Ron inhibitors for use in preventing and treating bone loss
09907791 ยท 2018-03-06
Assignee
Inventors
Cpc classification
C07D401/12
CHEMISTRY; METALLURGY
C07D491/02
CHEMISTRY; METALLURGY
A61K31/4355
HUMAN NECESSITIES
A61K31/444
HUMAN NECESSITIES
International classification
Abstract
Provided herein are methods for inhibiting osteolysis or treating osteoporosis in a subject in need thereof, the method including administering to the subject at least one RON inhibitor. The osteolysis may be caused by a condition selected from the group consisting of cancer, inflammation, and cyst. The condition may include a bone tumor or a tumor located in bone. The subject may have been diagnosed with bone cancer. The inhibitor may be ASLAN002. The inhibitor may be OSI-296. The inhibitor may be selective or specific for RON. The inhibitor may not depend on the function of RANKL or TGF.
Claims
1. A method for inhibiting osteolysis or treating osteoporosis in a subject in need thereof, the method comprising administering to the subject a composition comprising an effective amount of at least one Recepteur d'Origine Nantais (RON) inhibitor selected from the group consisting of OSI-296 and ASLAN002.
2. The method of claim 1, wherein the subject has been diagnosed with a condition selected from the group consisting of inflammation, cyst, and cancer.
3. The method of claim 2, wherein the subject has been diagnosed with cancer with bone metastasis or cancer-mediated bone destruction.
4. The method of claim 2, wherein the cancer is selected from the group consisting of lymphoma, lung cancer, pancreatic cancer, breast cancer, rectal cancer, colon cancer, stomach cancer, larynx cancer, liver cancer, brain cancer, and skin cancer.
5. The method of claim 1, wherein the osteolysis is caused by a condition selected from the group consisting of tumor, inflammation, and cyst.
6. The method of claim 5, wherein the condition comprises a bone tumor or a tumor located in bone.
7. The method of claim 1, wherein the subject is premenopausal.
8. The method of claim 1, wherein the subject is menopausal.
9. The method of claim 1, wherein the subject is postmenopausal.
10. The method of claim 1, wherein the RON inhibitor does not depend on the function of RANKL or TGF.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
DETAILED DESCRIPTION
(18) The present disclosure relates to the discovery that the RON ligand, macrophage-stimulating protein (MSP), is an important mediator of tumor-driven osteolysis. Macrophage-stimulating protein (MSP, also known as human MST1 or mouse (hepatocyte growth factor like) HGFL) is a plasminogen-related growth factor that was originally identified as a serum protein that caused macrophage chemotaxis and activation. MSP is secreted as an inactive single-chain precursor (pro-MSP), which becomes active after proteolytic cleavage, forming a disulfide-linked heterodimer. The first protease identified to activate pro-MSP under biological conditions was membrane-type serine protease 1 (MT-SP1, also known as ST14 or matriptase). However, there are other proteases capable of pro-MSP maturation such as hepsin, human airway trypsin-like protease (HAT), and hepatocyte growth factor activator (HGFA). MSP exerts several biological effects depending on the cell type in which its receptor, macrophage-stimulating-1 receptor (MST1R, or RON), becomes activated. MSP is the only known ligand for RON, and RON is one of only two members of a distinct receptor tyrosine kinase family that also includes Met. RON is expressed in many tissues during development; however, in adults its expression is restricted to certain epithelial-derived cells (such as keratinocytes), nociceptive neurons, resident tissue macrophages, and osteoclasts. MSP can promote migration and survival of epithelial cell lines and can promote an epithelial-to-mesenchymal transition in immortalized canine kidney cells in vitro.
