ANTI-H7CR ANTIBODIES
20180066056 ยท 2018-03-08
Assignee
Inventors
- SOLOMON LANGERMANN (GAITHERSBURG, MD, US)
- LINDA LIU (GAITHERSBURG, MD, US)
- SHENG YAO (GAITHERSBURG, MD, US)
- Lieping Chen (Baltimore, MD)
Cpc classification
A61P31/00
HUMAN NECESSITIES
C07K2319/30
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C12N15/1037
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
G01N33/577
PHYSICS
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Antibodies and humanized variants thereof and their antigen-binding fragments and other molecules that are capable of immunospecifically binding to the B7-H7 counter-receptor, and their uses in enhancing immune responses and the treatment and diagnosis of cancer and other diseases are provided.
Claims
1.-40. (canceled)
41. A method of diagnosing a disease associated with cellular or tissue expression of H7CR in a subject, the method comprising: contacting cells or tissue obtained from a biological sample of the subject to detect their ability to bind to an antibody or an antigen binding fragment thereof that specifically binds to human H7CR; wherein the antibody or an antigen-binding fragment thereof comprises: (A) three light chain CDRs having SEQ ID NOS: 29, 32, 45 and three heavy chain CDRs having SEQ ID NOS: 49, 52, and 56; (B) three light chain CDRs having SEQ ID NOS: 30, 32, 46 and three heavy chain CDRs having SEQ ID NOS: 50, 53, and 57; (C) three light chain CDRs having SEQ ID NOS: 29, 32, 47 and three heavy chain CDRs having SEQ ID NOS: 50, 54, and 58; (D) a light chain variable region having the amino acid sequence of any of SEQ ID NOS: 17-22; and a heavy chain variable region having the amino acid sequence of any of SEQ ID NOS: 23-28; or (E) a light chain variable region having the amino acid sequence of any of SEQ ID NOS: 33-38; and a heavy chain variable region having the amino acid sequence of any of SEQ ID NOS: 39-44; detecting the binding levels of the anti-H7CR antibody or an antigen binding fragment thereof to human H7CR expressed by the cells or tissue of the subject's sample relative to binding of the anti-H7CR antibody or an antigen binding fragment thereof to H7CR expressed by a control; and diagnosing an H7CR-associated disease in the subject when the binding level of the anti-H7CR antibody or an antigen binding fragment thereof to human H7CR expressed by the subject's cells or tissue is increased or decreased relative to the level of antibody binding to H7CR of the control.
42. The method of claim 41, wherein the H7CR that is specifically bound by the anti-H7CR antibody or an antigen binding fragment thereof is arrayed on the surface of a cell.
43. The method of claim 41, wherein the anti-H7CR antibody or an antigen-binding fragment thereof is detectably labeled or is directly or indirectly coupled to a detectable substance.
44. The method of claim 43, wherein the anti-H7CR antibody or an antigen-binding fragment thereof is directly or directly coupled to a detectable substance selected from one or more of an enzyme, prosthetic group, fluorescent material, luminescent material, bioluminescent material, radioactive material, positron emitting metal, or a nonradioactive paramagnetic metal ion.
45. The method of claim 41, wherein the anti-H7CR antibody or an antigen-binding fragment thereof is attached to or immobilized on a solid support.
46. The method of claim 41, wherein the binding of the anti-H7CR antibody or an antigen-binding fragment thereof to the subject's sample is detected by an immunoassay.
47. The method of claim 41, wherein the disease associated with cellular or tissue expression of H7CR is selected from cancer, an infectious disease, a chronic viral disease, or a disease affecting T cell number and growth.
48. The method of claim 47, further comprising treating the disease associated with cellular or tissue expression of H7CR in the diagnosed subject with an anti-H7CR antibody or an antigen binding fragment thereof in an amount effective to treat the disease.
49. The method of claim 48, wherein the anti-H7CR antibody or an antigen binding fragment thereof for treating the diagnosed subject comprises: (A) three light chain CDRs having SEQ ID NOS: 29, 32, 45 and three heavy chain CDRs having SEQ ID NOS: 49, 52, and 56; (B) three light chain CDRs having SEQ ID NOS: 30, 32, 46 and three heavy chain CDRs having SEQ ID NOS: 50, 53, and 57; (C) three light chain CDRs having SEQ ID NOS: 29, 32, 47 and three heavy chain CDRs having SEQ ID NOS: 50, 54, and 58; (D) a light chain variable region having the amino acid sequence of any of SEQ ID NOS: 17-22; and a heavy chain variable region having the amino acid sequence of any of SEQ ID NOS: 23-28; or (E) a light chain variable region having the amino acid sequence of any of SEQ ID NOS: 33-38; and a heavy chain variable region having the amino acid sequence of any of SEQ ID NOS: 39-44.
50. The method of claim 41, wherein the anti-H7CR antibody or an antigen binding fragment thereof is a humanized or chimeric antibody.
51. The method of claim 49, wherein the anti-H7CR antibody or an antigen binding fragment thereof is a humanized or chimeric antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
DETAILED DESCRIPTION OF THE INVENTION
[0064] Antibodies, humanized variants of antibodies and their antigen-binding fragments thereof and other molecules that are capable of immunospecifically binding to the B7-H7 counter-receptor, H7CR (also known as B7-H7CR and CD28H) and their uses in the treatment and diagnosis of cancer and other diseases are provided.
[0065] B7-H7 is expressed on antigen presenting cells; it is constitutively expressed on macrophages and inducible on dendritic cells. B7-H7 interacts with a counter-receptor (H7CR) to stimulate the immune system and immune responses (
A. B7-H7
[0066] B7-H7 was discovered through a search of Xenopus databases as a gene that exhibited significant homology to Xenopus B7-H4. The B7-H4 protein possesses 282 amino acid residues, which have been categorized as having an amino terminal extracellular domain, a large hydrophobic transmembrane domain and a very short intracellular domain (consisting of only 2 amino acid residues). Like other B7 family members, B7-H4 possesses a pair of Ig-like regions in its extracellular domain. The B7-H4 protein has an overall structure of a type I transmembrane protein.
[0067] The B7-H7 amino acid sequence was found to be similar to a previously discovered human gene, HHLA2 (human endogenous retrovirus-H long terminal repeat-associating protein 2 (HHLA2); Mager, D. L. et al. (1999) Endogenous Retroviruses Provide The Primary Polyadenylation Signal For Two New Human Genes (HHLA2 And HHLA3, Genomics 59:255-263), that had no known function (Flajnik, M. F. et al. (2012) Evolution Of The B7 Family: Co-Evolution Of B7H6 And Nkp30, Identification Of A New B 7 Family Member, B7H7, And Of B7's Historical Relationship With The MHC, Immunogenetics 64:571-590).
[0068] The human B7-H7 sequence has been found to have homologs in chicken, opossum, hoofed mammals (e.g., horse, pig), salmon, and shark. However, only pseudogenes have been thus far identified in rodents (mouse and rat). The amino acid sequences of such genes reveal a similar domain structure in all species, with conservation of the canonical residues for Ig superfamily domains.
[0069] Human B7-H7 polypeptide is 414 amino acids in length and has been reported to contain the following: a signal sequence, an extracellular domain, 3 immunoglobulin-like (Ig-like) domains, a transmembrane domain, and a cytoplasmic domain. In particular, the human B7-H7 polypeptide has been reported to contain an Ig-like V-type 1 domain, an Ig-like C-1 type domain, and an Ig-like V-type 2 domain. Multiple naturally occurring variants of B7-H7 exist (e.g., Accession No. Q9UM44-1 (homo sapiens), NP_009003 (GI:5901964, homo sapiens), and AAD48396 (GI:15726285, homo sapiens); see WO 2011/020024).
[0070] The term native-B7-H7 refers to any naturally occurring B7-H7 amino acid sequence, including immature or precursor and mature forms. Mature forms of B7-H7 include B7-H7 proteins that have been post-translationally modified, for example B7-H7 polypeptides that have had a signal or leader amino acid sequence cleaved. The amino acid sequence of a representative human B7-H7, Accession No. Q9UM44-1, is (SEQ ID NO: 1):
TABLE-US-00001 MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVI GRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDH LESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYT CYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICS VLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLN ITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVS LSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQN TIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNIS SDEYTLLTIHTVHVEPSQETASHNKGLWILVPSAILAAFL LIWSVKCCRAQLEARRSRHPADGAQQERCCVPPGERCPSA PDNGEENVPLSGKV
[0071] The human B7-H7 has been reported to contain the following predicted domains based on in silico analysis: a signal sequence at amino acid residues 1 to 22 of SEQ ID NO: 1, an Ig-like V-type 1 domain at amino acid residues 61 to 131 of SEQ ID NO: 1, an Ig-like C-1 type domain at amino acid residues 138 to 222 of SEQ ID NO: 1, an Ig-like V-type 2 domain at amino acid residues 235 to 328 of SEQ ID NO: 1, and a transmembrane domain at amino acid residues 345 to 365 of SEQ ID NO: 1. The predicted dimer interface for human B7-H7 polypeptide is amino acid residues 141-144, 156, 158, 160, 162, 193-196, 198, 200, 201, 224, and 225 of SEQ ID NO: 1. The predicted N-linked glycosylation sites for human B7-H7 polypeptide are at amino acid residues 90, 103, and 318 of SEQ ID NO: 1. Natural variations of human B7-H7 polypeptide include BOT, N344K, and S346R (UniProt Q9UM44) (see, WO 2011/020024, which reference is herein incorporated by reference in its entirety for its teaching of the structure and sequence of human B7-H7).
[0072] A DNA sequence encoding human B7-H7 (SEQ ID NO:1) is (SEQ ID NO:2):
TABLE-US-00002 atgaaggcacagacagcactgtctttcttcctcattctca taacatctctgagtggatctcaaggcatattccctttggc tttcttcatttatgttcctatgaatgaacaaatcgtcatt ggaagacttgatgaagatataattctcccttcttcatttg agaggggatccgaagtcgtaatacactggaagtatcaaga tagctataaggttcatagttactacaaaggcagtgaccat ttggaaagccaagatcccagatatgcaaacaggacacccc ttttctataatgagattcaaaatgggaatgcgtcactatt tttcagaagagtaagccttctggacgaaggaatttacacc tgctatgtaggaacagcaattcaagtgattacaaacaaag tggtgctaaaggtgggagtttttctcacacccgtgatgaa gtatgaaaagaggaacacaaacagcttcttaatatgcagc gtgttaagtgtttatcctcgtccaattatcacgtggaaaa tggacaacacacctatctctgaaaacaacatggaagaaac agggtctttggattctttttctattaacagcccactgaat attacaggatcaaattcatcttatgaatgtacaattgaaa attcactgctgaagcaaacatggacagggcgctggacgat gaaagacggccttcataaaatgcaaagtgaacacgtttca ctctcatgtcaacctgtaaatgattatttttcaccaaacc aagacttcaaagttacttggtccagaatgaaaagtgggac tttctctgtcctggcttactatctgagctcctcacaaaat acaattatcaatgaatcccgattctcatggaacaaagagc tgataaaccagagtgacttctctatgaatttgatggatct taatctttcagacagtggggaatatttatgcaatatttct tcggatgaatatactttacttaccatccacacagtgcatg tagaaccgagccaagaaacagcttcccataacaaaggctt atggattttggtgccctctgcgattttggcagcttttctg ctgatttggagcgtaaaatgttgcagagcccagctagaag ccaggaggagcagacaccctgctgatggagcccaacaaga aagatgttgtgtccctcctggtgagcgctgtcccagtgca cccgataatggcgaagaaaatgtgcctctttcaggaaaagta
[0073] In contrast to human B7-H4, which is widely expressed, human B7-H7 is found to exhibit more limited expression (e.g., expressed in the gut, kidney, lung, epithelial cells and lymphocytes). Human HHLA2 is found on chromosome 3q13.33 near B7.1 and B7.2. B7-H7 is constitutively expressed on macrophages and inducible on dendritic cells (DC).
B. H7CR
[0074] As used herein, the term native H7CR refers to any naturally occurring counter-receptor of B7-H7. H7CR is also referred to as B7-H7CR and CD28H. H7CR is expressed by T cells, NK cells, and plasmacytoid dendritic cells. The human H7CR polypeptide is otherwise referred to as transmembrane and immunoglobulin domain containing 2 (TMIGD2) in the literature/databases (Rahimi, N. et al. (Epub 2012 Mar. 14) Identification Of IGPR-1 As A Novel Adhesion Molecule Involved In Angiogenesis, Molec. Biol. Cell. 23(9):1646-1656) but the function of B7-H7CR was not previously elucidated. Non-limiting examples of Accession Nos. for the amino acid sequence of such native H7CR molecules include: Q96BF3-1 (homo sapiens), Q96BF3-2 (homo sapiens), NP_653216.1 (GI:21389429; homo sapiens) and NP_653216.2 (GI:281306838; homo sapiens). A representative amino acid sequence (Q96BF3-2) of a native H7CR molecule is provided below as SEQ ID NO:3:
TABLE-US-00003 MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQA TLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGV CGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPE LEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGS MGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPR GAPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRP CPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVG EE
[0075] A DNA sequence encoding human H7CR (SEQ ID NO:3) is (SEQ ID NO:4):
TABLE-US-00004 atggggtccccgggcatggtgctgggcctcctggtgcaga tctgggccctgcaagaagcctcaagcctgagcgtgcagca ggggcccaacttgctgcaggtgaggcagggcagtcaggcg accctggtctgccaggtggaccaggccacagcctgggaac ggctccgtgttaagtggacaaaggatggggccatcctgtg tcaaccgtacatcaccaacggcagcctcagcctgggggtc tgcgggccccagggacggctctcctggcaggcacccagcc atctcaccctgcagctggaccctgtgagcctcaaccacag cggggcgtacgtgtgctgggcggccgtagagattcctgag ttggaggaggctgagggcaacataacaaggctctttgtgg acccagatgaccccacacagaacagaaaccggatcgcaag cttcccaggattcctcttcgtgctgctgggggtgggaagc atgggtgtggctgcgatcgtgtggggtgcctggttctggg gccgccgcagctgccagcaaagggactcaggtaacagccc aggaaatgcattctacagcaacgtcctataccggccccgg ggggccccaaagaagagtgaggactgctctggagagggga aggaccagaggggccagagcatttattcaacctccttccc gcaaccggccccccgccagccgcacctggcgtcaagaccc tgccccagcccgagaccctgccccagccccaggcccggcc accccgtctctatggtcagggtctctcctagaccaagccc cacccagcagccgaggccaaaagggttccccaaagtggga gaggag
C. Definitions
[0076] As used herein, a molecule is said to be able to immunospecifically bind a second molecule if such binding exhibits the specificity and affinity of an antibody to its cognate antigen. Antibodies are said to be capable of immunospecifically binding to a target region or conformation (epitope) of an antigen (and in particular, the antigen H7CR) if such binding involves the antigen recognition site of the immunoglobulin molecule. An antibody that immunospecifically binds to a particular antigen may bind to other antigens with lower affinity if the other antigen has some sequence or conformational similarity that is recognized by the antigen recognition site as determined by, e.g., immunoassays, BIACORE assays, or other assays known in the art, but would not bind to a totally unrelated antigen. Preferably, however, antibodies (and their antigen binding fragments) will not cross-react with other antigens. Antibodies may also bind to other molecules in a way that is not immunospecific, such as to Fc receptors (FcR), by virtue of binding domains in other regions/domains of the molecule that do not involve the antigen recognition site, such as the Fc region.
[0077] The term substantially, as used in the context of binding or exhibited effect, is intended to denote that the observed effect is physiologically or therapeutically relevant. Thus, for example, a molecule is able to substantially block an activity of H7CR if the extent of blockage is physiologically or therapeutically relevant (for example if such extent is greater than 60% complete, greater than 70% complete, greater than 75% complete, greater than 80% complete, greater than 85% complete, greater than 90% complete, greater than 95% complete, or greater than 97% complete). Similarly, a molecule is said to have substantially the same immunospecificity and/or characteristic as another molecule, if such immunospecificities and characteristics are greater than 60% identical, greater than 70% identical, greater than 75% identical, greater than 80% identical, greater than 85% identical, greater than 90% identical, greater than 95% identical, or greater than 97% identical).
[0078] As used herein, the term subject is intended to denote a mammal such as a non-primate (e.g., cows, pigs, horses, cats, dogs, rats etc.) and a primate (e.g., monkey and human), most preferably a human. The term patient is intended to denote a subject receiving a disclosed composition for a diagnostic, therapeutic or prophylactic purpose.
[0079] As used herein, the term antibody is intended to denote an immunoglobulin molecule that possesses a variable region antigen recognition site. The term variable region is intended to distinguish such domain of the immunoglobulin from domains that are broadly shared by antibodies (such as an antibody Fc domain). The variable region includes a hypervariable region whose residues are responsible for antigen binding. The hypervariable region includes amino acid residues from a Complementarity Determining Region or CDR (i.e., typically at approximately residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and at approximately residues 27-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)) and/or those residues from a hypervariable loop (i.e., residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Chothia and Lesk, 1987, J. Mol. Biol. 196:901-917). Framework Region or FR residues are those variable domain residues other than the hypervariable region residues as herein defined. The term antibody includes monoclonal antibodies, multi-specific antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, camelized antibodies (See e.g., Muyldermans et al., 2001, Trends Biochem. Sci. 26:230; Nuttall et al., 2000, Cur. Pharm. Biotech. 1:253; Reichmann and Muyldermans, 1999, J. Immunol. Meth. 231:25; International Publication Nos. WO 94/04678 and WO 94/25591; U.S. Pat. No. 6,005,079), single-chain Fvs (scFv) (see, e.g., see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315 (1994)), single chain antibodies, disulfide-linked Fvs (sdFv), intrabodies, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id and anti-anti-Id antibodies to antibodies disclosed herein). In particular, such antibodies include immunoglobulin molecules of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1 and IgA.sub.2) or subclass.
[0080] As used herein, the term antigen binding fragment of an antibody refers to one or more portions of an antibody that contain the antibody's Complementarity Determining Regions (CDRs) and optionally the framework residues that include the antibody's variable region antigen recognition site, and exhibit an ability to immunospecifically bind antigen. Such fragments include Fab, F(ab).sub.2, Fv, single chain (ScFv),and mutants thereof, naturally occurring variants, and fusion proteins including the antibody's variable region antigen recognition site and a heterologous protein (e.g., a toxin, an antigen recognition site for a different antigen, an enzyme, a receptor or receptor ligand, etc.). As used herein, the term fragment refers to a peptide or polypeptide including an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, or at least 250 contiguous amino acid residues.
[0081] Human, chimeric or humanized antibodies are particularly preferred for in vivo use in humans, however, murine antibodies or antibodies of other species may be advantageously employed for many uses (for example, in vitro or in situ detection assays, acute in vivo use, etc.). Completely human antibodies are particularly desirable for therapeutic treatment of human subjects.
[0082] Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences (see U.S. Pat. Nos. 4,444,887 and 4,716,111; and International Publication Nos. WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741). Human antibodies can be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes. For example, the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells. Alternatively, the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes. The mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the J.sub.H region prevents endogenous antibody production. The modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice. The chimeric mice are then bred to produce homozygous offspring which express human antibodies. The transgenic mice are immunized using conventional methodologies with a selected antigen, e.g., all or a portion of a polypeptide. Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology (see, e.g., U.S. Pat. No. 5,916,771). The human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation. Thus, using such a technique, it is possible to produce therapeutically useful IgG, IgA, IgM and IgE antibodies. For an overview of this technology for producing human antibodies, see Lonberg and Huszar (1995, Int. Rev. Immunol. 13:65-93, which is incorporated herein by reference in its entirety). For a detailed discussion of this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies, see, e.g., International Publication Nos. WO 98/24893, WO 96/34096, and WO 96/33735; and U.S. Pat. Nos. 5,413,923, 5,625,126, 5,633,425, 5,569,825, 5,661,016, 5,545,806, 5,814,318, and 5,939,598, which are incorporated by reference herein in their entirety. In addition, companies such as Abgenix, Inc. (Freemont, Calif.) and Medarex (Princeton, N.J.) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.
[0083] A chimeric antibody is a molecule in which different portions of the antibody are derived from different immunoglobulin molecules such as antibodies having a variable region derived from a non-human antibody and a human immunoglobulin constant region. Methods for producing chimeric antibodies are known in the art. See e.g., Morrison, 1985, Science 229:1202; Oi et al., 1986, BioTechniques 4:214; Gillies et al., 1989, J. Immunol. Methods 125:191-202; and U.S. Pat. Nos. 6,311,415, 5,807,715, 4,816,567, and 4,816,397. Chimeric antibodies containing one or more CDRs from a non-human species and framework regions from a human immunoglobulin molecule can be produced using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; International Publication No. WO 91/09967; and U.S. Pat. Nos. 5,225,539, 5,530,101, and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering 7:805; and Roguska et al., 1994, Proc. Natl. Acad. Sci. USA 91:969), and chain shuffling (U.S. Pat. No. 5,565,332).
[0084] Humanized antibodies are known in the art (see, e.g., European Patent Nos. EP 239,400, EP 592,106, and EP 519,596; International Publication Nos. WO 91/09967 and WO 93/17105; U.S. Pat. Nos. 5,225,539, 5,530,101, 5,565,332, 5,585,089, 5,766,886, and 6,407,213; and Padlan, 1991, Molecular Immunology 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering 7(6):805-814; Roguska et al., 1994, PNAS 91:969-973; Tan et al., 2002, J. Immunol. 169:1119-1125; Caldas et al., 2000, Protein Eng. 13:353-360; Morea et al., 2000, Methods 20:267-79; Baca et al., 1997, J. Biol. Chem. 272:10678-10684; Roguska et al., 1996, Protein Eng. 9:895-904; Couto et al., 1995, Cancer Res. 55 (23 Supp):5973s-5977s; Couto et al., 1995, Cancer Res. 55:1717-22; Sandhu, 1994, Gene 150:409-10; Pedersen et al., 1994, J. Mol. Biol. 235:959-973; Jones et al., 1986, Nature 321:522-525; Reichmann et al., 1988, Nature 332:323-329; and Presta, 1992, Curr. Op. Struct. Biol. 2:593-596). As used herein, the term humanized antibody refers to an immunoglobulin including a human framework region and one or more CDR's from a non-human (usually a mouse or rat) immunoglobulin. The non-human immunoglobulin providing the CDR's is called the donor and the human immunoglobulin providing the framework is called the acceptor. Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, preferably about 95% or more identical. Hence, all parts of a humanized immunoglobulin, except possibly the CDR's, are substantially identical to corresponding parts of natural human immunoglobulin sequences. A humanized antibody is an antibody containing a humanized light chain and a humanized heavy chain immunoglobulin. For example, a humanized antibody would not encompass a typical chimeric antibody, because, e.g., the entire variable region of a chimeric antibody is non-human. A donor antibody has been humanized, by the process of humanization, because the resultant humanized antibody is expected to bind to the same antigen as the donor antibody that provides the CDR's. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a non-human species (donor antibody) such as mouse, rat, rabbit or a non-human primate having the desired specificity, affinity, and capacity. In some instances, Framework Region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may include residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will include substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin that immunospecifically binds to an FcRIIB polypeptide, that has been altered by the introduction of amino acid residue substitutions, deletions or additions (i.e., mutations).
