prodrugs include, but are not limited to, esters (e.g., acetate, dialkylaminoacetates, formates, phosphates, sulfates and benzoate derivatives) and carbamates (e.g., N,N-dimethylaminocarbonyl) of hydroxy functional groups, esters (e.g., ethyl esters, morpholinoethanol esters) of carboxyl functional groups, N-acyl derivatives (e.g., N-acetyl) N-Mannich bases, Schiff bases and enaminones of amino functional groups, oximes, acetals, ketals and enol esters of ketone and aldehyde functional groups in compounds of the invention, and the like, See Bundegaard, H., Design of Prodrugs, p 1-92, Elesevier, N.Y.-Oxford (1985).
(91) Diagnostic Device
(92) Also provided herein is diagnostic device that includes a solid support and a binding agent immobilized on the support, where the binding agent binds to a protein selected from the group consisting of copeptin, MMP9, LGALS3, and OCLN.
(93) In some cases, the diagnostic device includes a solid support and a plurality of immobilized binding agents, where a first binding agent binds to copeptin, a second binding agent binds to MMP9, a third binding agent binds to LGALS3, or a fourth binding agent binds to OCLN. A standard assay format for detection of these proteins in plasma or other processed bodily fluids includes ELISA or miniaturized ELISA-format system, e.g, on a chip. In some cases, the device is in a format/size of a credit card. In some cases, a diagnosis result (e.g., color change indicative of the change, presence and/or level of antigen (biomarker) present in the patient sample) is read, detected and/or sent to a second device, such as smart phone.
(94) An enzyme-linked immunosorbent assay (ELISA) is a test that uses antibodies and color change to identify the presence of an antibody-antigen complex. In this case, the antigen to be identified and quantified is a biomarker of concussion as described above. ELISA is an analytic biochemistry assay that uses a solid-phase enzyme immunoassay (EIA) to detect the presence of a substance, usually an antigen, in a liquid sample or wet sample. There are multiple forms of ELISA: direct ELISA, sandwich ELISA, and competitive ELISA.
(95) The steps of direct ELISA follows the mechanism: (1) a buffered solution of the antigen to be tested for is added to each well of a microtiter plate, where it is given time to adhere to the plastic through charge interactions; (2) a solution of nonreacting protein, such as bovine serum albumin or casein, is added to well (usually 96-well plates) in order to cover any plastic surface in the well which remains uncoated by the antigen; (3) the primary antibody with an attached (conjugated) enzyme is added, which binds specifically to the test antigen coating the well; (4) a substrate for this enzyme is then added. Often, this substrate changes color upon reaction with the enzyme. The higher the concentration of the primary antibody present in the serum, the stronger the color change. Often, a spectrometer is used to give quantitative values for color strength.
(96) The enzyme acts as an amplifier; even if only few enzyme-linked antibodies remain bound, the enzyme molecules will produce many signal molecules. The enzyme can go on producing color indefinitely, but the more antibody is bound, the faster the color will develop. A major disadvantage of the direct ELISA is the method of antigen immobilization is not specific; when serum is used as the source of test antigen, all proteins in the sample may stick to the microtiter plate well, so small concentrations of analyte in serum must compete with other serum proteins when binding to the well surface. The sandwich or indirect ELISA provides a solution to this problem, by using a capture antibody specific for the test antigen to pull it out of the serum's molecular mixture.
(97) ELISA may be run in a qualitative or quantitative format. Qualitative results provide a simple positive or negative result (yes or no) for a sample. The cutoff between positive and negative is determined by the analyst and may be statistical. Two or three times the standard deviation (error inherent in a test) is often used to distinguish positive from negative samples. In quantitative ELISA, the optical density (OD) of the sample is compared to a standard curve, which is typically a serial dilution of a known-concentration solution of the target molecule. For example, if a test sample returns an OD of 1.0, the point on the standard curve that gave OD=1.0 must be of the same analyte concentration as the sample.
(98) The use and meaning of the names direct ELISA and indirect ELISA differs in the literature depending on the context of the experiment. When the presence of an antigen is analyzed, the name direct ELISA refers to an ELISA in which only a labelled primary antibody is used, and the term indirect ELISA refers to an ELISA in which the antigen is bound by the primary antibody which then is detected by a labelled secondary antibody. In the latter case a sandwich ELISA is clearly distinct from an indirect ELISA. When the primary antibody is of interest, e.g. in the case of immunization analyses, this antibody is directly detected by the secondary antibody and the term direct ELISA applies to a setting with two antibodies.
(99) A sandwich ELISA, is used to detect sample antigen. The steps are: (1) a surface is prepared to which a known quantity of capture antibody is bound; (2) any nonspecific binding sites on the surface are blocked; (3) the antigen-containing sample is applied to the plate, and captured by antibody; (4) the plate is washed to remove unbound antigen; (5) a specific antibody is added, and binds to antigen (hence the sandwich: the Ag is stuck between two antibodies). This primary antibody could also be in the serum of a donor to be tested for reactivity towards the antigen; (6) enzyme-linked secondary antibodies are applied as detection antibodies that also bind specifically to the antibody's Fc region (nonspecific); (7) the plate is washed to remove the unbound antibody-enzyme conjugates; (8) a chemical is added to be converted by the enzyme into a color or fluorescent or electrochemical signal; (9) the absorbance or fluorescence or electrochemical signal (e.g., current) of the plate wells is measured to determine the presence and quantity of antigen.