(19) In addition to the effects the MSP/RON pathway has in a normal cellular context, the MSP/RON pathway may have a role in cancer. RON is expressed at high levels in many different epithelial cancers as well as malignancies of brain and bone. MSP and RON are coordinately overexpressed in over 20% of human breast cancers, and their overexpression along with matriptase has been shown to be an independent prognostic indicator for metastasis and poor survival. Overexpression of RON in breast epithelial cells leads to the transformation of cell lines and metastatic tumor development in mice. Overexpression of MSP in tumor cells driven by the polyomavirus middle T antigen under the control of the mouse mammary tumor virus promoter (MMTV-PyMT) led to spontaneous metastasis to bone and a significant increase in metastasis to other organs. MSP is sufficient to promote spontaneous metastasis to bone, yet spontaneous bone metastasis had been previously very difficult to achieve in genetically engineered mouse models. The bone metastases that developed in this model were osteolytic, replicating what is most commonly seen in human breast cancer patients. Interestingly, the overexpression of RON in mammary tumors did not lead to an increase in bone metastasis, suggesting a non-cell autonomous mechanism where tumor-host interactions may play a key role in MSP-driven bone metastasis.
(20) Despite evidence supporting an oncogenic and bone metastatic role in breast cancer, the role of the RON receptor tyrosine kinase pathway in the bone microenvironment during metastasis has remained unknown. As disclosed herein, the inventors discovered that the RON ligand, macrophage-stimulating protein (MSP), is an important mediator of tumor-driven osteolysis. MSP overexpression leads to a significant increase in the ability of tumor cells to destroy bone and this ability requires RON activity in host osteoclasts. MSP-driven osteoclast activation does not require RANKL or TGF signaling and, importantly, pharmacological inhibition of RON can prevent both the development of osteolysis and the progression of existing osteolysis. In addition, the MSP/RON pathway is pertinent to other cases of pathogenic osteoclast activation; this pathway also functions in bone loss due to osteoporosis. These findings elucidate an important role for the MSP/RON pathway in osteoclast activation, providing rationale for the use of RON inhibitors for treatment of bone destruction in the setting of metastatic cancer or osteoporosis.
1. DEFINITIONS
(21) The terms comprise(s), include(s), having, has, can, contain(s), and variants thereof, as used herein, are intended to be open-ended (i.e., meaning including but not limited to) transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures unless otherwise noted. The use of the terms a and an and the and similar referents in the context of describing the invention are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. The present disclosure also contemplates other embodiments comprising, consisting of and consisting essentially of, the embodiments or elements presented herein, whether explicitly set forth or not.
(22) For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
(23) The term about as used herein as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain aspects, the term about refers to a range of values that fall within 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
(24) Administration or administering refers to delivery of an inhibitor by any appropriate route to achieve the desired effect. Administration may include, but is not limited to, oral, sublingual, intramuscular, subcutaneous, intravenous, transdermal, topical, parenteral, buccal, rectal, and via injection, inhalation, and implants.
(25) As used herein cancer refers to abnormal cell growth. A cancer cell may have the potential to invade or spread to other parts of the body. Cancer may include a malignant tumor or malignant neoplasm. Cancer is a subset of neoplasms, wherein a neoplasm is a group of cells that have undergone unregulated growth, and will often form a mass or lump, but may be distributed diffusely. Metastasis or metastatic disease refers to the spread of a cancer or disease from one organ or part to another not directly connected with it. The new occurrences of cancer thus generated are referred to as metastases, a secondary tumor, or metastatic tumor. Cancer may include, for example, cancer of the skin, breast, prostate, lung, pancreas, colon, bone, bladder, rectum, stomach, esophagus, trachea, throat, head, neck, liver, kidney, brain, thyroid, heart, testicle, ovary, and cervix. Cancer may include carcinoma (derived from epithelial cells), sarcoma (derived from connective tissue), lymphoma (derived from hematopoietic cells), leukemia (derived from hematopoietic cells), blastoma (derived from immature precursor cells or embryonic tissue), or germ cell tumor (derived from pluripotent cells). In some embodiments, cancer includes bone cancer. In some embodiments, cancer includes a bone tumor or a tumor located in bone.
(26) As used herein, an effective amount or an amount sufficient to achieve a particular result in a subject refers to an amount of a therapeutic agent (e.g., a RON inhibitor) that is effective to produce a desired effect, which is optionally a therapeutic effect (i.e., by administration of a therapeutically effective amount). In some aspects, such particular result is a reduction in osteolysis in a patient in need thereof. In some aspects, such particular result is a reduction in osteoporosis in a patient in need thereof. The progression from normal cells to cells that can form a discernible mass to outright cancer involves multiple steps known as malignant progression.