[0085] Human, chimeric or humanized derivatives of anti-human H7CR antibodies are particularly preferred for in vivo use in humans, however, murine antibodies or antibodies of other species may be advantageously employed for many uses (for example, in vitro or in situ detection assays, acute in vivo use, etc.). Such a human or humanized antibody includes amino acid residue substitutions, deletions or additions in one or more non-human CDRs. The humanized antibody derivative may have substantially the same binding, stronger binding or weaker binding when compared to a non-derivative humanized antibody. In specific embodiments, one, two, three, four, or five amino acid residues of the CDR have been substituted, deleted or added (i.e., mutated). Completely human antibodies are particularly desirable for therapeutic treatment of human subjects.
[0086] Such human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences (see U.S. Pat. Nos. 4,444,887 and 4,716,111; and International Publication Nos. WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741). Such human antibodies can be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes. For example, the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells. Alternatively, the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes. The mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the J.sub.H region prevents endogenous antibody production. The modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice. The chimeric mice are then bred to produce homozygous offspring which express human antibodies. The transgenic mice are immunized using conventional methodologies with a selected antigen, e.g., all or a portion of a polypeptide. Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology (see, e.g., U.S. Pat. No. 5,916,771). The human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation. Thus, using such a technique, it is possible to produce therapeutically useful IgG, IgA, IgM and IgE antibodies. For an overview of this technology for producing human antibodies, see Lonberg and Huszar (1995, Int. Rev. Immunol. 13:65-93, which is incorporated herein by reference in its entirety). For a detailed discussion of this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies, see, e.g., International Publication Nos. WO 98/24893, WO 96/34096, and WO 96/33735; and U.S. Pat. Nos. 5,413,923, 5,625,126, 5,633,425, 5,569,825, 5,661,016, 5,545,806, 5,814,318, and 5,939,598, which are incorporated by reference herein in their entirety. In addition, companies such as Abgenix, Inc. (Freemont, Calif.) and Medarex (Princeton, N.J.) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.
[0087] The antibodies used in the disclosed methods may be monospecific. Also of interest are bispecific antibodies, trispecific antibodies or antibodies of greater multispecificity that exhibit specificity to different targets in addition to H7CR, such as other molecules of the immune system. For example, such antibodies may bind to both H7CR and to an antigen that is important for targeting the antibody to a particular cell type or tissue (for example, to an antigen associated with a cancer antigen of a tumor being treated). In another embodiment, such multispecific antibody binds to both B7-H7 and to H7CR, and thus serves to promote association of cells possessing such molecules to thereby agonize T cell responses. Such molecules have particular utility in the treatment of cancer and infectious disease. In another embodiment, such multispecific antibody binds to molecules (receptors or ligands) involved in alternative or supplemental immunomodulatory pathways, such as CTLA4, TIM3, TIM4, OX40, CD40, GITR, 4-1-BB, B7-H4, LIGHT or LAG3, in order to enhance the immunomodulatory effects. Furthermore, the multispecific antibody may bind to effecter molecules such as cytokines (e.g., IL-7, IL-15, IL-12, IL-4 TGF-beta, IL-10, IL-17, IFNg, Flt3, BLys) and chemokines (e.g., CCL21), which may be particularly relevant for modulating both acute and chronic immune responses.
[0088] DNA sequences coding for preferred human acceptor framework sequences include but are not limited to FR segments from the human germline VH segment VH1-18 and JH6 and the human germline VL segment VK-A26 and JK4. In a specific embodiment, one or more of the CDRs are inserted within framework regions using routine recombinant DNA techniques. The framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions (see, e.g., Chothia et al., 1998, Structural Determinants In The Sequences Of Immunoglobulin Variable Domain, J. Mol. Biol. 278:457-479 for a listing of human framework regions).
[0089] The disclosed humanized or chimeric antibody may contain substantially all of at least one, and typically two, variable domains in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. Preferably, the antibody also includes at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. The constant domains of the antibodies may be selected with respect to the proposed function of the antibody, in particular the effector function which may be required. In some embodiments, the constant domains of the antibodies are (or include) human IgA, IgD, IgE, IgG or IgM domains. In a specific embodiment, human IgG constant domains, especially of the IgG1 and IgG3 isotypes are used, when the humanized antibodies are intended for therapeutic uses and antibody effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) activity are needed. In alternative embodiments, IgG2 and IgG4 isotypes are used when the antibody is intended for therapeutic purposes and antibody effector function is not required. The Fc constant domains of the antibodies can include one or more amino acid modifications which alter antibody effector functions such as those disclosed in U.S. Patent Application Publication Nos. 2005/0037000 and 2005/0064514.
[0090] In some embodiments, the antibody contains both the light chain as well as at least the variable domain of a heavy chain. In other embodiments, the antibody may further include one or more of the CHI, hinge, CH2, CH3, and CH4 regions of the heavy chain. The antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgG.sub.1, IgG.sub.2, IgG.sub.3 and IgG.sub.4. In some embodiments, the constant domain is a complement fixing constant domain where it is desired that the antibody exhibit cytotoxic activity, and the class is typically IgG.sub.1. In other embodiments, where such cytotoxic activity is not desirable, the constant domain may be of the IgG.sub.2 class. The antibody may include sequences from more than one class or isotype, and selecting particular constant domains to optimize desired effector functions is within the ordinary skill in the art.
[0091] In a specific aspect, the present disclosure provides an Fc variant, wherein the Fc region includes at least one modification (e.g., amino acid substitutions, amino acid insertions, amino acid deletions) at one or more positions selected from the group consisting of 228, 234, 235 and 331 as numbered by the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In one aspect, the modification is at least one substitution selected from the group consisting of 228P, 234F, 235E, 235F, 235Y, and 331S as numbered by the EU index as set forth in Kabat.
[0092] In another specific aspect, the present disclosure provides an Fc variant, wherein the Fc region is an IgG4 Fc region and includes at least one modification at one or more positions selected from the group consisting of 228 and 235 as numbered by the EU index as set forth in Kabat. In still another specific aspect, the Fc region is an IgG4 Fc region and the non-naturally occurring amino acids are selected from the group consisting of 228P, 235E and 235Y as numbered by the EU index as set forth in Kabat.
[0093] In another specific aspect, the present disclosure provides an Fc variant, wherein the Fc region includes at least one non-naturally occurring amino acid at one or more positions selected from the group consisting of 239, 330 and 332 as numbered by the EU index as set forth in Kabat. In one aspect, the modification is at least one substitution selected from the group consisting of 239D, 330L, 330Y, and 332E as numbered by the EU index as set forth in Kabat. See, U.S. Pat. No. 7,317,091, incorporated herein by referenced in its entirety.
[0094] In a specific aspect, the present disclosure provides an Fc variant 1, wherein the Fc region includes at least one non-naturally occurring amino acid at one or more positions selected from the group consisting of 252, 254, and 256 as numbered by the EU index as set forth in Kabat. In one aspect, the modification is at least one substitution selected from the group consisting of 252Y, 254T and 256E as numbered by the EU index as set forth in Kabat. See, U.S. Pat. No. 7,083,784, incorporated herein by reference in its entirety.
[0095] In certain aspects, the present disclosure provides an Fc variant, wherein the Fc region includes a non-naturally occurring amino acid at position 428 as numbered by the EU index as set forth in Kabat. In one aspect, the modification at position 428 is selected from the group consisting of 428T, 428L, 428F, and 428S as numbered by the EU index as set forth in Kabat. See, U.S. Pat. No. 7,670,600, incorporated herein by reference in its entirety. In another aspect, an Fc variant may further includes a non-naturally occurring amino acid at position 434 as numbered by the EU index as set forth in Kabat. In one aspect, the modification at position 434 is selected from the group consisting of 434A, 434S, and 434F as numbered by the EU index as set forth in Kabat. In other aspects, the present disclosure provides an Fc variant, wherein the Fc region includes a non-naturally occurring amino acid at positions 428 and 434 as numbered by the EU index as set forth in Kabat. In a specific aspect, the Fc region includes 428L, 434S. See, U.S. Pat. No. 8,088,376.
[0096] The framework and CDR regions of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor CDR or the consensus framework may be mutagenized by substitution, insertion or deletion of at least one residue so that the CDR or framework residue at that site does not correspond to either the consensus or the donor antibody. Such mutations, however, are preferably not extensive. Usually, at least 75% of the humanized antibody residues will correspond to those of the parental framework region (FR) and CDR sequences, more often 90%, and most preferably greater than 95%. Humanized antibodies can be produced using variety of techniques known in the art, including, but not limited to, CDR-grafting (European Patent No. EP 239,400; International Publication No. WO 91/09967; and U.S. Pat. Nos. 5,225,539, 5,530,101, and 5,585,089), veneering or resurfacing (European Patent Nos. EP 592,106 and EP 519,596; Padlan, 1991, Molecular Immunology 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering 7(6):805-814; and Roguska et al., 1994, Proc. Natl. Acad. Sci. 91:969-973), chain shuffling (U.S. Pat. No. 5,565,332), and techniques disclosed in, e.g., U.S. Pat. Nos. 6,407,213, 5,766,886, 5,585,089, International Publication No. WO 9317105, Tan et al., 2002, J. Immunol. 169:1119-25, Caldas et al., 2000, Protein Eng. 13:353-60, Morea et al., 2000, Methods 20:267-79, Baca et al., 1997, J. Biol. Chem. 272:10678-84, Roguska et al., 1996, Protein Eng. 9:895-904, Couto et al., 1995, Cancer Res. 55 (23 Supp):5973s-5977s, Couto et al., 1995, Cancer Res. 55:1717-22, Sandhu, 1994, Gene 150:409-10, Pedersen et al., 1994, J. Mol. Biol. 235:959-73, Jones et al., 1986, Nature 321:522-525, Riechmann et al., 1988, Nature 332:323, and Presta, 1992, Curr. Op. Struct. Biol. 2:593-596. Often, framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089; U.S. Publication Nos. 2004/0049014 and 2003/0229208; U.S. Pat. Nos. 6,350,861; 6,180,370; 5,693,762; 5,693,761; 5,585,089; and 5,530,101 and Riechmann et al., 1988, Nature 332:323).
[0097] The antibodies may be produced by any method known in the art useful for the production of polypeptides, e.g., in vitro synthesis, recombinant DNA production, and the like. Preferably, the humanized antibodies are produced by recombinant DNA technology. The antibodies may be produced using recombinant immunoglobulin expression technology. The recombinant production of immunoglobulin molecules, including humanized antibodies are described in U.S. Pat. No. 4,816,397 (Boss et al.), U.S. Pat. Nos. 6,331,415 and 4,816,567 (both to Cabilly et al.), U.K. patent GB 2,188,638 (Winter et al.), and U.K. patent GB 2,209,757. Techniques for the recombinant expression of immunoglobulins, including humanized immunoglobulins, can also be found, in Goeddel et al., Gene Expression Technology Methods in Enzymology Vol. 185 Academic Press (1991), and Borreback, Antibody Engineering, W. H. Freeman (1992). Additional information concerning the generation, design and expression of recombinant antibodies can be found in Mayforth, Designing Antibodies, Academic Press, San Diego (1993).
[0098] An exemplary process for the production of the recombinant chimeric antibodies may include the following: a) constructing, by conventional molecular biology methods, an expression vector that encodes and expresses an antibody heavy chain in which the CDRs and variable region of a murine anti-human H7CR monoclonal antibody are fused to an Fc region derived from a human immunoglobulin, thereby producing a vector for the expression of a chimeric antibody heavy chain; b) constructing, by conventional molecular biology methods, an expression vector that encodes and expresses an antibody light chain of the murine anti-human H7CR monoclonal antibody, thereby producing a vector for the expression of chimeric antibody light chain; c) transferring the expression vectors to a host cell by conventional molecular biology methods to produce a transfected host cell for the expression of chimeric antibodies; and d) culturing the transfected cell by conventional cell culture techniques so as to produce chimeric antibodies.
[0099] An exemplary process for the production of the recombinant humanized antibodies may include the following: a) constructing, by conventional molecular biology methods, an expression vector that encodes and expresses an anti-human H7CR heavy chain in which the CDRs and a minimal portion of the variable region framework that are required to retain donor antibody binding specificity are derived from a non-human immunoglobulin, such as a murine anti-human H7CR monoclonal antibody, and the remainder of the antibody is derived from a human immunoglobulin, thereby producing a vector for the expression of a humanized antibody heavy chain; b) constructing, by conventional molecular biology methods, an expression vector that encodes and expresses an antibody light chain in which the CDRs and a minimal portion of the variable region framework that are required to retain donor antibody binding specificity are derived from a non-human immunoglobulin, such as a murine anti-human H7CR monoclonal antibody, and the remainder of the antibody is derived from a human immunoglobulin, thereby producing a vector for the expression of humanized antibody light chain; c) transferring the expression vectors to a host cell by conventional molecular biology methods to produce a transfected host cell for the expression of humanized antibodies; and d) culturing the transfected cell by conventional cell culture techniques so as to produce humanized antibodies.
[0100] With respect to either exemplary method, host cells may be co-transfected with such expression vectors, which may contain different selectable markers but, with the exception of the heavy and light chain coding sequences, are preferably identical. This procedure provides for equal expression of heavy and light chain polypeptides. Alternatively, a single vector may be used which encodes both heavy and light chain polypeptides. The coding sequences for the heavy and light chains may include cDNA or genomic DNA or both. The host cell used to express the recombinant antibody may be either a bacterial cell such as Escherichia coli, or more preferably a eukaryotic cell (e.g., a Chinese hamster ovary (CHO) cell or a HEK-293 cell). The choice of expression vector is dependent upon the choice of host cell, and may be selected so as to have the desired expression and regulatory characteristics in the selected host cell. Other cell lines that may be used include, but are not limited to, CHO-K1, NSO, and PER.C6 (Crucell, Leiden, Netherlands).
[0101] Any of the disclosed antibodies can be used to generate anti-idiotype antibodies using techniques well known to those skilled in the art (see, e.g., Greenspan, N. S. et al. (1989) Idiotypes: Structure And Immunogenicity, FASEB J. 7:437-444; and Nisinoff, A. (1991) Idiotypes: Concepts And Applications, J. Immunol. 147(8):2429-2438).
[0102] The binding properties of the disclosed antibodies can, if desired, be further improved by screening for variants that exhibit such desired characteristics. For example, such antibodies can be generated using various phage display methods known in the art. In phage display methods, functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them. In a particular embodiment, such phage can be utilized to display antigen binding domains, such as Fab and Fv or disulfide-bond stabilized Fv, expressed from a repertoire or combinatorial antibody library (e.g., human or murine). Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Phage used in these methods are typically filamentous phage, including fd and M13. The antigen binding domains are expressed as a recombinantly fused protein to either the phage gene III or gene VIII protein. Examples of phage display methods that can be used to make the immunoglobulins, or fragments thereof, include those disclosed in Brinkman, U. et al. (1995) Phage Display Of Disulfide-Stabilized Fv Fragments, J. Immunol. Methods, 182:41-50, 1995; Ames, R. S. et al. (1995) Conversion Of Murine Fabs Isolated From A Combinatorial Phage Display Library To Full Length Immunoglobulins, J. Immunol. Methods, 184:177-186; Kettleborough, C. A. et al. (1994) Isolation Of Tumor Cell-Specific Single-Chain Fv From Immunized Mice Using Phage Antibody Libraries And The Re-Construction Of Whole Antibodies From These Antibody Fragments, Eur. J. Immunol, 24:952-958, 1994; Persic, L. et al. (1997) An Integrated Vector System For The Eukaryotic Expression Of Antibodies Or Their Fragments After Selection From Phage Display Libraries, Gene, 187:9-18; Burton, D. R. et al. (1994) Human Antibodies From Combinatorial Libraries, Adv. Immunol. 57:191-280; PCT Publications WO 92/001047; WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969, 108.
[0103] As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including humanized antibodies, or any other desired fragments, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described in detail below. For example, techniques to recombinantly produce Fab, Fab and F(ab).sub.2 fragments can also be employed using methods known in the art (such as those disclosed in PCT Publication WO 92/22324; Mullinax, R. L. et al. (1992) Expression Of A Heterodimeric Fab Antibody Protein In One Cloning Step, BioTechniques, 12(6):864-869; and Sawai et al. (1995) Direct Production Of The Fab Fragment Derived From The Sperm Immobilizing Antibody Using Polymerase Chain Reaction And cDNA Expression Vectors, Am. J. Reprod. Immunol. 34:26-34; and Better, M. et al. (1988) Escherichia coli Secretion Of An Active Chimeric Antibody Fragment, Science 240:1041-1043). Examples of techniques which can be used to produce single-chain Fvs and antibodies include those described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston, J. S. et al. (1991) Protein Engineering Of Single-Chain Fv Analogs And Fusion Proteins, Methods in Enzymology 203:46-88; Shu, L. et al., Secretion Of A Single-Gene-Encoded Immunoglobulin From Myeloma Cells, Proc. Natl. Acad. Sci. (USA) 90:7995-7999; and Skerra. A. et al. (1988) Assembly Of A Functional Immunoglobulin Fv Fragment In Escherichia coli, Science 240:1038-1040.
[0104] Phage display technology can be used to increase the affinity of the disclosed antibodies for H7CR. This technique would be useful in obtaining high affinity antibodies that could be used in the combinatorial methods. This technology, referred to as affinity maturation, employs mutagenesis or CDR walking and re-selection using such receptors or ligands (or their extracellular domains) or an antigenic fragment thereof to identify antibodies that bind with higher affinity to the antigen when compared with the initial or parental antibody (See, e.g., Glaser, S. M. et al. (1992) Antibody Engineering By Codon-Based Mutagenesis In A Filamentous Phage Vector System, J. Immunol. 149:3903-3913). Mutagenizing entire codons rather than single nucleotides results in a semi-randomized repertoire of amino acid mutations. Libraries can be constructed consisting of a pool of variant clones each of which differs by a single amino acid alteration in a single CDR and which contain variants representing each possible amino acid substitution for each CDR residue. Mutants with increased binding affinity for the antigen can be screened by contacting the immobilized mutants with labeled antigen. Any screening method known in the art can be used to identify mutant antibodies with increased avidity to the antigen (e.g., ELISA) (see, e.g., Wu, H. et al. (1998) Stepwise In Vitro Affinity Maturation Of Vitaxin, An Alphav Beta3-Specific Humanized Mab, Proc. Natl. Acad. Sci. (USA) 95(11):6037-6042; Yelton, D. E. et al. (1995) Affinity Maturation Of The BR96 Anti-Carcinoma Antibody By Codon-Based Mutagenesis, J. Immunol. 155:1994-2004). CDR walking which randomizes the light chain may be used possible (see, Schier et al. (1996) Isolation Of Picomolar Affinity Anti-C-Erbb-2 Single-Chain Fv By Molecular Evolution Of The Complementarity Determining Regions In The Center Of The Antibody Binding Site, J. Mol. Biol. 263:551-567).
[0105] Random mutagenesis can also be used to identify improved CDRs. Phage display technology can alternatively be used to increase (or decrease) CDR affinity. This technology, referred to as affinity maturation, employs mutagenesis or CDR walking and re-selection uses the target antigen or an antigenic fragment thereof to identify antibodies having CDRs that bind with higher (or lower) affinity to the antigen when compared with the initial or parental antibody (see, e.g., Glaser, S. M. et al. (1992) Antibody Engineering By Codon-Based Mutagenesis In A Filamentous Phage Vector System, J. Immunol. 149:3903-3913). Mutagenizing entire codons rather than single nucleotides results in a semi-randomized repertoire of amino acid mutations. Libraries can be constructed consisting of a pool of variant clones each of which differs by a single amino acid alteration in a single CDR and which contain variants representing each possible amino acid substitution for each CDR residue. Mutants with increased (or decreased) binding affinity for the antigen can be screened by contacting the immobilized mutants with labeled antigen. Any screening method known in the art can be used to identify mutant antibodies with increased (or decreased) avidity to the antigen (e.g., ELISA) (see, Wu, H. et al. (1998) Stepwise In Vitro Affinity Maturation Of Vitaxin, An Alphav Beta3-Specific Humanized Mab, Proc. Natl. Acad. Sci. (USA) 95(11):6037-6042; Yelton, D. E. et al. (1995) Affinity Maturation Of The BR96 Anti-Carcinoma Antibody By Codon-Based Mutagenesis, J. Immunol. 155:1994-2004). CDR walking which randomizes the light chain may be used possible (see, Schier et al. (1996) Isolation Of Picomolar Affinity Anti-C-Erbb-2 Single-Chain Fv By Molecular Evolution Of The Complementarity Determining Regions In The Center Of The Antibody Binding Site, J. Mol. Biol. 263:551-567).