(100) In some cases, a secondary antibody is conjugated to an enzyme, although, in the technical sense, this is not necessary if the primary antibody is conjugated to an enzyme (which would be direct ELISA). However, the use of a secondary-antibody conjugate avoids the expensive process of creating enzyme-linked antibodies for every antigen one might want to detect. By using an enzyme-linked antibody that binds the Fc region of other antibodies, this same enzyme-linked antibody can be used in a variety of situations. Without the first layer of capture antibody, any proteins in the sample (including serum proteins) may competitively adsorb to the plate surface, lowering the quantity of antigen immobilized. Use of the purified specific antibody to attach the antigen to the plastic eliminates a need to purify the antigen from complicated mixtures before the measurement, simplifying the assay, and increasing the specificity and the sensitivity of the assay.
(101) A third use of ELISA is through competitive binding. The steps for this ELISA are somewhat different from the first two examples: (1) unlabeled antibody is incubated in the presence of its antigen (sample); (2) these bound antibody/antigen complexes are then added to an antigen-coated well; (3) the plate is washed, so unbound antibodies are removed. (The more antigen in the sample, the more Ag-Ab complexes are formed and so there are less unbound antibodies available to bind to the antigen in the well, hence competition.); (4) the secondary antibody, specific to the primary antibody, is added (this second antibody is coupled to the enzyme); (5) a substrate is added, and remaining enzymes elicit a chromogenic or fluorescent signal; (6) the reaction is stopped to prevent eventual saturation of the signal.
(102) Some competitive ELISA kits include enzyme-linked antigen rather than enzyme-linked antibody. The labeled antigen competes for primary antibody binding sites with the sample antigen (unlabeled). The less antigen in the sample, the more labeled antigen is retained in the well and the stronger the signal. Commonly, the antigen is not first positioned in the well.
(103) The support can be a strip, a glass, a silicon, a polymer, a bead, a nanoparticle or a chip (e.g., microfluidics). In some cases, the support comprises a microfluidic system. Microfluidic systems fabricated by microelectromechanical systems (MEMS) technology are now usually referred to aslab-on-a-chip (LOC), biochips, ormicro-total-analysis-system. They are fabricated as miniaturized versions of their large-scale counterparts. These miniaturized systems can carry out entire protocols traditionally performed in a laboratory. Sample pretreatment, sample/reagent transport, mixing, reaction, separation, detection, and product collection can all be performed automatically on a single LOC system. Functional microfluidic devices, such as micropumps, microvalves, microfilters, microreactors, and microseparators can be microfabricated and even integrated to perform a specific assay. The advantages of these developed LOC systems include less sample/reagent consumption, a reduced risk of contamination, enhanced sensitivity, less unit cost, lower power consumption, and a higher reliability and functionality. More importantly, portability arising from their compact form is a key factor for point-of-care (POC) applications.
(104) Microfluidic devices for immunoassays can be fabricated from a variety of materials. The most commonly used substrate materials are silicon, glass, and polymers. Many polymers have been used in microfluidic applications, such as polymethyl methacrylate (PMMA), polycarbonate, polystyrene (PS), and polydimethylsiloxane (PDMS). Among these polymers, PDMS is one of the most commonly used materials for microfluidic immunoassays in recent studies because of its desirable characteristics, such as flexibility, optical transparency (down to 230 nm), and biocompatibility. Heterogeneous materials formed by using two different types of materials can also be utilized for microfluidic devices. For example, PDMS/glass and silicon/glass are commonly used for forming microfluidic devices.
(105) Such device is portable and convenient, and provides a quick (e.g., between about 10-40 min, e.g., about 10, 20, 30, 40 minutes) and accurate diagnosis result for the patients. In addition, only a small volume from about 10 l to about 200 l (e.g., about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 l) of blood sample is sufficient for an accurate determination.
(106) Any binding agent that binds to copeptin, MMP9, LGALS3 or OCLN can be used in the devices described herein, for example, an antibody or a fragment thereof, a detectable protein or a fragment thereof. The antibody can be a polyclonal antibody or a monoclonal antibody. Exemplary antibodies are described above. Other exemplary binding agents that can be used in the device include, but are not limited to, DuoSet ELISA Development Systems from R&D Systems (Minneapolis, Minn.) for LGALS3 and MMP9 and the ELISA kits from USCN Life Science for OCLN and copeptin.
(107) In some cases, the antibody is conjugated to a detectable moiety. Exemplary detectable moiety includes, but is not limited to a fluorescent marker (e.g., fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, p-phthaldehyde and fluorescamine, and 152 Eu) or a chemiluminescent compound (e.g., luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester).
(108) Exemplary Study: A Panel of Blood Biomarkers for Diagnosis of Mild Traumatic Brain Injury/Concussion
(109) No routine tests currently exist to objectively diagnose mild traumatic brain injury mTBI/concussion with high level of accuracy and confidence. The methods and systems described herein solve this problem and provide a rapid and reliable test for concussion. Previously reported biomarkers for mTBI represented proteins released from the damaged neurons or glia. However, the low levels of these proteins and/or the complexity of assays used for their detection limits the implementation of these biomarkers in routine practice. Proteins whose synthesis is altered after mTBI and whose blood levels are accordingly measured using standard immunoassays were identified.