(27) Inhibitor refers to an agent that inhibits the activity of one or more proteins. For example, an inhibitor may indirectly inhibit the activity of a protein by inhibiting the expression of the protein. An another example, an inhibitor may indirectly or directly bind and inhibit the activity of the protein, including catalytic activity or binding activity such as the ability of the protein to mediate binding to its target. An inhibitor is said to competitively inhibit binding of a protein if it preferentially binds to that protein to the extent that it blocks, to some degree, activity of the protein. Competitive inhibition can be determined by any method known in the art, for example, competition ELISA assays, competition binding assays, activity assays over a range of concentrations, or behavioral assays. An inhibitor can be said to inhibit a protein by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, at least 50%, at least 45%, at least 40%, at least 35%, at least 30%, at least 25%, or at least 20%.
(28) Selective inhibitor as used herein refers to an inhibitor whose activity on, for example, a protein, is greater relative to its activity on another protein under selected conditions. An inhibitor is said to be selective for a protein, for example, when it inhibits the activity of that protein more effectively than it would inhibit the activity of a random, unrelated protein, or even a similar or related protein having analogous but distinct function. The relative inhibition of a protein may be quantified by, for example, IC.sub.50, EC.sub.50, or K.sub.d values, among others. IC.sub.50 values may be determined, for example, using Invitrogen Omnia (Waltham, Mass.). The terms specific and selective may be used interchangeably herein.
(29) Physiological conditions refers to conditions of an assay or reaction that may occur in nature for that organism or cell system. Physiological conditions may include a temperature of between about 20-40 C. and a pH of between about 6-8. For example, physiological conditions may include an aqueous buffered solution at a pH of 7.2-7.6 and a temperature of about 37 C.
(30) Menopause or menopausal subject refers to a condition in a woman when her menstrual periods stop and she is no longer able to have children. Premenopause or premenopausal subject refers to the years leading up to the last period, when the levels of reproductive hormones are already becoming more variable and lower, and the effects of hormone withdrawal are present. Postmenopause or postmenopausal subject refers to a condition in a woman who has not experienced any menstrual flow for a minimum of 12 months, assuming that she does still have a uterus, and is not pregnant or lactating. In women without a uterus, menopause or postmenopause can be identified by a blood test showing a very high FSH level. Thus postmenopause is all of the time in a woman's life that takes place after her last period, or more accurately, all of the time that follows the point when her ovaries become inactive.
(31) Osteoporosis as used herein is a progressive bone disease that is characterized by a decrease in bone mass and density. Osteoporosis can lead to an increased risk of fracture. Osteoporosis includes primary type 1, primary type 2, and secondary osteoporosis. As used herein, treating osteoporosis includes preventing osteoporosis, reducing the progression of osteoporosis, inhibiting osteolysis, or inhibiting osteoclasts, or a combination thereof.
(32) Osteolysis refers to an active resorption of bone matrix by osteoclasts. Osteolysis can occur during the natural formation of healthy bones. Osteolysis often occurs in the proximity of a prosthesis and can cause an immunological response or changes in the bone's structural load. Osteolysis may be caused by a condition including, but not limited to, tumor, inflammation, hormone changes such as menopause, or cyst, or a combination thereof. In some embodiments, the tumor comprises metastatic cancer. In some embodiments, the tumor comprises a bone tumor and/or a tumor located in bone.
(33) Subject or patient as used herein can mean any subject, particularly a mammalian subject, that wants to or is in need of being treated with the herein described therapeutic composition. A subject can be an animal, a vertebrate animal, a mammal, a rodent (e.g. a guinea pig, a hamster, a rat, a mouse), murine (e.g. a mouse), canine (e.g. a dog), feline (e.g. a cat), equine (e.g. a horse), a primate, simian (e.g. a monkey or ape), a monkey (e.g. marmoset, baboon), an ape (e.g. gorilla, chimpanzee, orangutan, gibbon), or a human. In some embodiments, the subject is a mammal. In further embodiments, the mammal is a human. In further embodiments, the mammal is a female human. In some embodiments, the subject is diagnosed with cancer. In some embodiments, the subject is diagnosed with bone cancer. In some embodiments, the subject is diagnosed with osteoporosis.