[0106] Methods for accomplishing such affinity maturation are described for example in: Krause, J. C. et al. (2011) An Insertion Mutation That Distorts Antibody Binding Site Architecture Enhances Function Of A Human Antibody, MBio. 2(1) pii: e00345-10. doi: 10.1128/mBio.00345-10; Kuan, C. T. et al. (2010) Affinity-Matured Anti-Glycoprotein NMB Recombinant Immunotoxins Targeting Malignant Gliomas And Melanomas, Int. J. Cancer 10.1002/ijc.25645; Hackel, B. J. et al. (2010) Stability And CDR Composition Biases Enrich Binder Functionality Landscapes, J. Mol. Biol. 401(1):84-96; Montgomery, D. L. et al. (2009) Affinity Maturation And Characterization Of A Human Monoclonal Antibody Against HIV-1 gp41, MAbs 1(5):462-474; Gustchina, E. et al. (2009) Affinity Maturation By Targeted Diversification Of The CDR-H2 Loop Of A Monoclonal Fab Derived From A Synthetic Nave Human Antibody Library And Directed Against The Internal Trimeric Coiled-Coil Of Gp41 Yields A Set Of Fabs With Improved HIV-1 Neutralization Potency And Breadth, Virology 393(1):112-119; Finlay, W. J. et al. (2009) Affinity Maturation Of A Humanized Rat Antibody For Anti-RAGE Therapy: Comprehensive Mutagenesis Reveals A High Level Of Mutational Plasticity Both Inside And Outside The Complementarity-Determining Regions, J. Mol. Biol. 388(3):541-558; Bostrom, J. et al. (2009) Improving Antibody Binding Affinity And Specificity For Therapeutic Development, Methods Mol. Biol. 525:353-376; Steidl, S. et al. (2008) In Vitro Affinity Maturation Of Human GM-CSF Antibodies By Targeted CDR-Diversification, Mol. Immunol. 46(1):135-144; and Barderas, R. et al. (2008) Affinity maturation of antibodies assisted by in silico modeling, Proc. Natl. Acad. Sci. (USA) 105(26):9029-9034.
[0107] The production and use of derivatives of any of the above-described antibodies and their antigen-binding fragments are also provided.
[0108] The term derivative refers to an antibody or antigen-binding fragment thereof that immunospecifically binds to an antigen but which includes, one, two, three, four, five or more amino acid substitutions, additions, deletions or modifications relative to a parental (or wild-type) molecule. Such amino acid substitutions or additions may introduce naturally occurring (i.e., DNA-encoded) or non-naturally occurring amino acid residues. The term derivative encompasses, for example, chimeric or humanized variants of any of antibodies 1.3, 4.5 or 7.8, as well as variants having altered CH1, hinge, CH2, CH3 or CH4 regions, so as to form, for example antibodies, etc., having variant Fc regions that exhibit enhanced or impaired effector or binding characteristics. The term derivative additionally encompasses non amino acid modifications, for example, amino acids that may be glycosylated (e.g., have altered mannose, 2-N-acetylglucosamine, galactose, fuctose, glucose, sialic acid, 5-N-acetylneuraminic acid, 5-glycolneuraminic acid, etc. content), acetylated, pegylated, phosphorylated, amidated, derivatized by known protecting/blocking groups, proteolytic cleavage, linked to a cellular ligand or other protein, etc. In some embodiments, the altered carbohydrate modifications modulate one or more of the following: solubilization of the antibody, facilitation of subcellular transport and secretion of the antibody, promotion of antibody assembly, conformational integrity, and antibody-mediated effector function. In a specific embodiment the altered carbohydrate modifications enhance antibody mediated effector function relative to the antibody lacking the carbohydrate modification. Carbohydrate modifications that lead to altered antibody mediated effector function are well known in the art (for example, see Shields, R. L. et al. (2002) Lack Of Fucose On Human IgG N-Linked Oligosaccharide Improves Binding To Human Fcgamma Pill And Antibody-Dependent Cellular Toxicity, J. Biol. Chem. 277(30):26733-26740; Davies J. et al. (2001) Expression Of GnTIII In A Recombinant Anti-CD20 CHO Production Cell Line: Expression Of Antibodies With Altered Glycoforms Leads To An Increase In ADCC Through Higher Affinity For FC Gamma RIII, Biotechnology & Bioengineering 74(4): 288-294). Methods of altering carbohydrate contents are known to those skilled in the art, see, e.g., Wallick, S. C. et al. (1988) Glycosylation Of A VH Residue Of A Monoclonal Antibody Against Alpha (1-6) Dextran Increases Its Affinity For Antigen, J. Exp. Med. 168(3): 1099-1109; Tao, M. H. et al. (1989) Studies Of Aglycosylatod Chimeric Mouse-Human IgG. Role Of Carbohydrate In The Structure And Effector Functions Mediated By The Human IgG Constant Region, J. Immunol. 143(8):2595-2601; Routledge, E. G. et al. (1995) The Effect Of Aglycosylation On The Immunogenicity Of A Humanized Therapeutic CD3 Monoclonal Antibody, Transplantation 60(8):847-53; Elliott, S. et al. (2003) Enhancement Of Therapeutic Protein In Vivo Activities Through Glycoengineering, Nature Biotechnol. 21:414-21; Shields, R. L. et al. (2002) Lack Of Fucose On Human IgG N-Linked Oligosaccharide Improves Binding To Human Fcgamma RIII And Antibody-Dependent Cellular Toxicity, J. Biol. Chem. 277(30):26733-26740).
[0109] In some embodiments, a humanized antibody is a derivative. Such a humanized antibody includes amino acid residue substitutions, deletions or additions in one or more non-human CDRs. The humanized antibody derivative may have substantially the same binding, better binding, or worse binding when compared to a non-derivative humanized antibody. In specific embodiments, one, two, three, four, or five amino acid residues of the CDR have been substituted, deleted or added (i.e., mutated).
[0110] A derivative antibody or antibody fragment may be modified by chemical modifications using techniques known to those of skill in the art, including, but not limited to, specific chemical cleavage, acetylation, formulation, metabolic synthesis of tunicamycin, etc. In one embodiment, an antibody derivative will possess a similar or identical function as the parental antibody. In another embodiment, an antibody derivative will exhibit an altered activity relative to the parental antibody. For example, a derivative antibody (or fragment thereof) can bind to its epitope more tightly or be more resistant to proteolysis than the parental antibody.
[0111] Substitutions, additions or deletions in the derivatized antibodies may be in the Fc region of the antibody and may thereby serve to modify the binding affinity of the antibody to one or more FcR. Methods for modifying antibodies with modified binding to one or more FcR are known in the art, see, e.g., PCT Publication Nos. WO 04/029207, WO 04/029092, WO 04/028564, WO 99/58572, WO 99/51642, WO 98/23289, WO 89/07142, WO 88/07089, and U.S. Pat. Nos. 5,843,597 and 5,642,821. Some embodiments encompass antibodies whose Fc region will have been deleted (for example, an Fab or F(ab)2, etc.) or modified so that the molecule will exhibit diminished or no Fc receptor (FcR) binding activity, or will exhibit enhanced antibody-dependent cell-mediated cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC) activities. Some embodiments, encompasses antibodies that have altered affinity for an activating FcR, e.g., FcRIIIA Preferably such modifications also have an altered Fc-mediated effector function. Modifications that affect Fc-mediated effector function are well known in the art (see U.S. Pat. No. 6,194,551, and WO 00/42072). In one particular embodiment, the modification of the Fc region results in an antibody with an altered antibody-mediated effector function, an altered binding to other Fc receptors (e.g., Fc activation receptors), an altered antibody-dependent cell-mediated cytotoxicity (ADCC) activity, an altered C1q binding activity, an altered complement-dependent cytotoxicity activity (CDC), a phagocytic activity, or any combination thereof.
[0112] Derivatized antibodies may be used to alter the half-lives (e.g., serum half-lives) of parental antibodies in a mammal, preferably a human. Preferably such alteration will result in a half-life of greater than 15 days, preferably greater than 20 days, greater than 25 days, greater than 30 days, greater than 35 days, greater than 40 days, greater than 45 days, greater than 2 months, greater than 3 months, greater than 4 months, or greater than 5 months. The increased half-lives of the humanized antibodies or fragments thereof in a mammal, preferably a human, results in a higher serum titer of said antibodies or antibody fragments in the mammal, and thus, reduces the frequency of the administration of said antibodies or antibody fragments and/or reduces the concentration of said antibodies or antibody fragments to be administered. Antibodies or fragments thereof having increased in vivo half-lives can be generated by techniques known to those of skill in the art. For example, antibodies or fragments thereof with increased in vivo half-lives can be generated by modifying (e.g., substituting, deleting or adding) amino acid residues identified as involved in the interaction between the Fc domain and the FcRn receptor. The humanized antibodies may be engineered to increase biological half-lives (see, e.g. U.S. Pat. No. 6,277,375). For example, humanized antibodies may be engineered in the Fc-hinge domain to have increased in vivo or serum half-lives.
[0113] Antibodies or fragments thereof with increased in vivo half-lives can be generated by attaching to said antibodies or antibody fragments polymer molecules such as high molecular weight polyethyleneglycol (PEG). PEG can be attached to said antibodies or antibody fragments with or without a multifunctional linker either through site-specific conjugation of the PEG to the N- or C-terminus of said antibodies or antibody fragments or via epsilon-amino groups present on lysine residues. Linear or branched polymer derivatization that results in minimal loss of biological activity will be used. The degree of conjugation will be closely monitored by SDS-PAGE and mass spectrometry to ensure proper conjugation of PEG molecules to the antibodies. Unreacted PEG can be separated from antibody-PEG conjugates by, e.g., size exclusion or ion-exchange chromatography.
[0114] The antibodies may also be modified by the methods and coupling agents described by Davis et al. (See U.S. Pat. No. 4,179,337) in order to provide compositions that can be injected into the mammalian circulatory system with substantially no immunogenic response.
[0115] The framework residues of the humanized antibodies can be modified. Framework residues in the framework regions may be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., U.S. Pat. No. 5,585,089; and Riechmann, L. et al. (1988) Reshaping Human Antibodies For Therapy, Nature 332:323-327).
[0116] Anti-human H7CR antibodies (and more preferably, humanized antibodies) and antigen-binding fragments thereof that are recombinantly fused or chemically conjugated (including both covalently and non-covalently conjugations) to a heterologous molecule (i.e., an unrelated molecule) are also provided. The fusion does not necessarily need to be direct, but may occur through linker sequences.
[0117] In one embodiment such heterologous molecules are polypeptides having at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids. Such heterologous molecules may alternatively be enzymes, hormones, cell surface receptors, drug moieties, such as: toxins (such as abrin, ricin A, pseudomonas exotoxin (i.e., PE-40), diphtheria toxin, ricin, gelonin, or pokeweed antiviral protein), proteins (such as tumor necrosis factor, interferon (e.g., -interferon, -interferon), nerve growth factor, platelet derived growth factor, tissue plasminogen activator, or an apoptotic agent (e.g., tumor necrosis factor-, tumor necrosis factor-)), biological response modifiers (such as, for example, a lymphokine (e.g., interleukin-1 (IL-1), interleukin-2 (IL-2), interleukin-6 (IL-6)), granulocyte macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), or macrophage colony stimulating factor, (M-CSF)), or growth factors (e.g., growth hormone (GH))), cytotoxins (e.g., a cytostatic or cytocidal agent, such as paclitaxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof), antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, BiCNU (carmustine; BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cisdichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), or anti-mitotic agents (e.g., vincristine and vinblastine).
[0118] Techniques for conjugating such therapeutic moieties to antibodies are well known; see, e.g., Arnon et al., Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy, in M
[0119] In one embodiment, the antibodies or fusion molecules include an Fc portion. The Fc portion of such molecules may be varied by isotype or subclass, may be a chimeric or hybrid, and/or may be modified, for example to improve effector functions, control of half-life, tissue accessibility, augment biophysical characteristics such as stability, and improve efficiency of production (and less costly). Many modifications useful in construction of disclosed fusion proteins and methods for making them are known in the art, see for example Mueller, J. P. et al. (1997) Humanized Porcine VCAM-Specific Monoclonal Antibodies With Chimeric IgG2/G4 Constant Regions Block Human Leukocyte Binding To Porcine Endothelial Cells, Mol. Immun. 34(6):441-452, Swann, P. G. (2008) Considerations For The Development Of Therapeutic Monoclonal Antibodies, Curr. Opin. Immun. 20:493-499 (2008), and Presta, L. G. (2008) Molecular Engineering And Design Of Therapeutic Antibodies, Curr. Opin. Immun 20:460-470. In some embodiments the Fc region is the native IgG1, IgG2, or IgG4 Fc region. In some embodiments the Fc region is a hybrid, for example a chimeric consisting of IgG2/IgG4 Fc constant regions. Modifications to the Fc region include, but are not limited to, IgG4 modified to prevent binding to Fc gamma receptors and complement, IgG1 modified to improve binding to one or more Fc gamma receptors, IgG1 modified to minimize effector function (amino acid changes), IgG1 with altered/no glycan (typically by changing expression host), and IgG1 with altered pH-dependent binding to FcRn, and IgG4 with serine at amino acid resident #228 in the hinge region changed to proline (S228P) to enhance stability. The Fc region may include the entire hinge region, or less than the entire hinge region.
[0120] The therapeutic outcome in patients treated with rituximab (a chimeric mouse/human IgG1 monoclonal antibody against CD20) for non-Hodgkin's lymphoma or Waldenstrom's macroglobulinemia correlated with the individual's expression of allelic variants of Fcy receptors with distinct intrinsic affinities for the Fc domain of human IgG1. In particular, patients with high affinity alleles of the low affinity activating Fc receptor CD16A (FcyRIIIA) showed higher response rates and, in the cases of non-Hodgkin's lymphoma, improved progression-free survival. In another embodiment, the Fc domain may contain one or more amino acid insertions, deletions or substitutions that reduce binding to the low affinity inhibitory Fc receptor CD32B (FcyRIIB) and retain wild-type levels of binding to or enhance binding to the low affinity activating Fc receptor CD16A (FcyRIIIA)
[0121] Another embodiment includes IgG2-4 hybrids and IgG4 mutants that have reduce binding to FcR which increase their half-life. Representative IG2-4 hybrids and IgG4 mutants are described in Angal, S. et al. (1993) A Single Amino Acid Substitution Abolishes The Heterogeneity Of Chimeric Mouse/Human (Igg4) Antibody, Molec. Immunol. 30(1):105-108; Mueller, J. P. et al. (1997) Humanized Porcine VCAM-Specific Monoclonal Antibodies With Chimeric Igg2/G4 Constant Regions Block Human Leukocyte Binding To Porcine Endothelial Cells, Mol. Immun. 34(6):441-452; and U.S. Pat. No. 6,982,323. In some embodiments the IgG1 and/or IgG2 domain is deleted for example, Angal, s. et al. describe IgG1 and IgG2 having serine 241 replaced with a proline.
[0122] In a preferred embodiment, the Fc domain contains amino acid insertions, deletions or substitutions that enhance binding to CD16A. A large number of substitutions in the Fc domain of human IgG1 that increase binding to CD16A and reduce binding to CD32B are known in the art and are described in Stavenhagen, J. B. et al. (2007) Fc Optimization Of Therapeutic Antibodies Enhances Their Ability To Kill Tumor Cells In Vitro And Controls Tumor Expansion In Vivo Via Low Affinity Activating Fcgamma Receptors, Cancer Res. 57(18):8882-8890. Exemplary variants of human IgG1 Fc domains with reduced binding to CD32B and/or increased binding to CD16A contain F243L, R929P, Y300L, V3051 or P296L substitutions. These amino acid substitutions may be present in a human IgG1 Fc domain in any combination. In one embodiment, the human IgG1 Fc domain variant contains a F243L, R929P and Y300L substitution. In another embodiment, the human IgG1 Fc domain variant contains a F243L, R929P, Y300L, V3051 and P296L substitution. In another embodiment, the human IgG1 Fc domain variant contains an N297Q substitution, as this mutation abolishes FcR binding.
[0123] Any of the described molecules can be fused to marker sequences, such as a peptide, to facilitate purification. In preferred embodiments, the marker amino acid sequence is a hexa-histidine peptide, the hemagglutinin HA tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson, I. A. et al. (1984) The Structure Of An Antigenic Determinant In A Protein, Cell, 37:767-778) and the flag tag (Knappik, A. et al. (1994) An Improved Affinity Tag Based On The FLAG Peptide For The Detection And Purification Of Recombinant Antibody Fragments, Biotechniques 17(4):754-761).
[0124] The antibodies or their antigen-binding fragments can be conjugated to a diagnostic or therapeutic agent or any other molecule for which serum half-life is desired to be increased. The antibodies can be used diagnostically (in vivo, in situ or in vitro) to, for example, monitor the development or progression of a disease, disorder or infection as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals, and nonradioactive paramagnetic metal ions. The detectable substance may be coupled or conjugated either directly to the antibody or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics. Such diagnosis and detection can be accomplished by coupling the antibody to detectable substances including, but not limited to, various enzymes, enzymes including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic group complexes such as, but not limited to, streptavidin/biotin and avidin/biotin; fluorescent materials such as, but not limited to, umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent material such as, but not limited to, luminol; bioluminescent materials such as, but not limited to, luciferase, luciferin, and aequorin; radioactive material such as, but not limited to, bismuth (.sup.213Bi), carbon (.sup.14C), chromium (.sup.51Cr), cobalt (.sup.57Co), fluorine (.sup.18F), gadolinium (.sup.153Gd, .sup.159Gd), gallium (.sup.68Ga, .sup.67Ga), germanium (.sup.68Ge), holmium (.sup.166Ho), indium (.sup.115In, .sup.113In, .sup.112In, .sup.111In), iodine (.sup.131I, .sup.125I, .sup.123I, .sup.121I), lanthanium (.sup.140La), lutetium (.sup.177Lu), manganese (.sup.54Mn), molybdenum (.sup.99Mo), palladium (.sup.103Pd), phosphorous (.sup.32P), praseodymium (.sup.142Pr) promethium (.sup.149Pm), rhenium (.sup.186Re, .sup.188Re), rhodium (.sup.105Rh), ruthemium (.sup.97Ru), samarium (.sup.153Sm), scandium (.sup.47Sc), selenium (.sup.75Se), strontium (.sup.85Sr), sulfur (.sup.35S), technetium (.sup.99Tc), thallium (.sup.201Ti), tin (.sup.113sn, .sup.117Sn), tritium (.sup.3H), xenon (.sup.133Xe), ytterbium (.sup.169Yb, .sup.175Yb), yttrium (.sup.90Y), zinc (.sup.65Zn); positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions.
[0125] The molecules can be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U.S. Pat. No. 4,676,980. Such heteroconjugate antibodies may additionally bind to haptens (such as fluorescein, etc.), or to cellular markers (e.g., 4-1-BB, B7-H4, B7-H7, CD4, CD8, CD14, CD25, CD27, CD40, CD68, CD163, CTLA4, GITR, LAG-3, OX40, TIM3, TIM4, TLR2, LIGHT, etc.) or to cytokines (e.g., IL-7, IL-15, IL-12, IL-4 TGF-beta, IL-10, IL-17, IFNg, Flt3, BLys) or chemokines (e.g., CCL21), etc.
[0126] The molecules may be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen or of other molecules that are capable of binding to target antigen that has been immobilized to the support via binding to an antibody or antigen-binding fragment. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
[0127] Nucleic acid molecules (DNA or RNA) that encode any such antibodies, fusion proteins or fragments, as well as vector molecules (such as plasmids) that are capable of transmitting or of replication such nucleic acid molecules and expressing such antibodies, fusion proteins or fragments in a cell line are also provided. The nucleic acids can be single-stranded, double-stranded, may contain both single-stranded and double-stranded portions.
D. Preferred Modulator Compositions
[0128] As used herein the term modulate relates to a capacity to alter an effect or result. In particular, a humanized variant of an anti-human H7CR antibody or any of its antigen-binding fragments that immunospecifically binds human H7CR or molecules that physiospecifically bind H7CR are capable of modulating the binding between H7CR and its cognate ligands and/or of modulating the signal transduction that occurs as a consequence of H7CRcognate ligand binding.
[0129] The antibody can be an agonist antibody that agonizes H7CR. Agonizing antibodies can bind H7CR and stimulate signal transduction through H7CR.
[0130] In one embodiment, the antibodies, or fragments thereof, or fusion molecules immunospecifically bind to H7CR but are substantially incapable of blocking H7CR's interaction with B7-H7 in vitro, or in a recipient subject or patient. As used herein, a molecule that is substantially incapable of blocking H7CR's interaction with B7-117 denotes that the presence of such molecule attenuates H7CR-B7-H7 interactions by less than 50%, more preferably less than 40%, still more preferably less than 30%, still more preferably less than 20%, still more preferably less than 10%, still more preferably less than 5%, still more preferably less than 1%, and most preferably completely fails to attenuate such interaction, as measured by any of the assays disclosed herein. Such antibodies, fragments and fusion molecules have particular utility as therapeutic agents or in diagnostic, cytological and histological assays for H7CR (or B7-H7) expression. Additionally, multi-specific anti-H7CR antibodies, anti-H7CR antigen-binding fragments and their respective fusion products that have the added ability to bind B7-H7 or other cellular ligands or receptors have particular utility in facilitating the co-localization of cells expressing such ligands or receptors to cells that express H7CR.
[0131] In a second embodiment, the antibodies, or fragments thereof, or fusion molecules immunospecifically bind to H7CR and are capable of substantially blocking H7CR's interaction with B7-H7 in vitro, or in a recipient subject or patient. As used herein, a molecule that is capable of substantially blocking H7CR's interaction with B7-117 denotes that the provision of such molecule attenuates H7CR-B7-H7 interactions by more than 50%, more preferably by more than 60%, more than 70%, more than 80%, more than 90%, more than 95%, more than 99% or most preferably completely attenuates such interaction, as measured by any of the assays disclosed herein. Such antibodies, fragments and fusion molecules have particular utility in attenuating the biological effects of B7-H7-H7CR interactions.
[0132] A preferred embodiment provides humanized antibodies and fragments or human antibodies and fragments.
[0133] Most preferably, such molecules will possess sufficient affinity and avidity to be able to bind to H7CR when expressed at an endogenous concentration and arrayed on the surface of a subject's cells. The term endogenous concentration refers to the level at which a molecule is natively expressed (i.e., in the absence of expression vectors or recombinant promoters) in a normal, cancer or pathogen-infected cell.