(110) Adult patients sustaining a concussion within the past 24 hours were enrolled in the study. Controls were uninjured subjects and patients with orthopedic injury (04 Plasma concentrations of eighteen potential biomarkers were measured using commercially available immunoassays.
(111) Four biomarkers were identified: copeptin, galectin 3 (LGALS3), matrix metalloproteinase 9 (MMP9), and occludin (OCLN). A 3.4-fold decrease in plasma concentration of copeptin was found in mTBI patients within eight hours after accident when compared to uninjured controls. Plasma levels of LGALS3, MMP9, and OCLN increased 3.6-4.5-fold within the same time frame post-injury. The levels of at least two biomarkers were altered beyond their respective cutoff values in 90% of mTBI patients, whereas in none of uninjured controls, were the levels of two biomarkers simultaneously changed. A positive correlation between the plasma levels of LGALS3 and OCLN was also found in mTBI patients, whereas in OI patients or uninjured subjects, these variables did not correlate.
(112) This panel of biomarkers discerns with high accuracy concussed patients from uninjured individuals within the first eight hours after accident. Furthermore, these biomarkers are useful to diagnose concussion in the presence of OI. Unlike the previously reported biomarkers, some of these proteins represent potential therapeutic targets in mTBI.
(113) In the present study, an alternative approach was explored. Proteins whose synthesis are upregulated in response to mTBI were identified, resulting in an increase in their blood levels, which could be readily measured using standard, immunoassays. In contrast to the above-described biomarkers, these proteins also represent potential targets for intervention.
(114) The following methods were used to generate the data described herein.
(115) Study Design and Participants
(116) This study was conducted in a large, urban academic ED with a level I trauma center. Research subjects were selected by research assistants (RAs) based upon electronic medical record review of the chief complaint and initial triage nursing notes. RAs, who were trained in recognizing the signs and symptoms of concussion, performed a brief interview with the subjects to determine eligibility. The definition and inclusion criteria for concussion were based on the 2012 Zurich Concussion Consensus Statement. If subjects were eligible, RAs collected demographic and clinical information, and then obtained blood samples through venipuncture. Control OI subjects with long bone fractures were recruited in the same ED. The same exclusion criteria applied to these subjects with the exception of the presence of long bone fractures and the absence of mTBI within the past six months. Control uninjured subjects were recruited by research staff. These subjects were not patients in the ED. The same exclusion criteria were applied to this group of subjects with the addition of no mTBI within the past six months.
(117) Biochemical Procedures
(118) The recommendations from the Biospecimens and Biomarkers Working Group.sup.19 were followed when collecting and processing blood samples. Blood was collected using heparin-containing Va-cutainer tubes. Plasma was subsequently isolated, aliquoted, and stored at 80 C. Plasma rather than serum was analyzed in this study because of our concern that the coagulation process may have an effect on the concentration of some of the biomarkers. This was based on our data obtained in the rat model of mTBI where the serum levels of chemokine (CXC motif) ligand 1 (CXCL1) were substantially higher than those measured in plasma. Additionally, unlike plasma levels of CXCL1, serum levels of CXCL1 did not change in response to injury.
(119) Eighteen potential biomarkers were studied. These proteins included proinflammatory mediators tumor necrosis factor alpha (TNF-a) and its soluble receptor, sTNFR1 (samples diluted 1:5), interleukin-1b (IL-1b), the chemokines CXCL1, CXCL8, and chemokine (CC motif) ligand 2 (CCL2), colony-stimulating factor 3 (CSF3), SPP1 (samples diluted 1:200), LGALS3 (samples diluted 1:5), soluble cell adhesion molecules intercellular adhesion molecule 1 (sICAM1; samples diluted 1:200), sE-selectin (samples diluted 1:20), sP-selectin (samples diluted 1:20), and sL-selectin (samples diluted 1:1000), matrix metalloproteinases MMP2 (samples diluted 1:50), MMP3 (samples diluted 1:100), and MMP9 (samples diluted 1:100), occludin (OCLN), and copeptin. Plasma concentrations of these proteins were measured using commercially available enzyme-linked immunosorbent assay (ELISA) kits with appropriate dilutions of the samples (as indicated above) to adjust for the assay range for each ELISA. DuoSet ELISA Development Systems from R&D Systems (Minneapolis, Minn.) were used to measure the concentrations of all biomarkers except for OCLN and copeptin. Levels of OCLN and copeptin were measured using the ELISA kits from USCN Life Science (Houston, Tex.).
(120) Statistical Analysis
(121) For statistical analysis, plasma concentrations of candidate biomarkers were considered as continuous data. Results are expressed as meansstandard deviation. In addition, a median and interquartile range (IQR) of concentrations for each biomarker were provided. Kruskal-Wallis' one-way analysis of variance was used followed by Dunn's test to compare mTBI patients with uninjured control subjects and patients with OI. Effect sizes (Cohen's d) for changes in plasma levels of four candidate biomarkers were also assessed. A pair-wise analysis of correlation for these bio-markers was also performed and Pearson's correlation coefficients were calculated. To determine whether the candidate biomarkers have the ability to discriminate between patients with mTBI and uninjured control subjects, receiver operating characteristics (ROC) curves were generated and the area under the curve (AUC), together with its 95% confidence interval (CI), was estimated for each ROC curve. Both uni- and multivariate ROC analyses were performed to evaluate the diagnostic performance of individual biomarkers and their combinations, respectively.