(34) As used herein the terms treat, treatment, or treatment of in the context of treating a condition, pertains generally to treatment and therapy, whether of a human or an animal (e.g. in veterinary applications), in which a desired therapeutic effect is achieved. Treatment or treating means preventing, inhibiting the progress (e.g., reduce the rate of progress or halt the rate of progress), suppressing, repressing, ameliorating, or completely eliminating the disease. Preventing the disease involves administering a composition of the present invention to an animal prior to onset of the disease. Suppressing the disease involves administering a composition of the present invention to an animal after induction of the disease but before its clinical appearance. Repressing or ameliorating the disease involves administering a composition of the present invention to an animal after clinical appearance of the disease.
(35) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
2. RON
(36) Recepteur d'origine nantais (RON or Ron) belongs to a subfamily of receptor tyrosine kinases. RON is encoded by the MST1R gene. RON is also known as macrophage-stimulating protein receptor. RON is activated by a serum-derived growth factor macrophage stimulating protein (MSP). RON gene transcription is essential for embryonic development and critical in regulating certain physiological processes. Activation of RON leads to the activation of common receptor tyrosine kinase downstream-signaling pathways, such as activation of MAPK, PI3K, RAS-ERK, and beta-catenin. Furthermore, Ron participates in crosstalk with other signaling pathways such as Insulin-like growth factor 1 (IGF1R) and EGF receptor (EGFR) that are common tumorigenic mechanisms. In some embodiments, RON may comprise an amino acid sequence consisting of SEQ ID NO: 1, which is encoded by a polynucleotide sequence of SEQ ID NO: 2.
3. MET
(37) Met, also called c-Met and MET and hepatocyte growth factor receptor (HGFR), is a receptor tyrosine kinase. Met possesses tyrosine kinase activity and is a membrane receptor protein. The primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor. Hepatocyte growth factor (HGF) is the only known ligand of Met. Met is normally expressed by cells of epithelial origin, while HGF is expressed in cells of mesenchymal origin or in transformed cells such as tumors. Upon HGF stimulation, Met induces several biological responses that collectively give rise to a program known as invasive growth. Met is also important for embryonic development and wound healing. In some embodiments, Met may comprise an amino acid sequence consisting of SEQ ID NO: 3, which is encoded by a polynucleotide sequence of SEQ ID NO: 4.
4. RON INHIBITOR
(38) Provided herein are RON inhibitors and compositions comprising the same. RON inhibitors encompass agents that inhibit the activity of RON under physiological conditions. A RON inhibitor may also inhibit the activity of members of the RON pathway including, for example, MSP, MBD4, Src, and PI3K. The amount or the activity of the protein may be reduced or inhibited using a variety of techniques known in the art. For example, an inhibitor may indirectly or directly bind and inhibit the activity of the protein, including binding activity or catalytic activity. An inhibitor may inhibit the ability of the protein to interact with cellular and extracellular components. An inhibitor may prevent or reduce expression of the protein. For example, a therapeutic composition adapted to reduce the amount or the activity of the protein may comprise a small molecule inhibitor of the protein itself or of a binding partner, an antibody specific for the protein, or a siRNA. In some embodiments, the therapeutic composition may comprise a siRNA adapted to reduce the expression of the protein. RON inhibitors may include, but are not limited to, OSI-296 (Steinig et al. Bioorg. Med. Chem. 2013, 23, 4381-4387), ASLAN002 (also known as BMS-777607; Schroeder et al. J. Med. Chem. 2009, 52, 1251-1254), LCRF-0004, Ron8, golvatinib (Molife et al. Clin. Cancer Res. 2014, 20, 6284-6294), LY2801653 (Kawada et al. Cancer Res. 2014, 74, 844-895), PF-04254644 (Cui et al. J. Med. Chem. 2013, 56, 6651-6665), SU11274 (Gao et al. Med. Oncol. 2013, 30, 546), foretinib (GSK1363089; Shah et al. PLoS One 2013, 8, e54014), MK-8033 (Northrup et al. J. Med. Chem. 2013, 56, 2294-2310), 3,5-disubstituted and 3,5,7-trisubstituted quinolines (Wang et al. J. Med. Chem. 2011, 54, 2127-2142), Compound I (Zhang et al. Cancer Res. 2008, 68, 6680-6687), NPS-1034 (Rho et al. Cancer Res. 2014, 74, 253-262), crizotinib (Yasuda et al. J. Thorac. Oncol. 2012, 7, 1086-1090), and any other agents that inhibit the activity of or reduce the amount of RON.