[0134] (1) Preferred Rodent Anti-Human H7CR Antibodies and Their CDRs
[0135] Such molecules can be produced by screening hybridoma lines for those that produce antibody that are immunospecific for human H7CR, and then optionally screening amongst such lines for those exhibiting modulating activity (e.g., neutralizing activity, agonizing activity, altered signal transducing activity, etc.). In one embodiment the antibodies are hamster anti-human H7CR clones: 1.3, 4.5 and 7.8. These antibodies are capable of binding to human H7CR and are substantially incapable of blocking H7CR's interaction with B7-H7. The antibodies expressed by the anti-human H7CR clones were sequenced to reveal their variable domains. CDR sequences of the variable domains are shown in bold and underlined:
TABLE-US-00005 Anti-HumanH7CRClone1.3 LightChainVariableRegion: (SEQIDNO:5) DIVMTQSPSSLAVSAGEKVTISCLSSQSLFSSNTNRNYLN WYLQKPGQSPKLLIYHASTRLTGVPDRFIGSGSGTDFTLT ISSVQAEDLGDYYCQHHYETPLTFGDGTRLEIK HeavyChainVariableRegion: (SEQIDNO:6) QIQLQESGPGLVKPSQSLSLTCSVTGFSISTSGYYWTWIR QFPGKRLEWMGYINYGGGTSYNPSLESRISITRDTSKNQP LLHLNSVTTEDTATYCCATMADRFAFFDVWGQGIQVTVSS Anti-HumanH7CRClone4.5 LightChainVariableRegion: (SEQIDNO:7) DIVMTQSPSSLAVSAGEKVTISCLSSQSLFSSNTKRNYLN WYLQKPGQSPKLLIYHASTRLTGVPGRFIGSGSGTDFTLT VSTVQAEDLGDYFCQQHYETPLTFGDGTRLEIK HeavyChainVariableRegion: (SEQIDNO:8) QIQLQESGFGLVKPSQSLSLTCSVTGFSITTGGYYWNWIR QPPGKKLEWMGYIYTSGRTSYNPSLKSRISITRDTSKNQP FLQLNSMTTEDTATYYCADMADKGGWFAYWGQGTLVTVSS Anti-HumanH7CRClone7.8 LightChainVariableRegion: (SEQIDNO:9) DIVMTQSPSSLTVSAGEKVTISCLSSQSLFSSNTNRNYLS WYLQRPGQSPKLLIYHASTRLTGVPGRFIGSGSGTDFTLT VSTVQAGDLGDYFCQQHYVTPLTFGDGTRLEIK HeavyChainVariableRegion: (SEQIDNO:10) QIQLQESGPGLVKPSQSLSLTCSVTGFSITTGGYYWNWIR QFPGKKLEWMGYIYSSGRTSYNPSLKSRISITRDTSKNQF FLQLNSVTTEDTATYYCADMADKGGWFDYWGQGTLVTVSS
[0136] (2) Consensus CDRs of the Anti-Human H7CR Antibodies
[0137] Analyses of the CDRs of the identified antibodies were conducted in order to identify consensus CDR sequences and likely variant CDR sequences that would provide similar binding attributes. Such variant CDRs were computed using Blosum62.iij analysis according to Table 1. Table 1 presents the Blosum62.iij substitution scores. The higher the score the more conservative the substitution and thus the more likely the substitution will not affect function.
TABLE-US-00006 TABLE 1 A R N D C Q E G H I L K M F P S T W Y V A +4 1 2 2 0 1 1 0 2 1 1 1 1 2 1 +1 0 3 2 0 R 1 +5 0 2 3 +1 0 2 0 3 2 +2 1 3 2 1 1 3 2 3 N 2 0 +6 +1 3 0 0 0 +1 3 3 0 2 3 2 +1 0 4 2 3 D 2 2 +1 +6 3 0 +2 1 1 3 4 1 3 3 1 0 1 4 3 3 C 0 3 3 3 +9 3 4 3 3 1 1 3 1 2 3 1 1 2 2 1 Q 1 +1 0 0 3 +5 +2 2 0 3 2 +1 0 3 1 0 1 2 1 2 E 1 0 0 +2 4 +2 +5 2 0 3 3 +1 2 3 1 0 1 3 2 2 G 0 2 0 1 3 2 2 +6 2 4 4 2 3 3 2 0 2 2 3 3 H 2 0 +1 1 3 0 0 2 +8 3 3 1 2 1 2 1 2 2 +2 3 I 1 3 3 3 1 3 3 4 3 +4 +2 3 +1 0 3 2 1 3 1 +3 L 1 2 3 4 1 2 3 4 3 +2 +4 2 +2 0 3 2 1 2 1 +1 K 1 +2 0 1 3 +1 +1 2 1 3 2 +5 1 3 1 0 1 3 2 2 M 1 1 2 3 1 0 2 3 2 +1 +2 1 +5 0 2 1 1 1 1 +1 F 2 3 3 3 2 3 3 3 1 0 0 3 0 +6 4 2 2 +1 +3 1 P 1 2 2 1 3 1 1 2 2 3 3 1 2 4 +7 1 1 4 3 2 S +1 1 +1 0 1 0 0 0 1 2 2 0 1 2 1 +4 +1 3 2 2 T 0 1 0 1 1 1 1 2 2 1 1 1 1 2 1 +1 +5 2 2 0 W 3 3 4 4 2 2 3 2 2 3 2 3 1 +1 4 3 2 +11 +2 3 Y 2 2 2 3 2 1 2 3 +2 1 1 2 1 +3 3 2 2 +2 +7 1 V 0 3 3 3 1 2 2 3 3 +3 +1 2 +1 1 2 2 0 3 1 +4
[0138] Antibodies and antigen-binding fragments having 1, 2, 3, 4, 5 or 6 variant CDRs are disclosed. A substantial number of distinct CDRs were identified permitting the recognition of CDR residues that are likely to be required in any variant of a particular identified CDR. Such residues are shown in boldface in Table 2 and Table 3. For those residues that are found to vary among the compared CDRs, the substitution scores of Table 1 provide a method for determining the identities of permitted substitutions. For example, if a particular residue of a particular CDR is found to vary as R or S, then since R and S have a substitution score of 1, any substitution of R or S having a substitution score of 1 or greater are as likely as the observed variants (R or S) (or are more likely than R or S) to create a variant CDR having binding attributes that are sufficiently similar to those of the particular CDR to permit the variant CDR to be employed in lieu thereof so as to form a functional anti-H7CR antibody or antigen-binding fragment. For each position, the selection of a residue having a higher substitution score is preferred over the selection of a residue having a lower substitution score.
[0139] Table 2 presents an analysis of the light chain CDRs of the anti-H7CR antibodies and provides the consensus sequence of the observed and preferred variant light chain (LC) anti-H7CR CDRs.
TABLE-US-00007 TABLE2 Anti-H7CRLightChainCDRs LightChainCDR1 Antibody Sequence SEQIDNO 1.3 Q S L F S S N T N R N Y 29 4.5 Q S L F S S N T K R N Y 30 7.8 Q S L F S S N T N R N Y 29 LCCDR1 Q S L F S S N T X.sub.1 R N Y 31 Consensus Sequence: X.sub.1isNorKorasubstitutionhavingan equalorgreatersubstitutionscore(i.e., 0): R,N,Q,E,K,orS LightChainCDR2 Antibody Sequence SEQIDNO 1.3. H A S 32 4.5 H A S 32 7.8 H A S 32 LCCDR2 H A S 32 Consensus Sequence: LightChainCDR3 Antibody Sequence SEQIDNO 1.3 Q H H Y E T P L T 45 4.5 Q Q H Y E T P L T 46 7.8 Q Q H Y V T P L T 47 LCCDR3 Q X.sub.1 H Y X.sub.2 T P L T 48 Consensus Sequence: X.sub.1isHorQorasubstitutionhavinganequal orgreatsubstitutionscore(i.e., 0):R, N,Q,E,orH X.sub.2isEorVorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 2): A,Q,E,K,M,P,S,T,Y,orV
[0140] Table 3 presents an analysis of the heavy chain CDRs of the anti-H7CR antibodies and provides the consensus sequence of the observed and preferred variant anti-H7CR heavy chain (HC) CDRs.
TABLE-US-00008 TABLE3 Anti-H7CRHeavyChainCDRs HeavyChainCDR1 Antibody Sequence SEQIDNO 1.3 G F S I S T S G 49 4.5 G F S I T T G G 50 7.8 G F S I T T G G 50 HCCDR1 G F D I X.sub.1 T X.sub.2 G 51 Consensus Sequence: X.sub.1isSorTorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., +1):SorT X.sub.2isSorGorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 0):A,NG, orS HeavyChainCDR2 Antibody Sequence SEQIDNO 1.3 I N Y G G G T 52 4.5 I Y T S G R T 53 7.8 I Y S S G R T 54 HCCDR2 I X.sub.1 X.sub.2 X.sub.3 G X.sub.4 T 55 Consensus Sequence: X.sub.1isNorYorasubstitutionhavinganequal orgreatersubstitutionscore(i.e. 2):A,R, N,Q,E,H,K,M,S,T,Y X.sub.2isY,TorSorasubstitutionhavingan equalorgreatersubstitutionscore(i.e., 2): A,R,N,C,Q,E,H,I,L,K,M,F,S,T,Y,orV X.sub.3isSorGorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 0): A,N,G,orS X.sub.4GorRorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 2): A,R,N,D,Q,E,G,H,K,P,S,orT HeavyChainCDR3 Antibody Sequence SEQIDNO 1.3 A T M A D R F A F F D V 56 4.5 A D M A D K G G W F A Y 57 7.8 A D M A D K G G W F D Y 58 HCCDR3 A X.sub.1 M A D X.sub.2 X.sub.3 X.sub.4 X.sub.5 F X.sub.6 X.sub.7 59 Consensus Sequence: X.sub.1isTorDorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 1): N,D,Q,E,K,P,S,orT X.sub.2isRorKorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., +2): R,orK X.sub.3isForGorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 3): A,R,N,D,C,Q,E,G,H,K,M,F,S,T,W,Y,or V X.sub.4isAorGorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 0): A,G,orS X.sub.5isForWorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., +1): F,W,orY X.sub.6isAorDorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 4): A,R,N,D,C,Q,E,G,H,I,L,K,M,F,P,S,T, W,Y,orV X.sub.7isVorYorasubstitutionhavinganequal orgreatersubstitutionscore(i.e., 2): A,R,N,D,Q,E,G,H,K,P,S,orT
[0141] Thus, in addition to antibodies and antigen-binding fragments thereof that possess the CDRs of the anti-H7CR antibodies: 1.3, 4.5 and 7.8, antibodies and antigen-binding fragments thereof that possess CDRs having the above-described light and/or heavy chain consensus sequences are also provided.
[0142] The antibodies or fragments thereof include an amino acid sequence of a variable heavy chain and/or variable light chain that is at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of the variable heavy chain and/or light chain of the hamster monoclonal antibody produced by any of the above clones, and which exhibit immunospecific binding to H7CR. Additionally, the antibodies or fragments thereof can include a CDR that is at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of a CDR of the above-listed clones and which exhibit immunospecific binding to H7CR. The determination of percent identity of two amino acid sequences can be determined by BLAST protein comparison.
[0143] In a specific embodiment, an antibody or an antigen-binding fragment thereof contains one, two, three, four, five, or more preferably, all 6 CDRs of the above-described preferred antibodies and will exhibit the ability to bind to human H7CR.
[0144] (3) Preferred Humanized Anti-Human H7CR Antibodies and their CDRs
[0145] Multiple preferred light and heavy chain humanized derivatives of anti-human H7CR antibodies 1.3 and 4.5 were prepared.
[0146] (a) Humanized Variants Of Anti-Human H7CR Antibody 1.3
[0147] The amino acid sequences of the Light Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 1.3, derived from the IGKV4-1*01 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00009 1. VL1AIGKV4-1*01(Humanized1): (SEQIDNO:17) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTNRNYLA WYQQKPGQPPKLLIYHASTRESGVPDRFSGSGSGTDFTLT ISSLQAEDVAVYYCQHHYETPLTFGQGTKLEIK 2. VL1BIGKV4-1*01(Humanized2): (SEQIDNO:18) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTNRNYLN WYQQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLT ISSLQAEDVADYYCQHHYETPLTFGDGTKLEIK 3. VL1CIGKVR-1*01(Humanized3): (SEQIDNO:19) DIVMTQSPDSLAVSLGERATINCLSSQSLFSSNTNRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFIGSGSGTDFTLT ISSLQAEDVGDYYCQHHYETPLTFGDGTKLEIK
[0148] The amino acid sequences of the Light Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 1.3 derived from the IGKV2D-28*01 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00010 1. VL2AIGKV2D-28*01(Humanized1): (SEQIDNO:20) DIVMTQSPLSLPVTPGEPASISCRSSQSLFSSNTNRNYLD WYLQKPGQSPQLLIYHASNRASGVPDRFSGSGSGTDFTLK ISRVEAEDVGVYYCQHHYETPLTFGDGTKLEIK 2. VL2BIGKV2D-28*01(Humanized2): (SEQIDNO:21) DIVMTQSPLSLPVTPGEPASISCRSSQSLFSSNTNRNYLN WYLQKPGQSPKLLIYHASTRASGVPDRFSGSGSGTDFTLK ISRVEAEDVGVYYCQHHYETPLTFGDGTKLEIK 3. VL2CIGKV2D-28*01(Humanized3): (SEQIDNO:22) DIVMTQSPLSLPVTPGEPASISCLSSQSLFSSNTNRNYLM WYLQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLK ISRVEAEDVGDYYCQHHYETPLTFGDGTKLEIK
[0149] The amino acid sequences of the Heavy Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 1.3 derived from the IGHV4-31*02 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00011 1. VH1AIGHV4-31*02(Humanized1): (SEQIDNO:23) QVQLQESGPGLVKPSQTLSLTCTVSGFSISTSGYYWSWIR QHPGKGLEWIGYINYGGGTYYNPSLKSRVTISVDTSKNQF SLKLSSVTAADTAVYYCATMADRFAFFDVWGQGTMVTVSS 2. VH1BIGHV4-31*02(Humanized2): (SEQIDNO:24) QVQLQESGPGLVKPSQTLSLTCTVSGFSISTSGYYWSWIR QHPGKRLEWIGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTAVYCCATMADRFAFFDVWGQGTMVTVSS 3. VH1CIGHV4-31*02(Humanized3): (SEQIDNO:25) QVQLQESGPGLVKPSQTLSLTCTVSGFSISTSGYYWSWIR QFPGKRLEWNGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTATYCCATMADRFAFFDVWGQGTMVTVSS
[0150] The amino acid sequences of the Heavy Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 1.3, derived from the AAY33199.1 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00012 1. VH2AAAY33199.1(Humanized1): (SEQIDNO:26) QVQLQESGPGLVKPAQTLSLTCTVSGFSISTSGYYWSWIR QYPGKGLEWIGYINYGGGTYYNPSLKSRVTISVDTSKNQF SLKLTSVTAADTAVYHCATMADRFAFFDVWGQGTMVTVSS 2. VH2BAAY33199.1(Humanized2): (SEQIDNO:27) QVQLQESGPGLVKPAQTLSLTCTVSGFSISTSGYYWSWIR QYPGKRLEWIGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLTSVTAASTATYCCATMADRFAFFDVWGQGTMVTVSS 3. VH2CAAY33199.1(Humanized3): (SEQIDNO:28) QVQLQESGPGLVKPAQTLSLTCTVSGFSISTSGYYWSWIR QFPGKRLEWMGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLTSVTAADTATYCCATMADRFAFFDVWGQGTMVTVSS
[0151] The antibodies, and their antigen-binding fragments can include any of the 36 combinations of the above-described humanized variants of anti-human H7CR antibody 1.3. Specifically, such antibodies include the combinations shown in Table 4:
TABLE-US-00013 TABLE 4 Humanized Variants of anti-human H7CR Antibody 1.3 Human- ized SEQ SEQ Variant ID ID No. Light Chain NO. Heavy Chain NO. 1 VL1A IGKV4-1*01 17 VH1A IGHV4-31*02 23 (Humanized 1) (Humanized 1) 2 VL1A IGKV4-1*01 17 VH1B IGHV4-31*02 24 (Humanized 1) (Humanized 2): 3 VL1A IGKV4-1*01 17 VH1C IGHV4-31*02 25 (Humanized 1) (Humanized 3) 4 VL1A IGKV4-1*01 17 VH2AA AAY33199.1 26 (Humanized 1) (Humanized 1) 5 VL1A IGKV4-1*01 17 VH2B AAY33199.1 27 (Humanized 1) (Humanized 2) 6 VL1A IGKV4-1*01 17 VH2CAAY33199.1 28 (Humanized 1) (Humanized 3) 7 VL1B IGKV4-1*01 18 VH1A IGHV4-31*02 23 (Humanized 2) (Humanized 1) 8 VL1B IGKV4-1*01 18 VH1B IGHV4-31*02 24 (Humanized 2) (Humanized 2): 9 VL1B IGKV4-1*01 18 VH1C IGHV4-31*02 25 (Humanized 2) (Humanized 1) 10 VL1B IGKV4-1*01 18 VH2A AAY33199.1 26 (Humanized 2) (Humanized 1) 11 VL1B IGKV4-1*01 18 VH2B AAY3319.1 27 (Humanized 2) (Humanized 2) 12 VL1B IGKV4-1*01 18 VH2C AAY33199.1 28 (Humanized 2) (Humanized 3) 13 VL1C IGKV4-1*01 19 VH1A IGHV4-31*02 23 (Humanized 3) (Humanized 1) 14 VL1C IGKV4-1*01 19 VH1B IGHV4-31*02 24 (Humanized 3) (Humanized 2): 15 VL1C IGKV4-1*01 19 VH1C IGHV4-31*02 25 (Humanized 3) (Humanized 3) 16 VL1C IGKV4-1*01 19 VH2A AAY33199.1 26 (Humanized 3) (Humanized 1) 17 VL1C IGKV4-1*01 19 VH2B AAY33199.1 27 (Humanized 3) (Humanized 2) 18 VL1C IGKV4-1*01 19 VH2C AAY33199.1 28 (Humanized 3) (Humanized 3) 19 VL2A IGKV2D-28*01 20 VH1A IGHV4-31*02 23 (Humanized 1) (Humanized 1) 20 VL2A IGKV2D-28*01 20 VH1B IGHV4-31*02 24 (Humanized 1) (Humanized 2): 21 VL2A IGKV2D-28*01 20 VH1C IGHV4-31*02 25 (Humanized 1) (Humanized 3) 22 VL2A IGKV2D-28*01 20 VH2A AAY33199.1 26 (Humanized 1) (Humanized 1) 23 VL2A IGKV2D-28*01 20 VH2B AAY33199.1 27 (Humanized 1) (Humanized 2) 24 VL2A IGKV2D-28*01 20 VH2C AAY33199.1 28 (Humanized 1) (Humanized 3) 25 VL2B IG V2D-28*01 21 VH1A IGHV4-31 *02 23 (Humanized 2) (Humanized 1) 26 VL2B IG V2D-28*01 21 VH1B IGHV4-31*02 24 (Humanized 2) (Humanized 2): 27 VL2B IG V2D-28*01 21 VH1C IGHV4-31*02 25 (Humanized 2) (Humanized 3) 28 VL2B IG V2D-28*01 21 VH2A AAY33199.1 26 (Humanized 2) (Humanized 1) 29 VL2B IG V2D-28*01 21 VH2B AAY33199.1 27 (Humanized 2) (Humanized 2) 30 VL2B IG V2D-28*01 21 VH2C AAY33199.1 28 (Humanized 2) (Humanized 3) 31 VL2C IG V2D-28*01 22 VH1A IGHV4-31 *02 23 (Humanized 3) (Humanized 1) 32 VL2C IG V2D-28*01 22 VH1B IGHV4-31*02 24 (Humanized 3) (Humanized 2): 33 VL2C IG V2D-28*01 22 VH1C IGHV4-31*02 25 (Humanized 3) (Humanized 3) 34 VL2C IG V2D-28*01 22 VH2A AAY33199.1 26 (Humanized 3) (Humanized 1) 35 VL2C IG V2D-28*01 22 VH2B AAY33199.1 27 (Humanized 3) (Humanized 2) 36 VL2C IG V2D-28*01 22 VH2C AAY33199.1 28 (Humanized 3) (Humanized 3)
[0152] (b) Humanized Variants Of Anti-Human H7CR Antibody 4.5
[0153] The amino acid sequences of the Light Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 4.5, derived from the IGKV4-1*01 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00014 1. VL1AIGKV4-1*01(Humanized1): (SEQIDNO:33) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTKRNYLA WYQQKPGQPPKLLIYHASTRESGVPDRFSGSGSGTDFTLT ISSLQAEDVAVYYCQQHYETPLTFGQGTRLEIK 2. VL1BIGKV4-1*01(Humanized2): (SEQIDNO:34) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTKRNYLN WYQQKPGQPPKLLIYHASTRLSGVPDRFSGSGSGTDFTLT ISSLQAEDVADYFCQQHYETPLTFGDGTRLEIK 3. VL1CIGKV4-1*01(Humanized3): (SEQIDNO:35) DIVMTQSPDSLAVSLGERATINCLSSQSLFSSNTKRNYLN WYQQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLT ISSLQAEDVADYFCQQHYETPLTFGDGTRLEIK
[0154] The amino acid sequences of the Light Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 4.5, derived from the IGKV2D-40*01 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00015 1. VL2AIGKV2D-40*01(Humanized1): (SEQIDNO:36) DIVMTQTPLSLPVTPGEPASISCRSSQSLFSSNTKRNYLD WYLQKPGQSPQLLIYHASYRASGVPDRFSGSGSGTDFTLK ISRVEAEDVGVYYCQQHYETPLTFGQGTRLEIK 2. VL2BIGKV2D-40*01(Humanized2): (SEQIDNO:37) DIVMTQTPLSLPVTPGEPASISCRSSQSLFSSNTKRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLK ISRVEAEDVGDYFCQQHYETPLTFGDGTRLEIK 3. VL2CIGKV2D-40*01(Humanized3): (SEQIDNO:38) DIVMTQTPSSLPVTPGEPASISCLSSQSLFSSNTKRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLK ISRVEAEDVGDYFCQQHYETPLTFGDGTRLEIK
[0155] The amino acid sequences of the Heavy Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 1.3, derived from the IGHV4-31*02 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00016 1. VH1AIGHV4-31*02(Humanized1): (SEQIDNO:39) QVQLQESGPGLVKPSQTLSLTCTVSGFSITTGGYYWSWIR QHPGKGLEWIGYIYTSGRTYYNPSLKSRVTISVDTSKNQF SLKLSSVTAADTAVYYCADMADKGGWFAYWGQGTLVTVSS 2. VH1BIGHV4-31*02(Humanized2): (SEQIDNO:40) QVQLQESGPGLVKPSQTLSLTCTVSGFSITTGGYYWNWIR QHPGKKLEWIGYIYTSGRTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTAVYYCADMADKGGWFAYWGQGTLVTVSS 3. VH1CIGHV4-31*02(Humanized3): (SEQIDNO:41) QVQLQESGPGLVKPSQTLSLTCTVSGFSITTGGYYWNWIR QFPGKKLEWMGYIYTSGRTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTAVYYCADMADKGGWFAYWGQGTLVTVSS
[0156] The amino acid sequences of the Heavy Chain Variable Region of preferred humanized variants of anti-human H7CR antibody 1.3, derived from the IGHV2-5*01 acceptor framework, are shown below (CDRs are shown underlined):
TABLE-US-00017 1. VH2AIGHV2-5*01(Humanized1): (SEQIDNO:42) QITLKESGPTLVKPTQTLTLTCTFSGFSITTGGYYVGWIR QPPGKALEWLALIYTSGRTRYSPSLKSRLTITKDTSKNQV VLTMTNMDPVDTATYYCADMADKGGWFAYSGQGTLVTVSS 2. VH2BIGHV2-5*01(Humanized2): (SEQIDNO:43) QITLKESGPTLVKPTQTLTLTCTVSGFSITTGGYYWNWIR QPPGKKLEWLALIYTSGRTSYNPSLKSRLTITKDTSKNQV VLTMTNMDPVDTATYYCADMADKGGWFAYWGQGTLVTVSS 3. VH2CIGHV2-5*01(Humanized3): (SEQIDNO:44) QIQLKESGPTLVKPTQTLTLTCTVSGFSITTGGYYWNWIR QPPGKKLEWMALIYTSGRTSYNPSLKSRLTITKDTSKNQV VLTMTNMDPVDTATYYCADMADKGGWFAYWGQGTLVTVSS
[0157] The antibodies and their antigen-binding fragments can include any of the 36 combinations of the above-described humanized variants of anti-human H7CR antibody 4.5. Specifically, such antibodies include the combinations shown in Table 5:
TABLE-US-00018 TABLE 5 Humanized Variants of anti-human H7CR Antibody 1.3 Human- ized SEQ SEQ Variant ID ID No. Light Chain NO. Heavy Chain NO. 1 VL1A IGKV4-1*01 33 VH1A IGHV4-31*02 39 (Humanized 1) (Humanized 1) 2 VL1A IGKV4-1*01 33 VH1B IGHV4-31*02 40 (Humanized 1) (Humanized 2): 3 VL1A IGKV4-1*01 33 VH1C IGHV4-31*02 41 (Humanized 1) (Humanized 3) 4 VL1A IGKV4-1*01 33 VH2A IGHV2-5*01 42 (Humanized 1) (Humanized 1) 5 VL1A IGKV4-1*01 33 VH2B IGHV2-5*01 43 (Humanized 1) (Humanized 2) 6 VL1A IGKV4-1*01 33 VH2C IGHV2-5*01 44 (Humanized 1) (Humanized 3) 7 VL1B IGKV4-1*01 34 VH1A IGHV4-31*02 39 (Humanized 2) (Humanized 1) 8 VL1B IGKV4-1*01 34 VH1B IGHV4-31*02 40 (Humanized 2) (Humanized 2) 9 VL1B IGKV4-1*01 34 VH1C IGHV4-31*02 41 (Humanized 2) (Humanized 1) 10 VL1B IGKV4-1*01 34 VH2A IGHV2-501 42 (Humanized 2) (Humanized 1) 11 VL1B IGKV4-1*01 34 VH2A IGHV2-501 43 (Humanized 2) (Humanized 2) 12 VL1B IGKV4-1*01 34 VH2A IGHV2-501 44 (Humanized 2) (Humanized 3) 13 VL1C IGKV4-1*01 35 VH1A IGHV4-31*02 39 (Humanized 3) (Humanized 1) 14 VL1C IGKV4-1*01 35 VH1B IGHV4-31*02 40 (Humanized 3) (Humanized 2): 15 VL1C IGKV4-1*01 35 VH1C IGHV4-31*02 41 (Humanized 3) (Humanized 3) 16 VL1C IGKV4-1*01 35 VH2A IGHV2-5*01 42 (Humanized 3) (Humanized 1) 17 VL1C IGKV4-1*01 35 VH2A IGHV2-5*01 43 (Humanized 3) (Humanized 2) 18 VL1C IGKV4-1*01 35 VH2A IGHV2-5*01 44 (Humanized 3) (Humanized 3) 19 VL2A IGKV2D-40*01 36 VH1A IGHV4-31*02 39 (Humanized 1) (Humanized 1) 20 VL2A IGKV2D-40*01 36 VH1B IGHV4-31*02 40 (Humanized 1) (Humanized 2) 21 VL2A IGKV2D-40*01 36 VH1C IGHV4-31*02 41 (Humanized 1) (Humanized 3) 22 VL2A IGKV2D-40*01 36 VH2C IGHV2-5*01 42 (Humanized 1) (Humanized 1) 23 VL2A IGKV2D-40*01 36 VH2C IGHV2-5*01 43 (Humanized 1) (Humanized 2) 24 VL2A IGKV2D-40*01 36 VH2C IGHV2-5*01 44 (Humanized 1) (Humanized 3) 25 VL2B IGKV2D-40*01 37 VH1A IGHV4-31 *02 39 (Humanized 2) (Humanized 1) 26 VL2B IGKV2D-40*01 37 VH1B IGHV4-31*02 40 (Humanized 2) (Humanized 2) 27 VL2B IGKV2D-40*01 37 VH1C IGHV4-31*02 41 (Humanized 2) (Humanized 3) 28 VL2B IGKV2D-40*01 37 VH2C IGHV2-5*01 42 (Humanized 2) (Humanized 1) 29 VL2B IGKV2D-40*01 37 VH2C IGHV2-5*01 43 (Humanized 2) (Humanized 2) 30 VL2B IGKV2D-40*01 37 VH2C IGHV2-5*01 44 (Humanized 2) (Humanized 3) 31 VL2C IGKV2D-40*01 38 VH1A IGHV4-31*02 39 (Humanized 3) (Humanized 1) 32 VL2C IGKV2D-40*01 38 VH1B IGHV4-31*02 40 (Humanized 3) (Humanized 2) 33 VL2C IGKV2D-40*01 38 VH1C IGHV4-31*02 41 (Humanized 3) (Humanized 3) 34 VL2C IGKV2D-40*01 38 VH2A IGHV2-5*01 42 (Humanized 3) (Humanized 1) 35 VL2C IGKV2D-40*01 38 VH2A IGHV2-5*01 43 (Humanized 3) (Humanized 2) 36 VL2C IGKV2D-40*01 38 VH2A IGHV2-5*01 44 (Humanized 3) (Humanized 3)