(122) In addition, a multivariate logistic regression analysis, controlling for age, sex, and body mass index (BMI), was performed to assess odds ratios (ORs) for the ability of candidate biomarkers to diagnose suspected concussion. A value of p<0.05 was considered statistically significant. Statistical analyses were performed using the statistical software packages, GraphPad Prism (version 6.0; GraphPad Software Inc., La Jolla, Calif.) and SigmaStat (version 12.5; Systat Software, Inc., San Jose, Calif.). Effect sizes (Cohen's d) were calculated using the Psychometrica online tool (http://www.psychometrica.de/effect_size.html), whereas the uni- and multivariate ROC analyses were performed using ROCCET, an online tool for ROC analysis (www.roccet.ca/ROCCET/).
(123) Identification of Biomarkers
(124) In total, 55 patients sustaining a concussion were enrolled. We also enrolled 44 uninjured control subjects and 17 subjects with long bone fractures who constituted the OI group. The characteristics of enrolled subjects, including their demographic data, the mechanisms of injury, and medical history, are provided in Table 2. The initial goal was to investigate whether concussion in humans is accompanied by increased production of proinflammatory mediators, as they potentially represent targets for therapeutic intervention. A group of mTBI patients were divided into two subgroups. The first subgroupmTBI (1-8 h)which represented the majority (41 or 75%) of participants, included mTBI patients in whom blood samples were collected within the first eight hours after concussion. The second subgroupmTBI (9-24 h)consisted of mTBI patients in whom blood samples were collected between nine and twenty-four hours after accident. The earliest time point at which blood was drawn in the mTBI (1-8 h) subgroup of patients was 1.5 h after injury, and the mean time between injury and blood collection was 4.21.6 h (median 4 h, IQR 3-5 h). In the mTBI (9-24 h) subgroup of patients, the mean period of time between injury and the collection of blood sample was 15.55.4 h (median 13 h, IQR 10.4-22.0 h). In OI patients, the blood samples were collected within 12 h after accident, with a mean of 6.63.2 h (median 6 h, IQR 3.5-9.0 h).
(125) Overall, 18 potential biomarkers were evaluated. For 14 of these proteins, no differences in their plasma levels were found between the mTBI (1-8 h) subgroup of patients and uninjured control subjects (Table 3). A considerable dispersion of plasma concentrations of tumor necrosis factor- and interleukin-1, and the chemokines CXCL1, CXCL8, and CCL2, was observed in both groups. This could be related, at least in part, to the existence of various underlying medical conditions in some of the participating individuals (see Table 2).
(126) Data obtained in two rodent models of severe TBI indicated that the brain synthesis of two proinflammatory mediators osteopontin (SPP1) and galectin 3 (LGALS3) is rapidly upregulated and maintained at high levels for at least three days after injury. While the plasma level of SPP1 did not change after mTBI (Table 3), a 4.3-fold increase in plasma concentration of GALS3 was found in the mTBI (1-8 h) subgroup of patients when compared to controls (
(127) Changes in plasma levels of select MMPs were also evaluated in mTBI patients. No changes in plasma levels of MMP2 and MMP3 were found in the mTBI (1-8 h) subgroup of patients compared to uninjured controls (Table 3); however, a 3.6-fold increase in plasma concentration of MMP9 was observed in the mTBI (1-8 h) subgroup of patients versus controls (
(128) These investigations led to the identification of four biomarkers for the diagnosis of mTBI within eight hours after injury. The majority (23 out of 26 or 88%) of individuals in the mTBI (1-8 h) subgroup of patients in whom the Glasgow Coma Scale (GCS) scores were recorded had a GCS score of 15. None of these mTBI patients had a GCS score of 13. The diagnostic performance of these biomarkers is summarized in Table 3, and
(129) TABLE-US-00007 TABLE 1 Diagnostic performance of biomarkers Biomarker Copeptin LGALS3 MMP9 OCLN Type of analysis ROC analysis* AUC 0.922 0.849 0.846 0.836 95% CI 0.855-0.989 0.763-0.935 0.759-0.933 0.746-0.926 Statistical significance p < 0.0001 p < 0.0001 p < 0.0001 p < 0.0001 Cutoff value 375 pg/mL 1 ng/mL 30 ng/mL 350 pg/mL PPV 94.6% 71.4% 90.6% 87.5% Sensitivity/specificity 0.833/0.933 0.775/0.733 0.725/0.930 0.683/0.879 Logistic regression analysis.sup. OR 94.2 9.0 34.5 19.3 95% CI 15.4-577.4 3.2-25.6 8.6-138.1 5.2-72.5 Statistical significance p < 0.001 p < 0.001 p < 0.001 p < 0.001 ROC = receiver operating characteristics. AUC = area under the curve. CI = confidence interval. PPV = positive predictive value. OR = odds ratio. *ROC analyses were conducted to assess the ability of biomarkers to discriminate between in TBI patients (blood samples collected at 1-8 h post injury) and uninjured subjects. .sup.Logistic regression analyses were adjusted for age, sex, and body mass index.