(39) In some embodiments, the inhibitor is OSI-296, shown below:
(40) ##STR00001##
(41) In some embodiments, the inhibitor is ASLAN002, shown below:
(42) ##STR00002##
(43) In some embodiments, the inhibitor may act independently of the RANKL and/or TGF pathways. The inhibitor may not affect the function of RANKL and/or TGF. The inhibitor may not depend on the function of RANKL and/or TGF.
(44) a. RON-Selective Inhibitor
(45) The RON inhibitor may be selective or specific for RON. As used herein, a RON-selective inhibitor inhibits the activity of RON greater than it inhibits the activity of another protein, such as, for example, another receptor tyrosine kinase, under physiological conditions. Receptor tyrosine kinases other than RON include, for example, Met and Axl. For example, a RON-selective inhibitor may inhibit RON greater than it inhibits Met under physiological conditions. For example, a RON-selective inhibitor may inhibit RON greater than it inhibits Axl under physiological conditions.
(46) In some embodiments, a RON-selective inhibitor may inhibit the activity of RON at least about 2 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 10 times, at least about 15 times, at least about 20 times, at least about 25 times, at least about 50 times, or at least about 100 times more than it inhibits the activity of another receptor tyrosine kinase, such as Met. In some embodiments, a RON-selective inhibitor may have an IC.sub.50 for another receptor tyrosine kinase that is at least about 2 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 10 times, at least about 15 times, at least about 20 times, at least about 25 times, at least about 50 times, or at least about 100 times greater than the IC.sub.50 for RON. In some embodiments, the RON-selective inhibitor comprises ASLAN002.
5. METHODS OF USING THE RON INHIBITORS
(47) RON inhibitors may be used to inhibit osteolysis or treat osteoporosis. The method includes administering to the subject at least one RON inhibitor. In some embodiments, the inhibitor is a RON-selective inhibitor.
(48) A RON inhibitor may be administered to a subject by any convenient route of administration, whether systemically/peripherally or at the site of desired action, including but not limited to, oral (e.g. by ingestion); topical (including e.g. transdermal, intranasal, ocular, buccal, and sublingual); pulmonary (e.g. by inhalation or insufflation therapy using, e.g. an aerosol, e.g. through mouth or nose); rectal; vaginal; parenteral, for example, by injection, including subcutaneous, intradermal, intramuscular, intravenous, intraarterial, intracardiac, intrathecal, intraspinal, intracapsular, subcapsular, intraorbital, intraperitoneal, intratracheal, subcuticular, intraarticular, subarachnoid, and intrasternal; by implant of a depot, for example, subcutaneously or intramuscularly.
(49) a. Methods for Inhibiting Osteolysis
(50) Provided herein are methods for inhibiting osteolysis in a subject in need thereof. The method includes administering to the subject at least one RON inhibitor. In some embodiments, the inhibitor is a RON-selective inhibitor. Inhibiting osteolysis may include reducing bone turnover, reducing the progression of bone loss, inhibiting osteoclasts, or a combination thereof. In some embodiments, the subject has been diagnosed with a condition selected from inflammation, cyst, cancer, cancer with bone metastasis, and cancer-mediated bone destruction.
(51) b. Methods for Treating Osteoporosis
(52) Provided herein are methods for treating osteoporosis in a subject in need thereof. Treating osteoporosis may include preventing osteoporosis, reducing the progression of osteoporosis, or a combination thereof. The method includes administering to the subject at least one RON inhibitor. In some embodiments, the inhibitor is a RON-selective inhibitor.
(53) All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to illustrate aspects and embodiments of the disclosure and does not limit the scope of the claims.
6. EXAMPLES
Example 1
Experimental Procedures
(54) Tumor Injections and X-Ray Analysis.