[0158] The disclosed antibodies or fragments thereof include an amino acid sequence of a variable heavy chain and/or variable light chain that is at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of the variable heavy chain and/or light chain of the mouse monoclonal antibody produced by any of the above clones, and which exhibit immunospecific binding to human H7CR. Other antibodies or fragments thereof include a CDR that is at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of a CDR of the above-listed clones and which exhibit immunospecific binding to H7CR. The determination of percent identity of two amino acid sequences can be determined by BLAST protein comparison.
[0159] In a preferred embodiment, the antibody is a humanized immunoglobulin molecule (e.g., an antibody, diabody, fusion protein, etc.) that includes one, two or three light chain CDRs and one, two or three heavy chain CDRs (most preferably three light chain CDRs and three heavy chain CDRs), wherein the light chain CDRs include: [0160] (1) the light chain CDR1 of a humanized variant of anti-human H7CR antibody 1.3; [0161] (2) the light chain CDR2 of a humanized variant of anti-human H7CR antibody 4.5; [0162] (3) the light chain CDR3 of a humanized variant of anti-human H7CR antibody 7.8; [0163] (4) the light chain CDR1 and the light chain CDR2 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0164] (5) the light chain CDR1 and the light chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0165] (6) the light chain CDR2 and the light chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8;
or [0166] (7) the light chain CDR1, the light chain CDR2 and the light chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8.
[0167] In an alternative preferred embodiment, the humanized immunoglobulin molecule includes one, two or three light chain CDRs and one, two or three heavy chain CDRs (most preferably three light chain CDRs and three heavy chain CDRs), wherein the heavy chain CDRs include: [0168] (1) the heavy chain CDR1 of a humanized variant of anti-human H7CR antibody 1.3; [0169] (2) the heavy chain CDR2 of a humanized variant of anti-human H7CR antibody 4.5; [0170] (3) the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 7.8; [0171] (4) the heavy chain CDR1 and the heavy chain CDR2 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0172] (5) the heavy chain CDR1 and the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0173] (6) the heavy chain CDR2 and the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8;
or [0174] (7) the heavy chain CDR1, the heavy chain CDR2 and the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8.
[0175] In a particularly preferred embodiment, the antibody is a humanized immunoglobulin molecule that includes one, two or three light chain CDRs and one, two or three heavy chain CDRs (most preferably three light chain CDRs and three heavy chain CDRs), wherein the light chain CDRs include: [0176] (1) the light chain CDR1 of a humanized variant of anti-human H7CR antibody 1.3; [0177] (2) the light chain CDR2 of a humanized variant of anti-human H7CR antibody 4.5; [0178] (3) the light chain CDR3 of a humanized variant of anti-human H7CR antibody 7.8; [0179] (4) the light chain CDR1 and the light chain CDR2 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0180] (5) the light chain CDR1 and the light chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0181] (6) the light chain CDR2 and the light chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8;
or [0182] (7) the light chain CDR1, the light chain CDR2 and the light chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8,
and wherein the heavy chain CDRs include: [0183] (1) the heavy chain CDR1 of a humanized variant of anti-human H7CR antibody 1.3; [0184] (2) the heavy chain CDR2 of a humanized variant of anti-human H7CR antibody 4.5; [0185] (3) the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 7.8; [0186] (4) the heavy chain CDR1 and the heavy chain CDR2 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0187] (5) the heavy chain CDR1 and the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8; [0188] (6) the heavy chain CDR2 and the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8;
or [0189] (7) the heavy chain CDR1, the heavy chain CDR2 and the heavy chain CDR3 of a humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8.
[0190] Most preferably, such CDRs shall be of the same humanized variant of anti-human H7CR antibody 1.3, 4.5 or 7.8, respectively.
[0191] In a specific embodiment, an antibody or an antigen-binding fragment will include one, two, three, four, five, or more preferably, all 6 CDRs of the humanized variants of anti-human H7CR antibody 1.3, 4.5 or 7.8 and will exhibit the same ability to bind to human H7CR as the parental antibody.
E. Therapeutic and Prophylactic Uses of the Preferred Compositions
[0192] As used herein, the terms treat, treating, treatment and therapeutic use refer to the elimination, reduction or amelioration of one or more symptoms of a disease or disorder that would benefit from an increased or decreased immune response. As used herein, a therapeutically effective amount refers to that amount of a therapeutic agent sufficient to mediate an altered immune response, and more preferably, a clinically relevant altered immune response, sufficient to mediate a reduction or amelioration of a symptom of a disease or condition. An effect is clinically relevant if its magnitude is sufficient to impact the health or prognosis of a recipient subject. A therapeutically effective amount may refer to the amount of therapeutic agent sufficient to reduce or minimize disease progression, e.g., delay or minimize the spread of cancer. A therapeutically effective amount may also refer to the amount of the therapeutic agent that provides a therapeutic benefit in the treatment or management of a disease. Further, a therapeutically effective amount with respect to a therapeutic agent means that amount of therapeutic agent alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment or management of a disease, e.g., sufficient to enhance the therapeutic efficacy of a therapeutic antibody sufficient to treat or manage a disease.
[0193] As used herein, the term prophylactic agent refers to an agent that can be used in the prevention of a disorder or disease prior to the detection of any symptoms of such disorder or disease. A prophylactically effective amount is the amount of prophylactic agent sufficient to mediate such protection. A prophylactically effective amount may also refer to the amount of the prophylactic agent that provides a prophylactic benefit in the prevention of disease. Further, a prophylactically effective amount with respect to a prophylactic agent means that amount of prophylactic agent alone, or in combination with other agents, that provides a prophylactic benefit in the prevention of disease.
[0194] The dosage amounts and frequencies of administration provided herein are encompassed by the terms therapeutically effective and prophylactically effective. The dosage and frequency further will typically vary according to factors specific for each patient depending on the specific therapeutic or prophylactic agents administered, the severity and type of cancer, the route of administration, as well as age, body weight, response, and the past medical history of the patient. Suitable regimens can be selected by one skilled in the art by considering such factors and by following, for example, dosages reported in the literature and recommended in the Physician's Desk Reference (56.sup.th Ed., 2002).
[0195] 1. Uses of Up-Modulators of the Immune System
[0196] One embodiment concerns H7CR-binding molecules, such as anti-H7CR antibodies (and fragments of such antibodies that bind to H7CR) or B7-H7 Ig, that, by binding to H7CR agonize (i.e., enhance) T cell proliferation and/or cytokine production. The administration of such molecules to a subject up-modulates the immune system of the subject. As H7CR expression is associated with a nave T cell phenotype, administration of such molecules would be effective for increasing T cell priming and activation and thus would be good to combine with vaccines. Furthermore, agonistic anti-H7CR (and B7-H7 Ig) would be very good to combine with molecules that target immune-checkpoints and inhibit receptors that would normally dampen the immune response: anti-PD-1, anti-B7-H1, anti-CTLA4 etc. Such antibodies may be better administered in sequence, i.e., anti-H7CR first to enhance T cell priming, followed by e.g., anti-PD-1 to prevent T cell exhaustion. Bi-specific molecules targeting H7CR and immune-checkpoint blockade are also contemplated.
[0197] Up-modulation of the immune system is particularly desirable in the treatment of cancers and chronic infections (e.g., HIV infection, AIDS, etc.) and thus the disclosed molecules have utility in the treatment of such disorders. Macrophages have been shown to contribute significantly to the initial steps of HIV infection (Carter, C. A. et al. (2008) Cell Biology Of HIV-1 Infection Of Macrophage, Ann. Rev. Microbiol. 62:425-443; Noursadeghi, M. et al. (2006) HIV-1 Infection Of Mononuclear Phagocytic Cells: The Case For Bacterial Innate Immune Deficiency In AIDS, Lancet Infect. Dis. 6:794-804). Accordingly antibodies (particularly if conjugated to a toxin) that bind B7-H7 have utility in preventing or treating HIV infection.
[0198] As used herein, the term cancer refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells. As used herein, cancer explicitly includes leukemias and lymphomas. The term refers to a disease involving cells that have the potential to metastasize to distal sites and exhibit phenotypic traits that differ from those of non-cancer cells, for example, formation of colonies in a three-dimensional substrate such as soft agar or the formation of tubular networks or weblike matrices in a three-dimensional basement membrane or extracellular matrix preparation. Non-cancer cells do not form colonies in soft agar and form distinct sphere-like structures in three-dimensional basement membrane or extracellular matrix preparations.
[0199] Cancers and related disorders that can be treated or prevented include, but are not limited to, the following: leukemias including, but not limited to, acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemias such as myeloblastic, promyelocytic, myelomonocytic, monocytic, erythroleukemia leukemias and myelodysplastic syndrome, chronic leukemias such as but not limited to, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, hairy cell leukemia; polycythemia vera; lymphomas such as, but not limited to, Hodgkin's disease, non-Hodgkin's disease; multiple myelomas such as, but not limited to, smoldering multiple myeloma, nonsecretory myeloma, osteosclerotic myeloma, plasma cell leukemia, solitary plasmacytoma and extramedullary plasmacytoma; Waldenstrom's macroglobulinemia; monoclonal gammopathy of undetermined significance; benign monoclonal gammopathy; heavy chain disease; bone and connective tissue sarcomas such as, but not limited to, bone sarcoma, osteosarcoma, chondrosarcoma, Ewing's sarcoma, malignant giant cell tumor, fibrosarcoma of bone, chordoma, periosteal sarcoma, soft-tissue sarcomas, angiosarcoma (hemangiosarcoma), fibrosarcoma, Kaposi's sarcoma, leiomyosarcoma, liposarcoma, lymphangiosarcoma, neurilemmoma, rhabdomyosarcoma, synovial sarcoma; brain tumors including but not limited to, glioma, astrocytoma, brain stem glioma, ependymoma, oligodendroglioma, nonglial tumor, acoustic neurinoma, craniopharyngioma, medulloblastoma, meningioma, pineocytoma, pineoblastoma, primary brain lymphoma; breast cancer including, but not limited to, adenocarcinoma, lobular (small cell) carcinoma, intraductal carcinoma, medullary breast cancer, mucinous breast cancer, tubular breast cancer, papillary breast cancer, Paget's disease, and inflammatory breast cancer; adrenal cancer, including but not limited to, pheochromocytoma and adrenocortical carcinoma; thyroid cancer such as but not limited to papillary or follicular thyroid cancer, medullary thyroid cancer and anaplastic thyroid cancer; pancreatic cancer, including but not limited to, insulinoma, gastrinoma, glucagonoma, vipoma, somatostatin-secreting tumor, and carcinoid or islet cell tumor; pituitary cancers including but not limited to, Cushing's disease, prolactin-secreting tumor, acromegaly, and diabetes insipius; eye cancers including, but not limited to, ocular melanoma such as iris melanoma, choroidal melanoma, and cilliary body melanoma, and retinoblastoma; vaginal cancers, including, but not limited to, squamous cell carcinoma, adenocarcinoma, and melanoma; vulvar cancer, including but not limited to, squamous cell carcinoma, melanoma, adenocarcinoma, basal cell carcinoma, sarcoma, and Paget's disease; cervical cancers including, but not limited to, squamous cell carcinoma, and adenocarcinoma; uterine cancers including, but not limited to, endometrial carcinoma and uterine sarcoma; ovarian cancers including, but not limited to, ovarian epithelial carcinoma, borderline tumor, germ cell tumor, and stromal tumor; esophageal cancers including, but not limited to, squamous cancer, adenocarcinoma, adenoid cyctic carcinoma, mucoepidermoid carcinoma, adenosquamous carcinoma, sarcoma, melanoma, plasmacytoma, verrucous carcinoma, and oat cell (small cell) carcinoma; stomach cancers including, but not limited to, adenocarcinoma, fungating (polypoid), ulcerating, superficial spreading, diffusely spreading, malignant lymphoma, liposarcoma, fibrosarcoma, and carcinosarcoma; colon cancers; rectal cancers; liver cancers including, but not limited to, hepatocellular carcinoma and hepatoblastoma, gallbladder cancers including, but not limited to, adenocarcinoma; cholangiocarcinomas including, but not limited to, papillary, nodular, and diffuse; lung cancers including but not limited to, non-small cell lung cancer, squamous cell carcinoma (epidermoid carcinoma), adenocarcinoma, large-cell carcinoma and small-cell lung cancer; testicular cancers including, but not limited to, germinal tumor, seminoma, anaplastic, classic (typical), spermatocytic, nonseminoma, embryonal carcinoma, teratoma carcinoma, choriocarcinoma (yolk-sac tumor), prostate cancers including, but not limited to, adenocarcinoma, leiomyosarcoma, and rhabdomyosarcoma; penal cancers; oral cancers including, but not limited to, squamous cell carcinoma; basal cancers; salivary gland cancers including, but not limited to, adenocarcinoma, mucoepidermoid carcinoma, and adenoidcystic carcinoma; pharynx cancers including, but not limited to, squamous cell cancer, and verrucous; skin cancers including, but not limited to, basal cell carcinoma, squamous cell carcinoma and melanoma, superficial spreading melanoma, nodular melanoma, lentigo malignant melanoma, acral lentiginous melanoma; kidney cancers including, but not limited to, renal cell cancer, adenocarcinoma, hypernephroma, fibrosarcoma, transitional cell cancer (renal pelvis and/or ureter); Wilms' tumor; bladder cancers including, but not limited to, transitional cell carcinoma, squamous cell cancer, adenocarcinoma, carcinosarcoma. In addition, cancers include myxosarcoma, osteogenic sarcoma, endotheliosarcoma, lymphangioendotheliosarcoma, mesothelioma, synovioma, hemangioblastoma, epithelial carcinoma, cystadenocarcinoma, bronchogenic carcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma and papillary adenocarcinomas (for a review of such disorders, see Fishman et al., 1985, Medicine, 2d Ed., J.B. Lippincott Co., Philadelphia and Murphy et al., 1997, Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery, Viking Penguin, Penguin Books U.S.A., Inc., United States of America).
[0200] Accordingly, the disclosed methods and compositions are also useful in the treatment, inhibition or prevention of a variety of cancers or other abnormal proliferative diseases, including (but not limited to) the following: carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, pancreas, stomach, cervix, thyroid and skin; including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Berketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyoscarcoma; other tumors, including melanoma, seminoma, tetratocarcinoma, neuroblastoma and glioma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; tumors of mesenchymal origin, including fibrosafcoma, rhabdomyoscarama, and osteosarcoma; and other tumors, including melanoma, xenoderma pegmentosum, keratoactanthoma, seminoma, thyroid follicular cancer and teratocarcinoma. It is also contemplated that cancers caused by aberrations in apoptosis would also be treated by the disclosed methods and compositions. Such cancers may include, but are not be limited to, follicular lymphomas, carcinomas with p53 mutations, hormone dependent tumors of the breast, prostate and ovary, and precancerous lesions such as familial adenomatous polyposis, and myelodysplastic syndromes. In specific embodiments, malignancy or dysproliferative changes (such as metaplasias and dysplasias), or hyperproliferative disorders, are treated or prevented by the disclosed methods and compositions in the ovary, bladder, breast, colon, lung, skin, pancreas, or uterus. In other specific embodiments, sarcoma, melanoma, or leukemia is treated or prevented by the disclosed methods and compositions.
[0201] Cancer cells acquire a characteristic set of functional capabilities during their development, albeit through various mechanisms. Such capabilities include evading apoptosis, self-sufficiency in growth signals, insensitivity to anti-growth signals, tissue invasion/metastasis, limitless explicative potential, and sustained angiogenesis. The term cancer cell is meant to encompass both pre-malignant and malignant cancer cells. In some embodiments, cancer refers to a benign tumor, which has remained localized. In other embodiments, cancer refers to a malignant tumor, which has invaded and destroyed neighboring body structures and spread to distant sites. In yet other embodiments, the cancer is associated with a specific cancer antigen (e.g., pan-carcinoma antigen (KS 1/4), ovarian carcinoma antigen (CA125), prostate specific antigen (PSA), carcinoembryonic antigen (CEA), CD 19, CD20, HER2/neu, etc.).