(130) The above-described biomarkers are useful for the diagnosis of isolated concussions. The plasma levels of these biomarkers may also be altered in patients with OI (
(131) In the course of these studies, a panel of four biomarkers for mTBI was defined. These markers accurately and reliably discern with high accuracy patients sustaining a concussion from uninjured subjects within the first eight hours after injury. These biomarkers can also aid in diagnosing suspected concussion in the presence of OI. The AUC values for these biomarkers are comparable to those reported for GFAP breakdown products, UCHL1, total tau, and S100B. The ability of these biomarkers to diagnose mTBI is not influenced by age, sex, or BMI. Since many individuals among mTBI patients and control subjects suffered from various diseases and/or were on various medications (Table 2). The diagnostic performance of these biomarkers is also independent of underlying medical conditions or medications taken by a patient. The plasma levels of these biomarkers can be altered by OI; however, this phenomenon is not unique to these proteins. Indeed, among apparently CNS-derived biomarkers investigated so far, UCHL1 appears to be the only biomarker that could potentially distinguish patients with mTBI from those with OI. While such data are not available for total tau, a noticeable overlap in serum levels of GFAP breakdown products between the mTBI and OI groups of patients, with comparable median values, was found. Similarly, no difference in serum levels of S100B between mTBI and OI patients was observed, and in a study assessing the diagnostic potential of SPTAN1 N-terminal fragment, the plasma levels of this protein were found to be elevated above an arbitrary cutoff value in 23% of OI subjects. These observations could be explained, at least in part, by findings demonstrating that long bone fractures cause the disruption of the integrity of the BBB and neuroinflammation.
(132) Copeptin was found to be the best performing biomarker for mTBI. Its plasma concentration was not only significantly decreased early after concussion, but was also maintained at the low level for at least 24 h post-mTBI. These observations are surprising given previous data obtained in a rat model of severe TBI and the results of clinical studies of patients with severe TBI, demonstrating an increase in vasopressin synthesis. The reasons for these apparent discrepancies are currently unknown and may be related to the reduced synthesis/secretion and/or augmented degradation of circulating copeptin in mTBI patients. This also suggests that the pathophysiology of TBI in humans is not a continuum between mTBI and severe TBI.
(133) MMP9 has never been evaluated as a potential biomarker for mTBI. With a significant (3.6-fold) increase in MMP9 concentration in plasma observed in mTBI patients versus uninjured controls, and a well-established ability of this proteinase to attack tight junction proteins at the BBB, whether this increase in MMP9 level is accompanied by an increase in the concentration of OCLN was investigated. While a rise in OCLN levels within eight hours after concussion was also observed, no correlation between plasma concentrations of MMP9 and OCLN was found, suggesting that MMP9 is not involved in OCLN degradation occurring after mTBI. At present, it is unclear whether this increase in OCLN concentration reflects dysfunction of the BBB in patients with mTBI. No change in albumin levels in cerebrospinal fluid (CSF) harvested from boxers sustaining concussions (based on the measurements of CSF levels of neurofilament light chain protein, total tau, and GFAP) was found, suggesting no disruption of the integrity of the BBB.
(134) A significant (4.3-fold) increase in plasma concentration of LGALS3 in mTBI patients compared to uninjured subjects was found. While animal studies of severe TBI suggested a long-lasting upregulation of LGALS3 synthesis in the injured brain, a relatively short-lasting increase in plasma levels of LGALS3 was only observed in mTBI patients. LGALS3 has previously been reported to be produced by activated microglia, but its pathophysiological role in neurotrauma is currently unknown. These data showed a positive correlation between plasma levels of LGALS3 and OCLN, suggesting that this proinflammatory mediator might have an adverse effect on BBB function in mTBI. The lack of such correlation in patients with OI can allow for the diagnosis of suspected concussion in the presence of OI.
(135) In summary, four plasma biomarkers for the diagnosis of concussion have been identified. Some of them (MMP9 and/or LGALS3) are targets for therapeutic intervention. Unlike previously reported blood biomarkers, which were the proteins released from the damaged brain cells, the biomarkers described in the present study could readily be measured using standard ELISA. Rapid microfluidics-based immunoassays for these biomarkers are useful for the point-of-care diagnosis in the ED or other relevant environments.