(55) All procedures involving mice and experimental protocols were approved by the Institutional Animal Care and Use Committee (IACUC) of the University of Utah. The RonTK/ mice which reside on the FVB background, were crossed with NOD.SCID mice for an immune-compromised mouse model. As a control, wild-type FVB mice were also crossed with NOD.SCID mice. The STK/ mice, which are on a C57BL/6 background, were compared to wild-type C57BL/6 mice as controls. Mice for all experiments were 6 to 8 weeks of age. For intratibial injections, 110.sup.5 (PyMTor DU4475) or 310.sup.5 (MDA-MB-231) tumor cells were resuspended in 10 L matrigel and injected into the right tibia of anesthetized female FVB (PyMT) or NOD.SCID mice carrying various alleles of RON. Osteolysis was assessed by X-ray radiography. Dissected hindlimbs from mice sacrificed at the final time point in each experiment were placed in the Kodak In-vivo Multispectral Imaging System FX and exposed to X-ray radiography at 35 kV for 100 sec. Excess tumor tissue was removed from the bones prior to X-ray. Osteolytic lesions were quantified using Image J software (NCBI). All images were compared to the contralateral leg as an internal control.
(56) Micro-Computed Tomography Imaging and Bone Mineral Density Measurements.
(57) Representative samples were imaged by micro-computed tomography (CT, Skyscan) with volume rendering snapshots of the tibia. For the osteoporosis study, representative samples were imaged and presented as volume rendering snapshots of the axial view of the tibial metaphysis region. For bone mineral density (BMD) measurements, the right tibia was removed and fixed in 10% NBF overnight. The tibia were then scanned by dual-energy X-ray absorptiometry (DXA) using a Norland pDEXA densitometer (Norland Medical Systems, White Plains, N.Y.). A region including the primary and secondary spongiosa was used to determine the BMD of the tibia.
(58) Tissue Processing and Immunohistochemical Staining.
(59) Hindlimb bones were excised from mice at the time of sacrifice and bones were fixed in 10% neutral-buffered formalin, decalcified in Formical-2000 (Decal Corporation, Tallman, N.Y.) for 8 days and embedded in paraffin for hematoxylin and eosin (H & E) or immunohistochemical staining. Osteoclast number was assessed as TRAP.sup.+ multinucleated cells containing 4 or more nuclei and reported as TRAP.sup.+ cells per field. Three sections per mouse and 5 fields per section were used for quantification with fields representing the entire length of the tibia. Tumor proliferation rate was reported as the number of cells which were positive for phospho-H3 staining compared to the number of unstained cells per field expressed as a percent. Three sections per mouse and 5 fields per section were used for quantification with analysis being restricted to within the bone marrow cavity. Immunohistochemical analysis was performed with heat-induced antigen retrieval in sodium-citrate buffer (Dako, Denmark). Primary antibodies used were anti-TRAP at 1:50 (Santa Cruz, sc-30833, Dallas, Tex.), anti-Ki67 at 1:100 (Santa Cruz, sc-12202S, Dallas, Tex.), anti-phosphoH3 at 1:100 (Cell Signaling, #9701, Beverly, Mass.), anti-NFATc1 at 1:50 (Santa Cruz, sc-13033, Dallas, Tex.), and anti-RON at 1:250 (Santa Cruz, sc-322, Dallas, Tex.). Bones from mice lacking RON were used as a negative control. Biotinylated secondary antibody was used with the EnVision.sup.+ system HRP kit (Dako, Denmark) and nuclei counterstained with hematoxylin.
(60) Recombinant MSP Production and Purification.
(61) Briefly, human MSP was expressed in 293T cells following transduction with pMSCV-hMSP-Thrombin-His-V5 lentivirus, which also contained a hygromycin selection cassette. Secreted MSP was collected from serum-free supernatants, concentrated, and activated by incubation with kallikrein (Sigma, St. Louis, Mo.; K2638). The activated MSP was purified over a His-Talon column (Clontech, Mountain View, Calif.; 635651), washed, and concentrated using Amicon Ultra-15 Centrifugal Filter Devices. MSP protein concentration was quantified using a human MSP DuoSet ELISA kit (R&D Systems; DY352) on a custom MULTI-ARRAY MSD 96-well microplate platform (MesoScale Discovery, Rockville, Md.; L15XA-3) and read with the SECTOR Imager 2400. MSP specific activity was confirmed by quantifying the ability of MSP to cause phosphorylation of Ron expressed in MCF10A cells.