[0202] Similar to its application to tumors as discussed above, the disclosed antibodies and antigen-binding fragments can be used alone, or as an adjuvant, in combination with vaccines or with antimibrobial agents, to stimulate the immune response against toxins or self-antigens or against pathogens (e.g., viruses, such as HIV, HTLV, hepatitis virus, influenza virus, respiratory syncytial virus, vaccinia virus, rabies virus; bacteria, such as those of Mycobacteria, Staphylococci, Streptococci, Pneumonococci, Meningococci, Conococci, Klebsiella, Proteus, Serratia, Pseudomonas, Legionella, Corynebacteria, Salmonella, Vibrio, Clostridia, Bacilli, Pasteurella, Leptospirosis, Bordatella, and particularly such pathogens associated with cholera, tetanus, botulism, anthrax, plague, and Lyme disease; or fungal or parasitic pathogens, such as Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizophus), Sporothrix (schenkii), Blastomyces (dermatitidis), Paracoccidioides (brasiliensis), Coccidioides (immitis) and Histoplasma (capsulatum), Entamoeba, histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba sp., Giardia Zambia, Cryptosporidium sp., Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Toxoplasma gondi, etc.)., Sporothrix, Blastomyces, Paracoccidioides, Coccidioides, Histoplasma, Entamoeba, Histolytica, Balantidium, Naegleria, Acanthamoeba, Giardia, Cryptosporidium, Pneumocystis, Plasmodium, Babesia, or Trypanosoma, etc. Thus, the antibodies and antigen-binding fragments have utility in the treatment of infectious disease.
[0203] Another use of the antibodies and antigen-binding fragments is to block or deplete T cells in patients having T cell cancers. In one embodiment such blockage or depletion is accomplished using anti-H7CR antibodies that bind to a site proximal to the binding site of H7CR to its ligand, such that normal H7CR function is impaired or disrupted. As a consequence of such disruption the effective (functional) concentration of T cells is depleted. In a preferred embodiment, such depletion is accomplished using anti-H7CR antibodies that are conjugated to a toxin, such that their binding to a T cell leads to the death of the cell. Preferably, in either embodiment, the sequence of the Fc region of the antibody will have been deleted (for example, an Fab or F(ab).sub.2, etc.) or modified so that the molecule will exhibit diminished or no Fc receptor (FcR) binding activity, or will exhibit enhanced antibody-dependent cell-mediated cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC) activities.
[0204] 2. Uses of Down-Modulators of the Immune System
[0205] An alternative embodiment relates to molecules, such as anti-B7-H7 antibodies (and fragments of such antibodies that bind to B7-H7 or H7CR Ig, that, by binding to B7-H7 antagonize (i.e., attenuate or impair) H7CR function and T cell proliferation and/or cytokine production. The administration of such molecules to a subject down-modulates the immune system of the subject, and is particularly useful for the treatment of inflammation or autoimmunity.
[0206] Another embodiment provides antibodies that bind to H7CR and block ligand interaction with H7CR and do not agonize H7CR.
[0207] Down-modulation of the immune system is desirable in the treatment of inflammatory and auto-immune diseases. Examples of autoimmune disorders that may be treated by administering the antibodies include, but are not limited to, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune diseases of the adrenal gland, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune oophoritis and orchitis, autoimmune thrombocytopenia, Behcet's disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatrical pemphigoid, CREST syndrome, cold agglutinin disease, Crohn's disease, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, glomerulonephritis, Graves' disease, Guillain-Barre, Hashimoto's thyroiditis, idiopathic pulmonary fibrosis, idiopathic thrombocytopenia purpura (ITP), IgA neuropathy, juvenile arthritis, lichen planus, lupus erthematosus, Mnire's disease, mixed connective tissue disease, multiple sclerosis, Neuromyelitis optica (NMO), type 1 or immune-mediated diabetes mellitus, myasthenia gravis, pemphigus vulgaris, pernicious anemia, polyarteritis nodosa, polychrondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis and dermatomyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, psoriatic arthritis, Raynauld's phenomenon, Reiter's syndrome, Rheumatoid arthritis, sarcoidosis, scleroderma, Sjgren's syndrome, stiff-man syndrome, systemic lupus erythematosus, lupus erythematosus, takayasu arteritis, temporal arteristis/giant cell arteritis, ulcerative colitis, uveitis, vasculitides such as dermatitis herpetiformis vasculitis, vitiligo, and Wegener's granulomatosis.
[0208] Examples of inflammatory disorders which can be prevented, treated or managed include, but are not limited to, asthma, encephilitis, inflammatory bowel disease, chronic obstructive pulmonary disease (COPD), allergic disorders, septic shock, pulmonary fibrosis, undifferentiated spondyloarthropathy, undifferentiated arthropathy, arthritis, inflammatory osteolysis, and chronic inflammation resulting from chronic viral or bacterial infections.
[0209] The described anti-H7CR antibodies may be employed to produce anti-idiotypic peptides or antibodies (Wallmann, J. et al. (2010) Anti-Ids in Allergy: Timeliness of a Classic Concept, World Allergy Organiz. J. 3(6): 195-201; Nardi, M. et al. (2000) Antiidiotype Antibody Against Platelet Anti-GpIIIa Contributes To The Regulation Of Thrombocytopenia In HIV-1-ITP Patients J. Exp. Med. 191(12):2093-2100) or mimetics (Zang, Y. C. et al. (2003) Human Anti-Idiotypic T Cells Induced By TCR Peptides Corresponding To A Common CDR3 Sequence Motif In Myelin Basic Protein-Reactive T Cells; Int. Immunol. 15(9): 1073-1080; Loiarro, M. et al. (Epub 2010 Apr. 8) Targeting TLR/IL-1R Signalling In Human Diseases, Mediators Inflamm. 2010:674363) of H7CR. Such molecules serve as surrogates for H7CR, and thus their administration to a subject down-modulates the immune system of such subject by engaging the B7-H7 ligand and preventing it from binding the endogenous H7CR receptor. Such molecules have utility in the treatment of graft vs. host disease. Similarly, agonist antibodies that enhance binding between such antibodies and such receptor/ligand have utility as agonists of H7CR signaling and thus have utility in the treatment of inflammation and autoimmune disease.
[0210] Thus, the antibodies and antigen-binding fragments have utility in the treatment of inflammatory and auto-immune diseases.
F. Methods of Administration
[0211] Various delivery systems are known and can be used to administer the therapeutic or prophylactic compositions described herein, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the antibody or fusion protein, receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429-4432), construction of a nucleic acid as part of a retroviral or other vector, etc.
[0212] Methods of administering a humanized antibody include, but are not limited to, parenteral administration (e.g., intradermal, intramuscular, intraperitoneal, intravenous and subcutaneous), epidural, and mucosal (e.g., intranasal and oral routes). In a specific embodiment, the disclosed antibodies are administered intramuscularly, intravenously, or subcutaneously. The compositions may be administered by any convenient route, for example, by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. In addition, pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. See, e.g., U.S. Pat. Nos. 6,019,968; 5,985,320; 5,985,309; 5,934,272; 5,874,064; 5,855,913; 5,290,540; and 4,880,078; and PCT Publication Nos. WO 92/19244; WO 97/32572; WO 97/44013; WO 98/31346; and WO 99/66903. In a specific embodiment, it may be desirable to administer the pharmaceutical compositions locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion, by injection, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. Preferably, when administering one or more of the disclosed antibodies, care must be taken to use materials to which the antibody or the fusion protein does not absorb.
[0213] In some embodiments, the humanized or chimeric antibodies are formulated in liposomes for targeted delivery of the disclosed antibodies. Liposomes are vesicles composed of concentrically ordered phopsholipid bilayers which encapsulate an aqueous phase. Liposomes typically include various types of lipids, phospholipids, and/or surfactants. The components of liposomes are arranged in a bilayer configuration, similar to the lipid arrangement of biological membranes. Liposomes are particularly preferred delivery vehicles due, in part, to their biocompatibility, low immunogenicity, and low toxicity. Methods for preparation of liposomes are known in the art, see, e.g., Epstein et al., 1985, Proc. Natl. Acad. Sci. USA, 82: 3688; Hwang et al., 1980 Proc. Natl Acad. Sci. USA, 77: 4030-4; U.S. Pat. Nos. 4,485,045 and 4,544,545.
[0214] Methods of preparing liposomes with a prolonged serum half-life, i.e., enhanced circulation time, such as those disclosed in U.S. Pat. No. 5,013,556 can be used to produce antibody formulations. Preferred liposomes used in the disclosed methods are not rapidly cleared from circulation, i.e., are not taken up into the mononuclear phagocyte system (MPS). The liposomes include sterically stabilized liposomes which are prepared using common methods known to one skilled in the art. Although not intending to be bound by a particular mechanism of action, sterically stabilized liposomes contain lipid components with bulky and highly flexible hydrophilic moieties, which reduces the unwanted reaction of liposomes with serum proteins, reduces oposonization with serum components and reduces recognition by MPS. Sterically stabilized liposomes are preferably prepared using polyethylene glycol. For preparation of liposomes and sterically stabilized liposome, see, e.g., Bendas et al., 2001 BioDrugs, 15(4): 215-224; Allen et al., 1987 FEBS Lett. 223: 42-6; Klibanov et al., 1990 FEBS Lett., 268: 235-7; Blum et al., 1990, Biochim. Biophys. Acta., 1029: 91-7; Torchilin et al., 1996, J. Liposome Res. 6: 99-116; Litzinger et al., 1994, Biochim. Biophys. Acta, 1190: 99-107; Maruyama et al., 1991, Chem. Pharm. Bull, 39: 1620-2; Klibanov et al., 1991, Biochim Biophys Acta, 1062; 142-8; Alien et al., 1994, Adv. Drug Deliv. Rev, 13: 285-309. Liposomes that are adapted for specific organ targeting, see, e.g., U.S. Pat. No. 4,544,545, or specific cell targeting, see, e.g., U.S. Patent Application Publication No. 2005/0074403 can also be used. Particularly useful liposomes for use in the compositions and methods can be generated by reverse phase evaporation method with a lipid composition including phosphatidylcholine, cholesterol, and PEG derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. In some embodiments, a fragment of an antibody, e.g., F(ab), may be conjugated to the liposomes using previously described methods, see, e.g., Martin et al., 1982, J. Biol. Chem. 257: 286-288.
[0215] The humanized or chimeric antibodies may also be formulated as immunoliposomes. Immunoliposomes refer to a liposomal composition, wherein an antibody or a fragment thereof is linked, covalently or non-covalently to the liposomal surface. The chemistry of linking an antibody to the liposomal surface is known in the art, see, e.g., U.S. Pat. No. 6,787,153; Allen et al., 1995, Stealth Liposomes, Boca Rotan: CRC Press, 233-44; Hansen et al., 1995, Biochim. Biophys. Acta, 1239: 133-144.
[0216] The humanized or chimeric antibodies can be packaged in a hermetically sealed container, such as an ampoule or sachette, indicating the quantity of antibody. In one embodiment, the antibodies are supplied as a dry sterilized lyophilized powder or water free concentrate in a hermetically sealed container and can be reconstituted, e.g., with water or saline to the appropriate concentration for administration to a subject. Preferably, the antibodies are supplied as a dry sterile lyophilized powder in a hermetically sealed container at a unit dosage of at least 5 mg, more preferably at least 10 mg, at least 15 mg, at least 25 mg, at least 35 mg, at least 45 mg, at least 50 mg, or at least 75 mg. The lyophilized antibodies should be stored at between 2 and 8 C. in their original container and the antibodies should be administered within 12 hours, preferably within 6 hours, within 5 hours, within 3 hours, or within 1 hour after being reconstituted. In an alternative embodiment, antibodies are supplied in liquid form in a hermetically sealed container indicating the quantity and concentration of the antibody, fusion protein, or conjugated molecule. Preferably, the liquid form of the antibodies are supplied in a hermetically sealed container at least 1 mg/ml, more preferably at least 2.5 mg/ml, at least 5 mg/ml, at least 8 mg/ml, at least 10 mg/ml, at least 15 mg/kg, at least 25 mg/ml, at least 50 mg/ml, at least 100 mg/ml, at least 150 mg/ml, at least 200 mg/ml of the antibodies.
[0217] The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the condition, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. For the disclosed antibodies, the dosage administered to a patient is typically 0.0001 mg/kg to 100 mg/kg of the patient's body weight. Preferably, the dosage administered to a patient is between 0.0001 mg/kg and 20 mg/kg, 0.0001 mg/kg and 10 mg/kg, 0.0001 mg/kg and 5 mg/kg, 0.0001 and 2 mg/kg, 0.0001 and 1 mg/kg, 0.0001 mg/kg and 0.75 mg/kg, 0.0001 mg/kg and 0.5 mg/kg, 0.0001 mg/kg to 0.25 mg/kg, 0.0001 to 0.15 mg/kg, 0.0001 to 0.10 mg/kg, 0.001 to 0.5 mg/kg, 0.01 to 0.25 mg/kg or 0.01 to 0.10 mg/kg of the patient's body weight. Generally, human antibodies have a longer half-life within the human body than antibodies from other species due to the immune response to the foreign polypeptides. Thus, lower dosages of human antibodies and less frequent administration is often possible. Further, the dosage and frequency of administration of antibodies or fragments thereof may be reduced by enhancing uptake and tissue penetration of the antibodies by modifications such as, for example, lipidation.
[0218] In yet another embodiment, the compositions can be delivered in a controlled release or sustained release system. Any technique known to one of skill in the art can be used to produce sustained release formulations including one or more antibodies. See, e.g., U.S. Pat. No. 4,526,938; PCT publication WO 91/05548; PCT publication WO 96/20698; Ning et al., 1996, Intratumoral Radioimmunotheraphy of a Human Colon Cancer Xenograft Using a Sustained-Release Gel, Radiotherapy & Oncology 39: 179-189, Song et al., 1995, Antibody Mediated Lung Targeting of Long-Circulating Emulsions, PDA Journal of Pharmaceutical Science & Technology 50:372-397; Cleek et al., 1997, Biodegradable Polymeric Carriers for a bFGF Antibody for Cardiovascular Application, Pro. Intl. Symp. Control. Rel. Bioact. Mater. 24:853-854; and Lam et al., 1997, Microencapsulation of Recombinant Humanized Monoclonal Antibody for Local Delivery, Proc. Int'l. Symp. Control Rel. Bioact. Mater. 24:759-760. In one embodiment, a pump may be used in a controlled release system (See Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:20; Buchwald et al., 1980, Surgery 88:507; and Saudek et al., 1989, N. Engl. J. Med. 321:574). In another embodiment, polymeric materials can be used to achieve controlled release of antibodies (see e.g., Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, 1983, J., Macromol. Sci. Rev. Macromol. Chem. 23:61; See also Levy et al., 1985, Science 228:190; During et al., 1989, Ann. Neurol. 25:351; Howard et al., 1989, J. Neurosurg. 7 1:105); U.S. Pat. No. 5,679,377; U.S. Pat. No. 5,916,597; U.S. Pat. No. 5,912,015; U.S. Pat. No. 5,989,463; U.S. Pat. No. 5,128,326; PCT Publication No. WO 99/15154; and PCT Publication No. WO 99/20253). Examples of polymers used in sustained release formulations include, but are not limited to, poly(-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N-vinyl pyrrolidone), poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters. In yet another embodiment, a controlled release system can be placed in proximity of the therapeutic target (e.g., the lungs), thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)). In another embodiment, polymeric compositions useful as controlled release implants are used according to Dunn et al. (See U.S. Pat. No. 5,945,155). This particular method is based upon the therapeutic effect of the in situ controlled release of the bioactive material from the polymer system. The implantation can generally occur anywhere within the body of the patient in need of therapeutic treatment. In another embodiment, a non-polymeric sustained delivery system is used, whereby a non-polymeric implant in the body of the subject is used as a drug delivery system. Upon implantation in the body, the organic solvent of the implant will dissipate, disperse, or leach from the composition into surrounding tissue fluid, and the non-polymeric material will gradually coagulate or precipitate to form a solid, microporous matrix (See U.S. Pat. No. 5,888,533). Controlled release systems are discussed in the review by Langer (1990, Science 249:1527-1533). Any technique known to one of skill in the art can be used to produce sustained release formulations including one or more therapeutic agents. See, e.g., U.S. Pat. No. 4,526,938; International Publication Nos. WO 91/05548 and WO 96/20698; Ning et al., 1996, Radiotherapy & Oncology 39:179-189; Song et al., 1995, PDA Journal of Pharmaceutical Science & Technology 50:372-397; Cleek et al., 1997, Pro. Int'l. Symp. Control. Rel. Bioact. Mater. 24:853-854; and Lam et al., 1997, Proc. Intl Symp. Control Rel. Bioact. Mater. 24:759-760.
[0219] In a specific embodiment wherein the therapeutic or prophylactic composition is a nucleic acid encoding a disclosed antibody or an antigen-binding fragment thereof, the nucleic acid can be administered in vivo to promote expression of its encoded antibody, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector (See U.S. Pat. No. 4,980,286), or by direct injection, or by use of microparticle bombardment (e.g., a gene gun; Biolistic, Dupont), or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox-like peptide which is known to enter the nucleus (See e.g., Joliot et al., 1991, Proc. Natl. Acad. Sci. USA 88:1864-1868), etc. Alternatively, a nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression by homologous recombination.
[0220] Treatment of a subject with a therapeutically or prophylactically effective amount of the disclosed antibodies can include a single treatment or, preferably, can include a series of treatments.
G. Pharmaceutical Compositions
[0221] The disclosed compositions can include bulk drug compositions useful in the manufacture of pharmaceutical compositions (e.g., impure or non-sterile compositions) and pharmaceutical compositions (i.e., compositions that are suitable for administration to a subject or patient) which can be used in the preparation of unit dosage forms. Such compositions can include a prophylactically or therapeutically effective amount of a prophylactic and/or therapeutic agent disclosed herein or a combination of those agents and a pharmaceutically acceptable carrier. Preferably, the compositions include a prophylactically or therapeutically effective amount of humanized antibodies and a pharmaceutically acceptable carrier.
[0222] In a specific embodiment, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term carrier refers to a diluent, adjuvant (e.g., Freund's adjuvant (complete and incomplete), excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
[0223] Generally, the ingredients of compositions can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0224] The compositions can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include, but are not limited to, those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
H. Kits
[0225] Another embodiment provides a pharmaceutical pack or kit including one or more containers filled with of the disclosed humanized antibodies. Additionally, one or more other prophylactic or therapeutic agents useful for the treatment of a disease can also be included in the pharmaceutical pack or kit. The pharmaceutical pack or kit can include one or more containers filled with one or more of the ingredients of the disclosed pharmaceutical compositions. Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
[0226] The kits that can be used in the above methods include the following. In one embodiment, a kit can include one or more of the disclosed humanized antibodies. In another embodiment, a kit further includes one or more other prophylactic or therapeutic agents useful for the treatment of cancer, in one or more containers. In another embodiment, a kit further includes one or more cytotoxic antibodies that bind one or more cancer antigens associated with cancer. In certain embodiments, the other prophylactic or therapeutic agent is a chemotherapeutic. In other embodiments, the prophylactic or therapeutic agent is a biological or hormonal therapeutic.
I. Diagnostic Methods
[0227] The disclosed antibodies and their antigen-binding fragments can be used for diagnostic purposes, such as to detect, diagnose, or monitor diseases, disorders or infections associated with H7CR expression. The detection or diagnosis of a disease, disorder or infection, particularly an autoimmune disease can be performed by: (a) assaying the expression of H7CR in cells or in a tissue sample of a subject using one or more antibodies (or fragments thereof) that immunospecifically bind to such antigens; and (b) comparing the level of the antigen with a control level, e.g., levels in normal tissue samples or levels in tissue at a different point in time, whereby an increase or decrease in the assayed level of antigen compared to the control level of the antigen is indicative of the disease, disorder or infection. Such antibodies and fragments are preferably employed in immunoassays, such as the enzyme linked immunosorbent assay (ELISA), the radioimmunoassay (RIA) and fluorescence-activated cell sorting (FACS).
[0228] One aspect relates to the use of such antibodies and fragments, and particularly such antibodies and fragments that bind to human H7CR, as reagents for IHC analysis in cells of an in vitro or in situ tissue sample or in vivo. Thus, the antibodies and fragments thereof the have utility in the detection and diagnosis of a disease, disorder, or infection in a human. In one embodiment, such diagnosis includes: a) administering to a subject (for example, parenterally, subcutaneously, or intraperitoneally) an effective amount of a labeled antibody or antigen-binding fragment that immunospecifically binds to H7CR; b) waiting for a time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject where H7CR is expressed (and for unbound labeled molecule to be cleared to background level); c) determining background level; and d) detecting the labeled antibody in the subject, such that detection of labeled antibody above the background level indicates that the subject has the disease, disorder, or infection. In accordance with this embodiment, the antibody is labeled with an imaging moiety which is detectable using an imaging system known to one of skill in the art. Background level can be determined by various methods including, comparing the amount of labeled molecule detected to a standard value previously determined for a particular system.
[0229] It will be understood in the art that the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images. In vivo tumor imaging is described in S. W. Burchiel et al.,Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments, (Chapter 13 in T
[0230] Depending on several variables, including the type of label used and the mode of administration, the time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject and for unbound labeled molecule to be cleared to background level is 6 to 48 hours or 6 to 24 hours or 6 to 12 hours. In another embodiment the time interval following administration is 5 to 20 days or 5 to 10 days.
[0231] In one embodiment, monitoring of a disease, disorder or infection is carried out by repeating the method for diagnosing the disease, disorder or infection, for example, one month after initial diagnosis, six months after initial diagnosis, one year after initial diagnosis, etc.
[0232] Presence of the labeled molecule can be detected in the subject using methods known in the art for in vivo scanning. These methods depend upon the type of label used. Skilled artisans will be able to determine the appropriate method for detecting a particular label. Methods and devices that may be used in the diagnostic methods include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography.
[0233] In a specific embodiment, the molecule is labeled with a radioisotope and is detected in the patient using a radiation responsive surgical instrument (Thurston et al., U.S. Pat. No. 5,441,050). In another embodiment, the molecule is labeled with a fluorescent compound and is detected in the patient using a fluorescence responsive scanning instrument. In another embodiment, the molecule is labeled with a positron emitting metal and is detected in the patient using positron emission-tomography. In yet another embodiment, the molecule is labeled with a paramagnetic label and is detected in a patient using magnetic resonance imaging (MRI).