(136) The Inclusion Criteria for the Study:
(137) 1. Age between 18 and 65 (inclusive) years 2. Glasgow Coma Scale (GCS) score of 13-15. (Patients for whom the GCS scores were not recorded were awake and able to consent.) 3. Concussion symptoms: subject-reported injury with loss of consciousness and/or two of the following symptoms: a. Amnesia b. Nausea/vomiting c. Headache d. Diplopia e. Dizziness f. Sleepiness g. Confusion h. Disorientation or sensation of fogginess 4. Subject is able to consent 5. Injury occurred less than 24 h before arrival at the Emergency Department
The Exclusion Criteria for the Study: 1. Syncope as the cause of the trauma 2. Medical history of cancer, autoimmune disease, active infectious diseases (including HIV and viral hepatitis), and inflammatory conditions (including inflammatory bowel disease) 3. Other concomitant medical issues that require admission to hospital 4. Current treatment with immunomodulator medications (including glucocorticoids), antibiotics, or chemotherapy 5. Alcohol intoxication determined by breathalyzer or blood alcohol content of >0.08%, or clinical suspicion of alcohol intoxication 6. Active psychiatric issues requiring psychiatry evaluation 7. Significant other trauma defined as: a. Long bone fracture b. Vertebral fracture c. Compartment syndrome d. Arterial bleeding e. Spinal cord injury f. Injuries to the lung, heart, and abdominal organs as noted on imaging, or requiring operative intervention or admission to the hospital g. Ocular injuries h. Burns i. Significant soft tissue injuries defined as >10-cm laceration, abrasion, or hematoma
Biomarkers Evaluated in this Study
(138) Eighteen potential biomarkers were studied. These included proinflammatory mediators tumor necrosis factor- (TNF-) and its soluble receptor sTNFR1 (samples diluted 1:5), interleukin-1 (IL-1), the chemokines CXCL1, CXCL8, and CCL2, colony-stimulating factor 3 (CSF3), osteopontin (SPP1; samples diluted 1:200), galectin 3 (LGALS3; samples diluted 1:5), soluble cell adhesion molecules intercellular adhesion molecule 1 (sICAM1; samples diluted 1:200), sE-selectin (samples diluted 1:20), sP-selectin (samples diluted 1:20), and sL-selectin (samples diluted 1:1000), matrix metalloproteinases (MMPs) MMP2 (samples diluted 1:50), MMP3 (samples diluted 1:100), and MMP9 (samples diluted 1:100), occludin (OCLN), and copeptin.
(139) DuoSet ELISA Development Systems from R&D Systems (Minneapolis, Minn., USA) were used to measure the concentrations of all biomarkers except those of OCLN and copeptin. The levels of OCLN and copeptin were evaluated using the ELISA kits from USCN Life Science (Houston, Tex., USA).
(140) TABLE-US-00008 TABLE 2 Characteristics of enrolled subjects Group mTBI Control OI (n = 55) (n = 44) (n = 17) Age (years) 34 .Math. 0 12 .Math. 5 34 .Math. 0 11 .Math. 9 41 .Math. 2 15 .Math. 2 BMI (kg/m.sup.2) 26 .Math. 4 4 .Math. 1 25 .Math. 6 4 .Math. 5 31 .Math. 5 5 .Math. 3 Men 33 (60 .Math. 0) 23 (52 .Math. 3) 11 (64 .Math. 7) Race White 49 (89 .Math. 1) 39 (88 .Math. 6) 16 (94 .Math. 1) Black 3 (5 .Math. 5) 1 (2 .Math. 3) 1 (5 .Math. 9) Other 3 (5 .Math. 5) 4 (9 .Math. 1) Ethnicity Non-Hispanic 41 (74 .Math. 5) 40 (90 .Math. 9) 14 (82 .Math. 4) Hispanic 13 (23 .Math. 6) 4 (9 .Math. 1) 3 (17 .Math. 6) Refused/not recorded 1 (1 .Math. 8) Previous TBI Yes 18 (32 .Math. 7) 6 (13 .Math. 6) 4 (23 .Math. 5) Years since last TBI 9 .Math. 1 9 .Math. 6 12 .Math. 5 11 .Math. 1 17 .Math. 3 16 .Math. 5 Medical history* None 31 (56 .Math. 4) 31 (70 .Math. 5) 12 (70 .Math. 6) Chronic pain 6 (10 .Math. 9) 2 (4 .Math. 5) Diabetes 1 (1 .Math. 8) 2 (11 .Math. 8) Hypercholesterolemia 3 (5 .Math. 5) 3 (6 .Math. 8) 2 (11 .Math. 8) Hypertension 4 (7 .Math. 3) 3 (6 .Math. 8) 4 (23 .Math. 5) Psychiatric disease 8 (14 .Math. 5) 4 (9 .Math. 1) 3 (17 .Math. 6) Vascular disease 3 (5 .Math. 5) (CAD, stroke) Medications.sup. None 24 (43 .Math. 6) 24 (54 .Math. 5) 12 (70 .Math. 6) ACE inhibitors/ARB 4 (7 .Math. 3) 2 (4 .Math. 5) 1 (5 .Math. 9) Aspirin 4 (7 .Math. 3) 1 (2 .Math. 3) OCP 3 (5 .Math. 5) 6 (13 .Math. 6) 1 (5 .Math. 9) Statins 3 (5 .Math. 5) 3 (6 .Math. 8) 2 (11 .Math. 8) SSRI/SNRI 7 (12 .Math. 7) 2 (4 .Math. 5) 2 (11 .Math. 8) Mechanism of injury Fall 15 (27 .Math. 3) Motor vehicle crash 14 (25 .Math. 5) Sport 7 (12 .Math. 7) Struck by/against an 7 (12 .Math. 7) object Assault 5 (9 .Math. 1) Bicycling 4 (7 .Math. 3) Pedestrian struck 3 (5 .Math. 5) GCS on arrival 15 28 (50 .Math. 92) 14 3 (5 .Math. 5) 13 Not recorded 24 (43 .Math. 6) Head CT findings Normal 25 (45 .Math. 5) Scalp hematoma 7 (12 .Math. 7) Facial bone fracture 3 (5 .Math. 5) Sinusitis 2 (3 .Math. 6) Chronic 1 (1 .Math. 8) encephalomalacia Intraparenchymal 1 (1 .Math. 8) contusion CT not performed 16 (29 .Math. 1) Controls = uninjured subjects. mTBI = subjects who sustained a concussion. OI = subjects with orthopedic injury. BMI = body mass index. CAD = coronary artery disease. ACE = angiotensin-converting enzyme. ARB = angiotensin II receptor blockers. SSRI = Selective serotonin reuptake inhibitors. SNRI = Serotonin-norepi-nephrine reuptake inhibitors. OCP = oral contraceptive pills. GCS = Glasgow Coma Scale. CT = computed tomography. *Some subjects had more than one medical problem and were taking more than one medication, .sup.Only common medications taken are listed. Data are either mean SD or n (%).