(62) Plasmids and Retroviral Transduction of Osteoclast Precursors.
(63) Wild-type Src was subcloned out of the pM5McSrc vector (Addgene plasmid 17685) by PCR and inserted into the pMSCV-puro vector (Clontech, Mountain View, Calif.) using the BgIII 5 and EcoRI 3 restriction sites. The constitutively active Src mutant (Y529F) and the kinase dead Src mutant (Y529F+K297M) were generated using standard PCR techniques. A total of 5 ug of the pMSCV retroviral vectors were transfected into the 293T cell line using X-tremeGENE 9 transfection reagent (Roche Applied Science, Indianapolis, Ind.). Virus was collected 48 hours after post transfection. Ron TK/ bone marrow precursor cells were infected with virus for 24 hours in the presence of 100 ng/mL M-CSF and 4 ug/mL Polybrene (Sigma, St. Louis, Mo.). Cells were selected in the presence of M-CSF and 1 ug/mL puromycin for 3 days prior to use as osteoclast precursors.
(64) Osteoclast Resorption Assay.
(65) Bone marrow osteoclasts were generated from 6 to 8 week old WT and RonTK/ mice. Briefly, bone marrow was isolated from hindlimb bones and plated in -MEM media containing 10% heat-inactivated fetal bovine serum (FBS, Sigma, St. Louis, Mo.), 100 units/mL penicillin-streptomycin (Hyclone), and 33 ng/mL human macrophage colony-stimulating factor (hM-CSF) (PeproTech, Rocky Hill, N.J.) for 24 hours. Non-adherent cells were collected and frozen for later use. To assess resorption activity, bone marrow precursor cells were thawed and seeded at a density of 110.sup.5 cells per well in BioCoat Osteologic slides (BD Biosciences, San Jose, Calif.) in -MEM media containing 10% FBS and antibiotics. After adhering overnight, media was removed and media containing 33 ng/mL hM-CSF and 9 ng/mL muRANKL (R & D systems, Minneapolis, Minn.) was added. The medium was changed every 3 days depending on acidification, and the assay was terminated as indicated. Recombinant human MSP was prepared and added daily as indicated. Cells were removed with 6% bleach and slides were viewed microscopically using phase-contrast with 20 magnification. Osteolytic resorption area within 5 representative fields was determined using Image J software, experiments were performed in triplicate. Recombinant MSP was prepared as follows (to be described in detail elsewhere): Concentrated, serum-free media from an MCF7 cell line engineered to overexpress MSP was cleaved with kallikrein (Invitrogen, Waltham, Mass.; 4 ng of kallikrein/1 g of supernatant protein at 37 C. for 2.5 hours). The reaction was diluted to 20 mL with 10 mM sodium phosphate, pH 7.4 and loaded onto a 5 mL HiTrap heparin column (Millipore, Billerica, Mass.) equilibrated with 20 mL of 10 mM sodium phosphate, pH 7.4, at a rate of 1 mL/min. The column was washed with 10 mL of 10 mM sodium phosphate, pH 7.4, at a rate of 1 mL/min. The bound protein was eluted with 7 mL of serial concentrations of NaCl in 10 mM sodium phosphate, pH 7.4: 0.1 M, 0.15 M, 0.2 M, 0.25 M, 0.3 M, 0.35 M, 0.4 M, 0.45 M, and 2 M. Each fraction was collected and concentrated/desalted on a spin column. Each fraction was run for MSP western analysis and ELISA analysis to determine purity and concentration.
(66) Osteoclast Survival Assay.
(67) Bone marrow precursor cells were thawed and seeded at a density of 210.sup.5 cells per well in a 24-well plate containing glass coverslips in -MEM media containing 10% FBS and antibiotics. After adhering overnight, media was removed and media containing 33 ng/mL hM-CSF and 9 ng/mL muRANKL was added. Cells were allowed to differentiate for 7 days with media changed every 3 days. Coverslips were then imaged microscopically using phase contrast to determine osteoclast number in each well. To test survival, factor-containing media was removed and -MEM media containing 10% FBS was added as well as MSP as indicated. Cells were cultured for an additional 48 hours, fixed with 10% NBF for 10 minutes and washed with 1PBS. For TRAP fluorescent staining, the leukocyte acid phosphatase kit (Sigma, St. Louis, Mo.) was used according to the manufacturer's instructions, with the substitution of 200 M ELF97 (Invitrogen, Waltham, Mass.) as a phosphatase substrate. Coverslips were incubated in TRAP solution for 15 minutes at 37 degrees, washed with 1PBS and counterstained with DAPI. The number of multinucleated TRAP+ cells (containing 4 or more nuclei) within 5 representative fields were included for quantification. Experiments were performed in triplicate.