[0234] Having now generally described the invention, the same will be more readily understood through reference to the following examples, which are provided by way of illustration and are not intended to be limiting of the present invention unless specified.
Example 1
Characterization of Anti-Human H7CR Antibodies and Expression Pattern of H7CR
Materials and Methods
[0235] For binding affinity estimation, 0.2 million CHO.hH7CR transfectants (
5 g/ml H7CR 1.3, 4.5 and 7.8 mAbs was used to stain H7CR stable transfectants to show binding specificity (
Immunohistochemistry staining for H7CR on human tonsil paraffin-embedded section was performed with 4.5 antibody at a concentration of 5 g/ml using a standard protocol (
Results
[0236] Hamster antibodies 1.3, 4.5 and 7.8 were found to be capable of immunospecifically binding to human H7CR.
[0237]
[0238] The anti-H7CR antibodies permitted a determination of the expression profiles of H7CR and B7-H7.
[0239] An in vitro functional analysis of expression of B7-H7 was conducted. Matured monocyte-derived dendritic cells were evaluated for their ability to express B7-H7 and other activation markers. The results of this study (
Example 2
Anti-H7CR Antibodies Promote Antigen Specific Memory T Cell Responses
Materials and Methods
[0240] In order to further characterize the anti-H7CR antibodies, a tetanus toxoid (TT) memory recall response assay was conducted. Monocyte-derived immature DC were matured by incubation with 1 ng/ml TNF and 1 g/ml PGE2 for two days, and were incubated in the presence of 50 g/ml tetanus toxoid (TT) overnight on the second day of DC maturation. The dendritic cells were washed three times with X-Vivo media and then incubated in the presence of carboxyfluorescein succinimidyl ester (CFSE)-labeled autologous T cells at a ratio of 1:20 for two weeks in the presence of 100 ng/ml TT and 10 g/ml H7CR1.3, 4.5 or 7.8 monoclonal antibody (
[0241] Culture supernatants were collected at different time points for total cytokine analysis by Bio-Plex Pro Human Cytokine 17-Plex kit (M5000031YV, BioRad) according to Manufacturer's manual. Data were collected and analysized by Bio-Plex 200 system (BioRad).
Results
[0242] The results of this analysis (
[0243] Cells were subjected to intracellular staining after 5 hr incubation with Golgi Block (without PMA and Ionmycin) and their intracellular expression of IFN and carboxyfluorescein succinimidyl ester (CSFE) dilution were assessed. The results of this investigation revealed that treatment with anti-H7CR antibodies enhanced proliferation as represented by CF SE dilution and IFN expression in antigen-specific T cells (
[0244] Among 1.3 humanized variants (
Example 3
The Interaction of B7-H7:H7CR Regulates Antigen-Specific Human T Cell Responses
Materials and Methods
[0245] In order to determine the role of the B7-H7:H7CR pathway on the antigen-specific T cell response, purified human CD4.sup.+ T cells were labeled with CFSE, and cultured with autologous monocyte-derived dendritic cells that had been pre-incubated with 50 g/ml tetanus toxoid (TT) as antigen. The dendritic cells were washed three times with X-Vivo media and then incubated in the presence of carboxyfluorescein succinimidyl ester (CFSE)-labeled autologous T cells at a ratio of 1:20 for two weeks in the presence of 100 ng/ml TT and 10 g/ml H7CR monoclonal antibody. Cellular proliferation was monitored by CFSE dilution using flow cytometry.
Results
[0246] A TT-specific T cell proliferation was found to be strongly augmented when agonistic anti-H7CR mAb were included in the culture (to amplify H7CR signal on T cells) (
[0247] Cells incubated in the presence of the agonistic anti-H7CR mAb exhibited a substantial enhancement of cytokine production, including IFN- (
Example 4
Humanization of Anti-H7CR Antibodies 1.3 and 4.5
[0248] Hamster anti-H7CR antibodies 1.3 and 4.5 were humanized using a process that included generating a homology modeled antibody 3D structure and creating a profile of the parental antibody based on structure modeling. A set of humanized heavy and light chain variable region sequences were generated, each of which combined specific regions of the parental antibody sequence with the majority of the human framework sequence. A total of 6 humanized heavy chain sequences and 6 humanized light chain sequences were produced.
[0249] Sequence alignments comparing the variable domains of antibody 1.3 to the human germline framework sequence database were generated using Geneious. Preferred acceptor frameworks were identified based on the overall sequence identity across the framework, matching interface position, similarly classed CDR canonical positions, and presence of N-glycosylation sites that would have to be removed.
[0250] A structural model of the variable light and heavy chains of the antibodies was generated in Discovery Studio. Template structures were identified by searching the PDB database with the 1.3 light chain and heavy chain variable domain sequences with and without their CDRs. The alignment of the 1.3 sequences to the templates and modeling the structures based on homology were carried out using MODELLER (Sali, A. et al. (1993) Comparative Protein Modelling By Satisfaction Of Spatial Restraints, J. Molec. Biol. 234(3):779-815).
[0251] A number of hybrid sequences that combined different regions of the parental antibody sequence with that of the human frameworks were systematically analyzed using the 3D model to identify the hybrid sequences that were predicted to have the least impact on the defined structure of the CDRs (Chothia, C. et al. (1987) Canonical Structures For The Hypervariable Regions Of Immunoglobulins, J. Mol. Biol. 196:901-917; Martin, A. C. et al. (1996) Structural Families In Loops Of Homologous Proteins: Automatic Classification, Modelling And Application To Antibodies, J. Molec. Biol. 263(5):800-815). Particular attention was given to hybrid sequences that contained amino acids from the human framework that were within 5A of CDR loops, in the Vernier zone, in the VH/VL interchain interface, or in CDR canonical class determining positions, as these hybrid sequences are judged more likely to have a detrimental effect on the function of the resulting humanized antibody.
[0252] A profile of the parental antibody was created based on CDR analysis and structure modeling. Human acceptor frameworks were identified based on sequence and homology comparisons. Humanized antibodies were designed by creating multiple hybrid sequences that fuse parts of the parental antibody sequence with the human framework sequences. Using the 3D model, these humanized sequences were methodically analyzed by eye and by computer modeling to isolate the sequences that would most likely retain antigen binding. The goal was to maximize the amount of human sequence in the final humanized antibody while retaining the original antibody specificity.
[0253] Collier de Perles is a 2D representation of variable domains and provides information on the amino acid positions in beta-strands and loops in the variable domains (Ruiz, M. et al. (2002) IMGT Gene Identification And Colliers de Perles Of Human Immunoglobulins With Known 3D Structures, Immunogenetics 53(10-11):857-883). Collier de Perles of antibody 1.3 light chain and heavy chain variable regions are shown in
[0254] Humanization of Antibody 1.3
[0255] Sequence alignments comparing hamster antibody 1.3 variable domains to the human germline database were generated. Based on the overall sequence identity, matching interface position, and similarly classed CDR canonical positions, two germline families were identified as possible acceptor frameworks for the light chain: IGKV4-1*01 and IGKV2D-28*01. The J-segment genes were compared to the parental sequence over FR4 and J-segments, and IGKJ2*01 was selected for the light chain. Alignment of the parental 1.3 VL chain to these acceptor frameworks is shown in Table 6, with non-identical residues shown underlined.
TABLE-US-00019 TABLE6 VariableLightChain SEQID# Sequence 10203040 Hamster1.3 60 DIVMTQSPSSLAVSAGEKVTISCLSSQSLFSSNTNRNYLN IGKV4-1*01 61 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLA IGKV2D-28*01 62 DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSN-GYNYLD 50607080 Hamster1.3 63 WYLQKPGQSPKLLIYHASTRLTGVPDRFIGSGSGTDFTLT IGKV4-1*01 64 WYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT IGKV2D-28*01 65 WYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLK 90100110 Hamster1.3 66 ISSVQAEDLGDYYCQHHYETPLTFGDGTKLEIK IGKV4-1*01 67 ISSLQAEDVAVYYCQQYYSTPYT IGKV2D-28*01 68 ISRVEAEDVGVYYCMQALQTPYT IGHJ2*01 69 FGQGTKLEIK
[0256] The heavy chain of hamster antibody 1.3 was found to be most similar to the germline IGHV4-31*02. In the top 50 closest germlines to antibody 1.3 heavy chain, none of the CDR H3 have the same length as the 1.3 heavy chain. Therefore, a rearranged heavy chain was selected as the second acceptor framework (AAY33199.1) based on overall similarity, CDR lengths, and CDR canonical structures. The J-segment genes were compared to the Parental sequence over FR4 and J-segments, and IGHJ3*01 was selected for the heavy chain. Alignment of the parental VH chain to these acceptor frameworks is shown in Table 7, with non-identical residues shown underlined.
TABLE-US-00020 TABLE7 VariableHeavyChain SEQID# Sequence 10203040 Hamster1.3 70 QIQLQESGPGLVKPSQSLSLTCSVTGFSISTSGYYWTWIR IGHV4-31*02 71 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIP AAY33199.1 72 QVQLQESGPGLVKPAQTLSLTCTVSGGSISSVNYYWSWIR 50607080 Hamster1.3 73 QFPGKRLEWMGYINYGGGTSYNPSLKSRISITRDTSKNQF IGHV4-31*02 74 CHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQF AAY33199.1 75 QYPGKGLEWIGYIYYRGSTYYNPSLKSRVTISVDTSKNQF 90100110120 Hamster3.1 76 LLHLNSVTTEDTATYCCATMADRFAFFDVWGQGIQVTVSS IGHV4-31*02 77 SLKLSSVTAADTAVYYCAR AAY33199.1 78 SLKLTSVTAADTAVYHCARERTMTGAFDIWGQGTMVTVSS IGHJ3*01 79 DAFDVWGQGTMVTVSS
[0257] For the light chain, three humanized chains were created for each of the two acceptor frameworks IGKV4-1*01 and IGKV2D-28*01 to thereby form six humanized 1.3 light chains. The first humanized chain for each acceptor framework (VL1A, VL2A) contains the most human framework (Humanized Light Chain 1). The second humanized chain for each acceptor framework (VLIB, VL2B) contains some amount of parental sequence fused with the human framework sequence, which should help retain the original CDR conformation (Humanized Light Chain 2). The third humanized chain for each of the acceptor frameworks (VL1C, VL2C) contains even more parental sequence fused with the human framework, which should help maintain the original antibody specificity and CDR structure (Humanized Light Chain 3). The amino acid sequences of these chains are as indicated below.
[0258] Amino Acid Sequences of the Light Chain Variable Region of the humanized variants of anti-human H7CR antibody 1.3, as derived from the IGKV4-1*01 acceptor framework (CDRs are shown underlined):
TABLE-US-00021 1. VL1AIGKV4-1*01(Humanized1): (SEQIDNO:17) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTNRNYLA WYQQKPGQPPKLLIYHASTRESGVPDRFSGSGSGTDFTLT ISSLQAEDVAVYYCQHHYETPLTFGQGTKLEIK 2. VL1BIGKV4-1*01(Humanized2): (SEQIDNO:18) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTNRNYLN WYQQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLT ISSLQAEDVADYYCQHHYETPLTFGDGTKLEIK 3. VL1CIGKV4-1*01(Humanized3): (SEQIDNO:19) DIVMTQSPDSLAVSLGERATINCLSSQSLFSSNTNRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFITSGSGTDFTLT ISSLQAEDVGDYYCQHHYETPLTFGDGTKLEIK
[0259] Amino Acid Sequences of the Light Chain Variable Region of the humanized variants of anti-human H7CR antibody 1.3, as derived from the IGKV2D-28*01 acceptor framework (CDRs are shown underlined):
TABLE-US-00022 1. VL2AIGKV2D-28*01(Humanized1): (SEQIDNO:20) DIVMTQSPLSLPVTPGEPASISCRSSQSLFSSNTNRNYLD WYLQKPGQSPQLLIYHASNRASGVPDRFSGSGSGTDFTLK ISRVEAEDVGVYYCQHHYETPLTFGDGTKLEIK 2. VL2BIGKV2D-28*01(Humanized2): (SEQIDNO:21) DIVMTQSPLSLPVTPGEPASISCRSSQSLFSSNTNRNYLN WYLQKPGQSPKLLIYHASTRASGVPDRFSGSGSGTDFTLK ISRVEAEDVGVYYCQHHYETPLTFGDGTKLEIK 3. VL2CIGKV2D-28*01(Humanized3): (SEQIDNO:22) DIVMTQSPLSLPVTPGEPASISCLSSQSLFSSNTNRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLK ISRVEAEDVGDYYCQHHYETPLTFGDGTKLEIK
[0260] For the heavy chain, three humanized chains were created for each of the IGHV4-31*02 and AAY33199.1 acceptor frameworks identified above. In a similar fashion to the light chain, the first humanized chain for each acceptor framework (VH1A, VH2A) contains the most human sequence (Humanized 1). The second humanized chain for each acceptor framework (VH1B, VH2B) should help retain the original CDR conformation (Humanized 2). The third chain for each of the acceptor frameworks (VH1C, VH2C) should help maintain the original antibody specificity and CDR structure (Humanized 3). The amino acid sequences of these chains are as indicated below.
[0261] Amino Acid Sequences of the Heavy Chain Variable Region of the humanized variants of anti-human H7CR antibody 1.3, as derived from the IGHV4-31*02 acceptor framework (CDRs are shown underlined):
TABLE-US-00023 1. VH1AIGHV4-31*02(Humanized1): (SEQIDNO:23) QVQLQESGPGLVKPSQTLSLTCTVSGFSISTSGYYWSWIR QHPGKGLEWIGYINYGGGTYYNPSLKSRVTISVDTSKNQF SLKLSSVTAADTAVYYCATMADRFAFFDVWGQGTMVTVSS 2. VH1BIGHV4-31*02(Humanized2): (SEQIDNO:24) QVQLQESGPGLVKPSQTLSLTCTVSGFSISTSGYYWSWIR QHPGKRLEWIGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTAVYCCATMADRFAFFDVWGQGTMVTVSS 3. VH1CIGHV4-31*02(Humanized3): (SEQIDNO:25) QVQLQESGPGLVKPSQTLSLTCTVSGFSISTSGYYWSWIR QFPGKRLEWMGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTATYCCATMADRFAFFDVWGQGTMVTVSS
[0262] Amino Acid Sequences of the Heavy Chain Variable Region of the humanized variants of anti-human H7CR antibody 1.3, as derived from the AAY33199.1 acceptor framework (CDRs are shown underlined):
TABLE-US-00024 1.VH2AAAY33199.1(Humanized1): (SEQIDNO:26) QVQLQESGPGLVKPAQTLSLTCTVSGFSISTSGYYWSWIR QYPGKGLEWIGYINYGGGTYYNPSLKSRVTISVDTSKNQF SLKLTSVTAADTAVYHCATMADRFAFFDVWGQGTMVTVSS 2.VH2BAAY33199.1(Humanized2): (SEQIDNO:27) QVQLQESGPGLVKPAQTLSLTCTVSGFSISTSGYYWSWIR QYPGKRLEWIGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLTSVTAADTATYCCATMADRFAFFDVWGQGTMVTVSS 3.VH2CAAY33199.1(Humanized3): (SEQIDNO:28) QVQLQESGPGLVKPAQTLSLTCTVSGFSISTSGYYWSWIR QFPGKRLEWMGYINYGGGTSYNPSLKSRVTISRDTSKNQF SLKLTSVTAADTATYCCATMADRFAFFDVWGQGTMVTVSS
[0263] Preferred antibodies and their antigen-binding fragments include any of the 36 combinations of the above-described humanized variants of anti-human H7CR antibody 1.3. Specifically, such antibodies contain the combinations shown in Table 4. All 36 such humanized variants of anti-human H7CR antibody 1.3 were evaluated for their respective ability to bind human H7CR molecules as ectopically expressed on the surface of a CHO cell and 28 out of 36 are found to be able to bind to such human H7CR molecules.
Humanization of Anti-H7CR Antibody 4.5
[0264] Sequence alignments comparing hamster antibody 4.5 variable domains to the human germline database were generated. Based on the overall sequence identity, matching interface position, and similarly classed CDR canonical positions, two germline families were identified as possible acceptor frameworks for the light chain: IGKV4-1*01 and IGKV2D-40*01. The J-segment genes were compared to the parental sequence over FR4 and J-segments, and IGKJ5*01 was selected for the light chain. Alignment of the parental 1.3 VL chain to these acceptor frameworks is shown in Table 8, with non-identical residues shown underlined.
TABLE-US-00025 TABLE8 Variable SEQ LightChain ID# Sequence 10203040 Hamster4.5 80 DIVMTQSPSSLAVSAGEKVTISCLSSQSLFSSNTKRNYLN IGKV4-1*01 81 DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLA IGKV2D-40*01 82 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLD 50607080 Hamster4.5 83 WYLQKPGQSPKLLIYHASTRLTGVPGRFIGSGSGTDFTLT IGKV4-1*01 84 WYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT IGKV2D-40*01 85 WYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLK 90100110 Hamster4.5 86 VSTVQAEDLGDYFCQQHYETPLTFGDGTRLEIK IGKV4-1*01 87 ISSLQAEDVAVYYCQQYYSTPYT IGKV2D-40*01 88 ISRVEAEDVGVYYCMQRIEFP IGKJ5*01 89 ITFGQGTRLEIK
[0265] The heavy chain of hamster antibody 4.5 was found to be most similar to the germline IGHV4-31*02. In the top 50 closest germlines to antibody 4.5 heavy chain, the second acceptor framework that had a similar canonical structure is IGHV2-5*01. The J-segment genes were compared to the Parental sequence over FR4 and J-segments, and IGHJ5*01 was selected for the heavy chain. Alignment of the parental VH chain to these acceptor frameworks is shown in Table 9, with non-identical residues shown underlined.
TABLE-US-00026 TABLE9 Variable SEQ HeavyChain ID# Sequence 10203040 Hamster4.5 90 QIQLQESGPGLVKPSQSLSLTCSVTGFSITTGGYYWNWIR IGHV4-31*02 91 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIR IGHV2-5*01 92 QITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIR 50607080 Hamster4.5 93 QFPGKKLEWMGYIYTSGRTSYNPSLKSRISITRDTSKNQF IGHV4-31*02 94 QHPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQF IGHV2-5*01 95 QPPGKALEWLALIYWNDDKRYSPSLKSRLTITKDTSKNQV 90100110 Hamster4.5 96 FLQLNSMTTEDTATYYCADMADKGGWFAYWGQGTLVTVSS IGHV4-31*02 97 SLKLSSVTAADTAVYYCA----R IGHV2-5*01 98 VLTMTNMDPVDTATYYCA----HR IGHJ5*01 99 NWFDSWGQGTLVTVSS
[0266] For the light chain, three humanized chains were created for each of the two acceptor frameworks IGKV4-1*01 and IGKV2D-40*01 to thereby form six humanized 4.5 light chains. The first humanized chain for each acceptor framework (VL1A, VL2A) contains the most human framework (Humanized Light Chain 1). The second humanized chain for each acceptor framework (VL1B, VL2B) contains some amount of parental sequence fused with the human framework sequence, which should help retain the original CDR conformation (Humanized Light Chain 2). The third humanized chain for each of the acceptor frameworks (VL1C, VL2C) contains even more parental sequence fused with the human framework, which should help maintain the original antibody specificity and CDR structure (Humanized Light Chain 3). The amino acid sequences of these chains are as indicated below.
[0267] Amino Acid Sequences of the Light Chain Variable Region of the humanized variants of anti-human H7CR antibody 4.5, as derived from the IGKV4-1*01 acceptor framework (CDRs are shown underlined):
TABLE-US-00027 1.VL1AIGKV4-1*01(Humanized1): (SEQIDNO:33) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTKRNYLA WYQQKPGQPPKLLIYHASTRESGVPDRFSGSGSGTDFTLT ISSLQAEDVAVYYCQQHYETPLTFGQGTRLEIK 2.VL1BIGKV4-1*01(Humanized2): (SEQIDNO:34) DIVMTQSPDSLAVSLGERATINCKSSQSLFSSNTKRNYLN WYQQKPGQPPKLLIYHASTRLSCVPDRFSGSGSGTDFTLT ISSLQAEDVADYFCQQHYETPLTFGDGTRLEIK 3.VL1CIGKV4-1*01(Humanized3): (SEQIDNO:35) DIVMTQSPDSLAVSLGERATINCLSSQSLFSSNTKRNYLN WYQQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLT ISSLQAEDVADYFCQQHYETPLTFGDGTRLEIK
[0268] Amino Acid Sequences of the Light Chain Variable Region of the humanized variants of anti-human H7CR antibody 4.5, as derived from the IGKV2D-40*01 acceptor framework (CDRs are shown underlined):
TABLE-US-00028 1.VL2AIGKV2D-40*01(Humanized1): (SEQIDNO:36) DIVMTQTPLSLPVTPGEPASISCRSSQSLFSSNTKRNYLD WYLQKPGQSPQLLIYHASYRASGVPDRFSGSGSGTDFTLK ISRVEAEDVGVYYCQQHYETPLTFGQGTRLEIK 2.VL2BIGKV2D-40*01(Humanized2): (SEQIDNO:37) DIVMTQTPLSLPVTPGEPASISCRSSQSLFSSNTKRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLK ISRVEAEDVGDYFCQQHYETPLTFGDGTRLEIK 3.VL2CIGKV2D-40*01(Humanized3): (SEQIDNO:38) DIVMTQTPSSLPVTPGEPASISCLSSQSLFSSNTKRNYLN WYLQKPGQSPKLLIYHASTRLSGVPDRFSGSGSGTDFTLK ISRVEAEDVGDYFCQQHYETPLTFGDGTRLEIK
[0269] For the heavy chain, three humanized chains were created for each of the IGHV4-31*02 and IGHV2-5*01 acceptor frameworks identified above. In a similar fashion to the light chain, the first humanized chain for each acceptor framework (VH1A, VH2A) contains the most human sequence (Humanized 1). The second humanized chain for each acceptor framework (VH1B, VH2B) should help retain the original CDR conformation (Humanized 2). The third chain for each of the acceptor frameworks (VH1C, VH2C) should help maintain the original antibody specificity and CDR structure (Humanized 3). The amino acid sequences of these chains are as indicated below.