(141) TABLE-US-00009 TABLE 3 Plasma levels of 14 out of 18 proteins evaluated in this study Controls mTBI (1-8 h) mTBI (9-24 h) OI Mean Me- Mean Me- Mean Me- Mean Me- Protein SD dian IQR SD dian IQR SD dian IQR SD dian IQR TNF- 252 376 24 6-481 245 559 8 7-181 298 456 24 8-770 340 691 8 8-48 (pg/mL) sTNFR1 0.9 0.5 0.8 0.6-1.0 0.9 0.2 1.0 0.7-1.2 0.7 0.3 0.6 0.5-1.1 0.9 0.2 0.9 0.8-1.0 (ng/mL) IL-1 35 94 2 2-25 30 82 2 2-10 52 131 2 2-28 27 56 2 2-7 (pg/mL) CXCL1 575 687 387 72-884 294 504 113 16-370 711 962 224 76-1340 246 278 114 49-373 (pg/mL) CXCL8 17 41 6 4-12 9 9 6 4-10 12 13 7 4-14 16 26 8 6-15 (pg/mL) CCL2 (pg/mL) 325 561 115 67-355 136 122 94 36-213 478 883 146 71-377 222 51 220 168-271 CSF3 (pg/mL) 24 17 17 16-27 27 12 24 16-37 45 46** 23 16-60 36 17 31 22-18 SPP1 (ng/mL) 16 11 15 6-24 16 11 13 6-28 28 20 29 10-36 16 9 16 9-20 sICAM1 118 32 113 96-135 134 31.sup. 127 113-165 95 12 99 82-106 178 103 144 93-225 (ng/mL) sE-selectin 14 7 14 9-18 14 5 12 9-19 15 7 14 9-20 19 9 17 11-25 (ng/mL) sP-selectin 25 12 22 18-29 34 13 33 26-38 27 12 25 17-35 35 6 37 28-40 (ng/mL) sL-selectin 1.5 0.4 1.4 1.3-1.8 1.6 0.3 1.7 1.3-1.8 1.7 0.5 1.9 1.4-2.0 1.2 0.6 1.3 0.7-1.6 (g/mL) MMP2 84 72 62 31-119 .sup.87 28.sup. 81 68-106 106 26 97 84-118 152 52**** 138 130-161 (ng/mL) MMP3 15 9 12 9-22 14 6 13 9-20 13 9 10 6-15 9 6 6 3-15 (ng/mL) Controls = uninjured subjects. mTBI (1-8 h) = mTBI patients in whom blood samples were collected between 1 and 8 h post-injury. mTBI (9-24 h) = mTBI patients in whom blood samples were collected between 9 and 24 h post-injury. OI = patients with orthopedic injury. IQR = interquartile range. **p < 0.01, ****p < 0.0001 when compared to control. .sup.p < 0.001 when compared to OI. .sup.
(142) TABLE-US-00010 TABLE 4 Concussion data for the department of emergency medicine Concussion Data for the Department of Emergency Medicine Year 2010 2011 2012 2013 2014 2010-2014 Total Isolated Total Isolated Total Isolated Total Isolated Total Isolated Total Isolated Number of Concus- Number of Concus- Number of Concus- Number of Concus- Number of Concus- Number of Concus- Concus- sions Concus- sions Concus- sions Concus- sions Concus- sions Concus- sions Site sions % sions % sions % sions % sions % sions % RIH 1129 889 79 1248 940 75 809 621 77 664 541 81 765 630 82 4615 3621 78 TMH 171 145 85 223 209 94 224 203 91 212 191 90 275 253 92 1105 1001 91 HCH 683 643 94 826 769 93 757 709 94 740 709 96 808 759 94 3814 3589 94 RIH = Rhode Islan Hospital TMH = The Miriam Hospital HCH = Hasbro Children's Hospital
REFERENCES
(143) 1 Faul M, Xu L, Wald M M, Coronado V. Traumatic Brain Injury in the United States: Emergency Department Visits, Hospitalizations and Deaths, 2002-2006. Centers for Disease Control and Prevention, National Center for Injury Prevention and Control, Atlanta, Ga., 2010. 2 Tagliaferri F, Compagnone C, Korsic M, Servadei F, Kraus J. A systematic review of brain injury epidemiology in Europe. Acta Neurochir (Wien) 2006; 148: 255-68. 3 Cassidy J D, Carroll L J, Peloso P M, et al. Incidence, risk factors and prevention of mild traumatic brain injury: results of the WHO Collaborating Centre Task Force on Mild Traumatic Brain Injury. J Rehabil Med 2004; Suppl. 43: 28-60. 4 Williamson I J, Goodman D. Converging evidence for the under-reporting of concussions in youth ice hockey. Br J Sports Med 2006; 40: 128-32. 5 Rigg J L, Mooney S R. Concussions and the military: issues specific to service members. Pm R 2011; 3: S380-6. 6 Mondello S, Schmid K, Berger R P, et al. The challenge of mild traumatic brain injury: role of biochemical markers in diagnosis of brain damage. Med Res Rev 2014; 34: 503-31. 7 Papa L, Lewis L M, Falk J L, et al. Elevated levels of serum glial fibrillary acidic protein breakdown products in mild and moderate traumatic brain injury are associated with intracranial lesions and neurosurgical intervention. Ann Emerg Med 2012; 59: 471-83. 8 Papa L, Lewis L M, Silvestri S, et al. Serum levels of ubiquitin C-terminal hydrolase distinguish mild traumatic brain injury from trauma controls and are elevated in mild and moderate traumatic brain injury patients with intracranial lesions and neurosurgical intervention. J Trauma Acute Care Surg 2012; 72: 1335-44. 9 Siman R, Giovannone N, Hanten G, et al. Evidence that the blood biomarker SNTF predicts brain imaging changes and persistent cognitive dysfunction in mild TBI patients. Front Neurol 2013; 4: 190. 10 Shahim P, Tegner Y, Wilson D H, et al. Blood biomarkers for brain injury in concussed professional ice hockey players. JAMA Neurol 2014; 71: 684-92. 11 McCrory P, Meeuwisse W H, Aubry M, et al. Consensus statement on concussion in sport: the 4th International Conference on Concussion in Sport held in Zurich, November 2012. Br J Sports Med 2013; 47: 250-8. 12 Manley G T, Diaz-Arrastia R, Brophy M, et al. Common data elements for traumatic brain injury: recommendations from the Biospecimens and Biomarkers Working Group. Arch Phys Med Rehabil 2010; 91: 1667-72. 13 Perez-Polo J R, Rea H C, Johnson K M, et al. Inflammatory consequences in a rodent model of mild traumatic brain injury. J Neurotrauma 2013; 30: 727-40. 14 Chodobski A, Zink B J, Szmydynger-Chodobska J. CNS barriers in neurotrauma. In Vascular Mechanisms in CNS Trauma, Edited by Eng H Lo, Josephine Lok, MingMing Ning, Michael J Whalen, Springer, New York, 2014, pp. 3-28. 15 Natale J E, Ahmed F, Cernak I, Stoica B, Faden A I. Gene expression profile changes are commonly modulated across models and species after traumatic brain injury. J Neurotrauma 2003; 20: 907-27. 16 Liu W, Hendren J, Qin X J, Shen J, Liu K J. Normobaric hyperoxia attenuates early blood-brain barrier disruption by inhibiting MMP-9-mediated occludin degradation in focal cerebral ischemia. J Neurochem 2009; 108: 811-20. 17 Szmydynger-Chodobska J, Fox L M, Lynch K M, Zink B J, Chodobski A. Vasopressin amplifies the production of proinflammatory mediators in traumatic brain injury. J Neurotrauma 2010; 27: 1449-61. 18 Szmydynger-Chodobska J, Zink B J, Chodobski A. Multiple sites of vasopressin synthesis in the injured brain. J Cereb Blood Flow Metab 2011; 31: 47-51. 19 Struck J, Morgenthaler N G, Bergmann A. Copeptin, a stable peptide derived from the vasopressin precursor, is elevated in serum of sepsis patients. Peptides 2005; 26: 2500-4. 20 Bazarian J J, Blyth B J, He H, et al. Classification accuracy of serum Apo A-I and S100B for the diagnosis of mild traumatic brain injury and prediction of abnormal initial head computed tomography scan. J Neurotrauma 2013; 30: 1747-54. 21 Nygren De Boussard C, Fredman P, Lundin A, Andersson K, Edman G, Borg J. S100 in mild traumatic brain injury. Brain Inj 2004; 18: 671-83. 22 Terrando N, Eriksson L I, Ryu J K, et al. Resolving postoperative neuroinflammation and cognitive decline. Ann Neurol 2011; 70: 986-95. 23 Dong X Q, Huang M, Yang S B, Yu W H, Zhang Z Y. Copeptin is associated with mortality in patients with traumatic brain injury. J Trauma 2011; 71: 1194-8. 24 Roberts D J, Jenne C N, Leger C, et al. A prospective evaluation of the temporal matrix metalloproteinase response after severe traumatic brain injury in humans. J Neurotrauma 2013; 30: 1717-26. 25 Hadass O, Tomlinson B N, Gooyit M, et al. Selective inhibition of matrix metalloproteinase-9 attenuates secondary damage resulting from severe traumatic brain injury. PLoS One 2013; 8: e76904. 26 Zetterberg H, Hietala M A, Jonsson M, et al. Neurochemical aftermath of amateur boxing. Arch Neurol 2006; 63: 1277-80. 27 Venkatesan C, Chrzaszcz M, Choi N, Wainwright M S. Chronic upregulation of activated microglia immunoreactive for galectin-3/Mac-2 and nerve growth factor following diffuse axonal injury. J Neuroinflammation 2010; 7: 32. 28 Lin C C, Wang J H, Wu H W, Lee G B. Microfluidic immunoassays. JALA Charlottesv Va 2010; 15: 253-74.
Other Embodiments
(144) While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the disclosure, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
(145) The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank, NCBI, UniProt, or other submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
(146) While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the disclosure encompassed by the appended claims.