[0270] Amino Acid Sequences of the Heavy Chain Variable Region of the humanized variants of anti-human H7CR antibody 4.5, as derived from the IGHV4-31*02 acceptor framework (CDRs are shown underlined):
TABLE-US-00029 1.VH1AIGHV4-31*02(Humanized1) (SEQIDNO:39) QVQLQESGPGLVKPSQTLSLTCTVSGFSITTGGYYWSWIR QHPGKGLEWIGYIYTSGRTYYNPSLKSRVTISVDTSKNQF SLKLSSVTAADTAVYYCADMADKGGWFAYWGQGTLVTVSS 2.VH1BIGHV4-31*02(Humanized2): (SEQIDNO:40) QVQLQESGPGLVKPSQTLSLTCTVSGFSITTGGYYWNWIR QHPGKKLEWIGYIYTSGRTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTAVYYCADMADKGGWFAYWGQGTLVTVSS 3.VH1CIGHV4-31*02(Humanized3): (SEQIDNO:41) QVQLQESGPGLVKPSQTLSLTCTVSGFSITTGGYYWNWIR QFPGKKLEWMGYIYTSGRTSYNPSLKSRVTISRDTSKNQF SLKLSSVTAADTAVYYCADMADKGGWFAYWGQGTLVTVSS
[0271] Amino Acid Sequences of the Heavy Chain Variable Region of the humanized variants of anti-human H7CR antibody 4.5 as derived from the IGHV2-5*01 acceptor framework (CDRs are shown underlined):
TABLE-US-00030 1.VH2AIGHV2-5*01(Humanized1): (SEQIDNO:42) QITLKESGPTLVKPTQTLTLTCTFSGFSITTGGYYVGWIR QPPGKALEWLALIYTSGRTRYSPSLKSRLTITKDTSKNQV VLTMTNMDPVDTATYYCADMADKGGWFAYWGQGTLVTVSS 2.VH2BIGHV2-5*01(Humanized2): (SEQIDNO:43) QITLKESGPTLVKPTQTLTLTCTVSGFSITTGGYYWNWIR QPPGKKLEWLALIYTSGRTSYNPSLKSRLTITKDTSKNQV VLTMTNMDPVDTATYYCADMADKGGWFAYWGQGTLVTVSS 3.VH2CIGHV2-5*01(Humanized3): (SEQIDNO:44) QIQLKESGPTLVKPTQTLTLTCTVSGFSITTGGYYWNWIR QPPGKKLEWMALIYTSGRTSYNPSLKSRLTITKDTSKNQV VLTMTNMDPVDTATYYCADMADKGGWFAYWGQGTLVTVSS
[0272] Preferred antibodies and their antigen-binding fragments include any of the 36 combinations of the above-described humanized variants of anti-human H7CR antibody 4.5. Specifically, such antibodies include the combinations shown in Table 5. All 36 such humanized variants of anti-human H7CR antibody 4.5 are evaluated for their respective ability to bind human H7CR molecules as endogenously expressed on the surface of a cell and all are found to be able to bind to such human H7CR molecules.
Example 5
Antibody 1.3 Increases T Cell Functionality In Vivo
Materials and Methods
[0273] NOD-SCID I12rg/ (NSG) mice (Jackson Lab) were intraperitoneally transferred with 1520 million human PBMCs or 10 million purified naive CD4+ human T cells. On day 0 and day 2, each mouse was inoculated peritoneally with 300 g control or H7CR mAb 1.3. 6 days after transfer, splenocytes were harvested. Human T cells were detected by staining for human CD45, CD3, and CD8. To monitor cell division, hPBMCs were labeled with CFSE before transfer.
Results
[0274] Flow cytometric analysis revealed that antibody 1.3 expanded human anti-mouse xeno-reactive T cells as evidenced by increased population of CFSE diluted population in both human CD4+ and CD8+ T cells. (
Example 6
Antibody 1.3 Increase CD40L, IFN, and CD107a Expression In Vivo: Xeno GvDH Model
Materials and Methods
[0275] NOD-SCID (NSG) mice (Jackson Lab) were intraperitoneally transferred with 1520 million human PBMCs or 10 million purified nave CD4+ human T cells. On day 0 and day 2, each mouse was inoculated peritoneally with 300 g control or H7CR mAb 1.3. 6 days after transfer, splenocytes were harvested. Human T cells were detected by staining for human CD45, CD3, and CD8. Splenocytes were restimulated in vitro with PMA plus ionomycin to detect IFN- or CD107a-producing cells. To monitor cell division, hPBMCs were labeled with CFSE before transfer.
Results
[0276]
Example 7
Characterization of Variants of Antibody 1.3
Materials and Methods
[0277] 100 l 1 mg/ml H7CRECD human IgGl Fc fusion protein diluted in PBS was immobilized on a flat bottom 96 well plate (Costar 9017) overnight at 4 C. Plates were washed twice with PBS+0.1% PS-20 and blocked with 200 l/well PBS 10% FBS at RT for 1 hr. 100 l human IgG4 Fc chimeric 1.3 and 14 selected 1.3 humanized variants diluted in PBS 10% FBS were added to each well and incubated at RT for 1 hr. Plates were washed three times and 100 l 1 g/ml anti-human IgG4 HRP (Southern Biotech) was added to each well and incubated at RT for 1 hr. Plates were washed six times and 100 l TMB substrate (SurModics) was added to each well for 5-15 mins. 100 l stop solution (0.1M Sulfuric acid) was added to each well. Plates were read at Absorbance 450 nm by PerkinElmer EnVision 2104 Multilabel Reader.
[0278] The binding affinities for 14 variants of antibody 1.3 were investigated using an ELISA assay to a H7CR fusion protein.
Results
[0279] The binding affinity results are shown in Table 10.
TABLE-US-00031 TABLE 10 ANTIBODY HEAVY CHAIN LIGHT CHAIN EC.sub.50 (nM) chimeric 0.055 V1 1A 1A 0.84 SEQ ID NO: 23 SEQ ID NO: 17 V2 1B 1A 0.23 SEQ ID NO: 24 SEQ ID NO: 17 V3 1C 1A 0.38 SEQ ID NO: 25 SEQ ID NO: 17 V4 2A 1A 1.08 SEQ ID NO: 26 SEQ ID NO: 17 V5 2B 1A 0.28 SEQ ID NO: 27 SEQ ID NO: 17 V6 2C 1A 0.30 SEQ ID NO: 28 SEQ ID NO: 17 V7 1B 1B 1.01 SEQ ID NO: 24 SEQ ID NO: 18 V8 1C 1B 0.74 SEQ ID NO: 25 SEQ ID NO: 18 V9 2B 1B 2.43 SEQ ID NO: 27 SEQ ID NO: 18 V10 2C 1B 1.18 SEQ ID NO: 28 SEQ ID NO: 18 V11 1B 1C 1.04 SEQ ID NO: 24 SEQ ID NO: 19 V12 1C 1C 0.75 SEQ ID NO: 25 SEQ ID NO: 19 V13 2B 1C 0.45 SEQ ID NO: 27 SEQ ID NO: 19 V14 2C 1C 0.32 SEQ ID NO: 28 SEQ ID NO: 19
[0280]
[0281] The sequences for chimeric 1.3 antibody are [[is]] as follows: Heavy chain nucleic acid sequence:
TABLE-US-00032 (SEQIDNO:100) ATGGAATGGTCCTGGGTGTTCCTGTTCTTCCTGTCCGTGACCACCGG CGTGCACTCCCAGATCCAGCTGCAGGAATCTGGCCCTGGCCTCGTGA AGCCTTCCCAGTCCCTGTCCCTGACCTGCAGCGTGACCGGCTTCTCC ATCTCCACCTCCGGCTACTACTGGACCTGGATCCGGCAGTTCCCTGG CAAGCGGCTGGAATGGATGGGCTACATCAACTACGGCGGAGGCACCT CCTACAACCCCAGCCTGAACTTCCCGGATCTCCATCACCCGGGATAC CTCCAAGAACCAGTTCCTGCTGCACCTGAACTCCGTGACAACCGAGG ACACCGCCACCTACTGCTGCGCTACCATGGCCGACAGATTCGCCTTC TTCGACGTGTGGGGCCAGGGCATCCAAGTGACCGTGTCCTCCGCTTC CACCAAGGGCCCCTCTGTGTTTCCTCTGGCCCCTTGCTCCCGGTCCA CCTCTGAGTCTACAGCCGCTCTGGGCTGCCTCGTGAAAGACTACTTC CCCGAGCCCGTGACAGTGTCCTGGAACTCTGGCGCTCTGACCTCTGG CGTGCACACCTTCCCTGCTGTGCTGCAGTCTAGCGGCCTGTACTCCC TGTCCTCCGTCGTGACCGTGCCTTCCAGCTCTCTGGGCACCAAGACC TACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAGGTGGACAA GAGAGTGGAATCTAAGTACGGCCCTCCCTGCCCCCCTTGTCCTGCCC CTGAATTTCTGGGCGGACCCTCCGTGTTTCTGTTCCCCCCAAAGCCC AAGGACACCCTGATGATCTCCCGGACCCCCGAAGTGACCTGCGTGGT GGTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTGGTACG TGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGAA CAGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCA CCAGGATTGGCTGAACGGCAAAGAGTACAAGTGCAAGGTGTCCAACA AGGGCCTGCCCTCCAGCATCGAAAAGACCATCTCCAAGGCTAAGGGC CAGCCCCGCGAGCCCCAGGTGTACACACTGCCTCCAAGCCAGGAAGA GATGACCAAGAATCAGGTGTCACTGACCTGTCTCGTGAAGGGCTTCT ACCCCTCCGATATCGCCGTGGAATGGGAGTCCAACGGCCAGCCCGAG AACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACGGCTCCTT CTTTCTGTACTCTCGCCTGACCGTGGACAAGTCCCGGTGGCAGGAAG GCAACGTGTTCTCCTGCTCTGTGATGCACGAGGCCCTGCACAACCAC TACACCCAGAAGTCCCTGAGCCTGTCCCCCGGCTGATGA.
[0282] Light chain nucleic acid sequence:
TABLE-US-00033 (SEQIDNO:101) ATGTCCGTGCCCACCCAGGTGCTGGGATTGCTGCTGCTGTGGCTGAC CGACGCCAGATGCGACATCGTGATGACCCAGTCCCCCTCCTCCCTGG CTGTGTCTGCTGGCGAGAAAGTGACCATCTCCTGCCTGTCCTCCCAG TCCCTGTTCTCCTCCAACACCAACCGGAACTACCTGAACTGGTATCT GCAGAAGCCCGGCCAGTCCCCTAAGCTGCTGATCTACCACGCCTCCA CCAGACTGACCGGCGTGCCCGATAGATTCATCGGCTCTGGCTCCGGC ACCGACTTTACCCTGACCATCAGCTCCGTGCAGGCCGAGGACCTGGG CGACTACTACTGCCAGCACCACTACGAGACACCCCTGACCTTTGGCG ACGGCACCAAGCTGGAAATCAAGCGGACCGTGGCCGCTCCCTCCGTG TTCATCTTCCCACCTTCCGACGAGCAGCTGAAGTCTGGCACCGCCTC TGTCGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGC AGTGGAAGGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCC GTGACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCAGCAC CCTGACCCTGTCCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCT GCGAAGTGACCCACCAGGGCCTGTCTAGCCCCGTGACCAAGTCTTTC AACCGGGGCGAGTGCTGATGA.
[0283] Heavy chain protein sequence:
TABLE-US-00034 (SEQIDNO:11) MEWSWVFLFFLSVTTGVHSQIQLQESGPGLVKPSQSLSLTCSVTGFS ISTSGYYWTWIRQFPGKRLEWMGYINYGGGTSYNPSLKSRISITRDT SKNQFLLHLNSVTTEDTATYCCATMADRFAFFDVWGQGIQVTVSSAS TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDK RVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVEH QDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPG**.
[0284] Light chain protein sequence:
TABLE-US-00035 (SEQIDNO:12) MSVPTQVLGLLLLWLTDARCDIVMTQSPSSLAVSAGEKVTISCLSSQ SLFSSNTNRNYLNWYLQKPGQSPKLLIYHASTRLTGVPDRFIGSGSG TDFTLTTSSVQAEDLGDYYCQHHYETPLTFGDGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC**.
Example 8
Humanized H7CR Antibody 4.5 Variants
Materials and Methods
[0285] 5 g/ml antibodies from thirty-six variants were incubated with H7CR-GFP fusion protein transfected CHO cells for 30 min at room temperature. Cells were then washed twice with 2 ml flow cytometry buffer, and resuspended in 100 l flow cytometry buffer. 1 l anti-hIg PE secondary antibody (Biolegend) was added and incubated with the cells for 15 mins. Samples were then washed and resuspended in 100 l flow cytometry buffer. Flow Cytometry data was acquired using BD Canto (BD Biosciences) in plate format and analyzed by FlowJo software. X axis shows H7CR-GFP expression and Y axis shows variant binding to the transfectants.
Results
[0286] Thirty-six humanized variants of H7CR antibody 4.5 were assayed for binding specificity for H7CR. The results are presented in
TABLE-US-00036 TABLE 11 4.5 antibody humanized variants 4.5 humanized variants Heavy Light Variant # Chain Chain 1 HC1-1 (SEQ ID NO: 39) LC1-1 (SEQ ID NO: 33) 2 HC1-1 (SEQ ID NO: 39) LC1-2 (SEQ ID NO: 34) 3 HC1-1 (SEQ ID NO: 39) LC1-3 (SEQ ID NO: 35) 4 HC1-1 (SEQ ID NO: 39) LC2-1 (SEQ ID NO: 36) 5 HC1-1 (SEQ ID NO: 39) LC2-2 (SEQ ID NO: 37) 6 HC1-1 (SEQ ID NO: 39) LC2-3 (SEQ ID NO: 38) 7 HC1-2 (SEQ ID NO: 40) LC1-1 (SEQ ID NO: 33) 8 HC1-2 (SEQ ID NO: 40) LC1-2 (SEQ ID NO: 34) 9 HC1-2 (SEQ ID NO: 40) LC1-3 (SEQ ID NO: 35) 10 HC1-2 (SEQ ID NO: 40) LC2-1 (SEQ ID NO: 36) 11 HC1-2 (SEQ ID NO: 40) LC2-2 (SEQ ID NO: 37) 12 HC1-2 (SEQ ID NO: 40) LC2-3 (SEQ ID NO: 38) 13 HC1-3 (SEQ ID NO: 41) LC1-1 (SEQ ID NO: 33) 14 HC1-3 (SEQ ID NO: 41) LC1-2 (SEQ ID NO: 34) 15 HC1-3 (SEQ ID NO: 41) LC1-3 (SEQ ID NO: 35) 16 HC1-3 (SEQ ID NO: 41) LC2-1 (SEQ ID NO: 36) 17 HC1-3 (SEQ ID NO: 41) LC2-2 (SEQ ID NO: 37) 18 HC1-3 (SEQ ID NO: 41) LC2-3 (SEQ ID NO: 38) 19 HC2-1 (SEQ ID NO: 42) LC1-1 (SEQ ID NO: 33) 20 HC2-1 (SEQ ID NO: 42) LC1-2 (SEQ ID NO: 34) 21 HC2-1 (SEQ ID NO: 42) LC1-3 (SEQ ID NO: 35) 22 HC2-1 (SEQ ID NO: 42) LC2-1 (SEQ ID NO: 36) 23 HC2-1 (SEQ ID NO: 42) LC2-2 (SEQ ID NO: 37) 24 HC2-1 (SEQ ID NO: 42) LC2-3 (SEQ ID NO: 38) 25 HC2-2 (SEQ ID NO: 43) LC1-1 (SEQ ID NO: 33) 26 HC2-2 (SEQ ID NO: 43) LC1-2 (SEQ ID NO: 34) 27 HC2-2 (SEQ ID NO: 43) LC1-3 (SEQ ID NO: 35) 28 HC2-2 (SEQ ID NO: 43) LC2-1 (SEQ ID NO: 36) 29 HC2-2 (SEQ ID NO: 43) LC2-2 (SEQ ID NO: 37) 30 HC2-2 (SEQ ID NO: 43) LC2-3 (SEQ ID NO: 38) 31 HC2-3 (SEQ ID NO: 44) LC1-1 (SEQ ID NO: 33) 32 HC2-3 (SEQ ID NO: 44) LC1-2 (SEQ ID NO: 34) 33 HC2-3 (SEQ ID NO: 44) LC1-3 (SEQ ID NO: 35) 34 HC2-3 (SEQ ID NO: 44) LC2-1 (SEQ ID NO: 36) 35 HC2-3 (SEQ ID NO: 44) LC2-2 (SEQ ID NO: 37) 36 HC2-3 (SEQ ID NO: 44) LC2-3 (SEQ ID NO: 38)
[0287] The sequence data for the chimeric 4.5 antibody is as follows:
[0288] Heavy chain nucleic acid sequence:
TABLE-US-00037 (SEQIDNO:13) ATGGAATGGTCCTGGGTGTTCCTGTTCTTCCTGTCCGTGACCACCGG CGTGCACTCCCAGATCCAGCTGCAGGAATCTGGCCCTGGCCTCGTGA AGCCTTCCCAGTCCCTGTCCCTGACCTGCAGCGTGACCGGCTTCTCT ATCACAACCGGCGGCTACTACTGGAACTGGATCCGGCAGTTCCCCGG CAAGAAACTGGAATGGATGGGCTACATCTATACCAGCGGCCGGACCT CCTACAACCCCAGCCTGAAGTCCCGGATCTCCATCACCCGGGACACC TCCAAGAACCAGTTCTTTCTGCAGCTGAACTCCATGACCACCGAGGA CACCGCCACCTACTACTGCGCCGACATGGCCGATAAGGGCGGATGGT TCGCTTACTGGGGCCAGGGCACACTCGTGACCGTGTCCTCTGCTTCC ACCAAGGGCCCCTCCGTGTTTCCTCTGGCCCCTTGCTCCAGATCCAC CTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAAGACTACTTCC CCGAGCCCGTGACAGTGTCTTGGAACTCTGGCGCCCTGACCTCTGGC GTGCACACCTTTCCAGCTGTGCTGCAGTCCTCCGGCCTGTACTCCCT GTCCTCCGTCGTGACTGTGCCCTCCAGCTCTCTGGGCACCAAGACCT ACACCTGTAACGTGGACCACAAGCCCTCCAACACCAAGGTGGACAAG CGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTCCTTGCCCAGCCCC TGAATTTCTGGGCGGACCTTCTGTGTTTCTGTTCCCCCCAAAGCCCA AGGACACCCTGATGATCTCCCGGACCCCCGAAGTGACCTGCGTGGTG GTGGATGTGTCCCAGGAAGATCCCGAGGTGCAGTTCAATTGGTACGT GGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGAAC AGTTCAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCAC CAGGATTGGCTGAACGGCAAAGAGTACAAGTGCAAGGTGTCCAACAA GGGCCTGCCCAGCTCCATCGAAAAGACCATCTCCAAGGCTAAGGGCC AGCCCCGCGAGCCCCAGGTGTACACACTGCCTCCAAGCCAGGAAGAG ATGACCAAGAATCAGGTGTCACTGACCTGTCTCGTGAAGGGCTTCTA CCCCTCCGATATCGCCGTGGAATGGGAGTCCAACGGCCAGCCCGAGA ACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACGGCTCCTTC TTTCTGTACTCTCGCCTGACCGTGGACAAGTCCCGGTGGCAGGAAGG CAACGTGTTCTCCTGCTCTGTGATGCACGAGGCCCTGCACAACCACT ACACCCAGAAGTCCCTGAGCCTGTCCCCCGGCTGATGA.
[0289] Light chain nucleic acid sequence:
TABLE-US-00038 (SEQIDNO:14) ATGTCCGTGCCCACCCAGGTGCTGGGATTGCTGCTGCTGTGGCTGAC CGACGCCAGATGCGACATCGTGATGACCCAGTCCCCCTCCTCCCTGG CTGTGTCTGCTGGCGAGAAAGTGACCATCTCCTGCCTGTCCTCCCAG TCCCTGTTCTCCAGCAACACCAAGCGGAACTACCTGAACTGGTATCT GCAGAAGCCCGGCCAGTCCCCTAAGCTGCTGATCTACCACGCCTCCA CCAGACTGACCGGCGTGCCCGGAAGATTCATCGGCTCTGGCTCTGGC ACCGACTTCACCCTGACCGTGTCTACCGTGCAGGCCGAGGACCTGGG CGACTACTTCTGCCAGCAGCACTACGAGACACCCCTGACCTTTGGCG ACGGCACCCGGCTGGAAATCAAGAGAACCGTGGCCGCTCCCTCCGTG TTCATCTTCCCACCTTCCGACGAGCAGCTGAAGTCCGGCACCGCTTC TGTCGTGTGCCTGCTGAACAACTTCTACCCCCGCGAGGCCAAGGTGC AGTGGAAGGTGGACAACGCCCTGCAGTCCGGCAACTCCCAGGAATCC GTGACCGAGCAGGACTCCAAGGACAGCACCTACTCCCTGTCCTCTAC CCTGACCCTGAGCAAGGCCGACTACGAGAAGCACAAGGTGTACGCCT GCGAAGTGACCCACCAGGGCCTGTCTAGCCCCGTGACCAAGTCTTTC AACCGGGGCGAGTGCTGATGA.
[0290] Heavy chain protein sequence:
TABLE-US-00039 (SEQIDNO:15) MEWSWVFLFFLSVTTGVHSQIQLQESGPGLVKPSQSLSLTCSVTGFS ITTGGYYWNWIRQFPGKKLEWMGYIYTSGRTSYNPSLKSRISTTRDT SKNQFFLQLNSMTTEDTATYYCADMADKGGWFAYWGQGTLVTVSSAS TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDK RVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPG**.
[0291] Light chain protein sequence:
TABLE-US-00040 (SEQIDNO:16) MSVPTQVLGLLLLWLTDARCDIVMTQSPSSLAVSAGEKVTISCLSSQ SLFSSNTKRNYLNWYLQKPGQSPKLLIYHASTRLTGVPGRFIGSGSG TDFTLTVSTVQAEDLGDYFCQQHYETPLTFGDGTRLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC**.
[0292] All publications and patents mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference in its entirety. While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the essential features hereinbefore set forth.