(68) Murine RANKL ELISA.
(69) Quantitative levels of murine RANKL in serum isolated from mice at the end-point of experiments were determined in triplicate by ELISA according to the manufacturer's protocol (Quantikine immunoassay kit, R & D systems, Minneapolis, Minn.).
(70) Pharmacological Inhibition In Vitro and In Vivo.
(71) For in vitro experiments, OSI-296 (OSI pharmaceuticals, Melville, N.Y.) and ASLAN002 (BMS-777607; Selleck, Houston, Tex.) were dissolved in DMSO. Inhibitors were added to in vitro osteoclast assays at a final concentration of 10 M daily for 3 days beginning on day 9 of the experiment. muRANK-Fc (Amgen, Thousand Oaks, Calif.) was provided as a stock of 4.1 mg/mL in PBS and was added to in vitro assays at a final concentration of 10 g/mL daily as indicated.
(72) For in vivo experiments, the OSI-296 inhibitor was dissolved in 40% Trappsol with 0.01 M HCl, and mice were treated at a concentration of 200 mg/kg daily by oral gavage. Treatment began either 3 days after tumor cell injection for prophylactic experiments, or 3 weeks after tumor cell injection for therapeutic experiments. ASLAN002 was dissolved in 70% PEG400 with 1PBS and mice were treated at a concentration of 50 mg/kg daily by oral gavage. muRANK-Fc was given at a concentration of 10 mg/kg every three days by intra-peritoneal injection. For the osteoporosis study, mice were treated beginning on the day after ovary removal. The treatment regimen for OSI-296 was 200 mg/kg every other day by oral gavage. ASLAN002 was administered at 50 mg/kg every other day by oral gavage. Treatment continued until the time of sacrifice at 28 days.
(73) Cell Culture.
(74) The DU4475 cell line (ATCC) was maintained in RPMI (Hyclone, GE Healthcare, Little Chalfont, UK) with 10% FBS and antibiotics. The MDA-MB-231 cell line (ATCC) was maintained in RPMI with 10% FBS, antibiotics, and HEPES (Sigma, St. Louis, Mo.). MC3T3-E1 subclone 4 cells (ATCC) were maintained in -MEM with 10% FBS and antibiotics. PyMT tumors were isolated and transduced as previously described and frozen for later use (Welm, et al. Proc. Natl. Acad. Sci. USA 2005, 102, 4324-9; Welm, et al. Proc. Natl. Acad. Sci. USA 2007, 104, 7570-7575). Cells were thawed and grown for 2 to 3 days in DMEM/F12 with 10% FBS, antibiotics, insulin (Gibco, Life Technologies, Thermo Fisher, Waltham, Mass.), hydrocortisone, and epidermal growth factor prior to injections. MDA-MB-231 cells were transduced with replication-defective retroviruses containing the expression vector pMSCVpuro or MSCVpuro-MSP, and infected cells were selected with puromycin.
(75) Western Blot Analyses.
(76) Cells were serum starved (0.5% FBS) for 3 hours prior to lysate collection. Inhibitors were added 1 hour prior to lysis and MSP was added 15 min prior to lysis when indicated. Cells were washed with 1PBS and harvested in lysis buffer (25 mM Tris-HCl, pH 7.5, 0.42 M NaCl, 1.5 mM MgCl.sub.2, 0.5 mM EDTA, 1 mM DTT, 25% sucrose, and 0.1% Triton X-100) plus 100 protease arrest (Bioscience, Bozeman, Mont.) and 100 orthovanadate. Primary antibodies used for immunoblotting include: anti-MSP (Santa Cruz, sc-6090, Dallas, Tex.) at a 1:250 dilution, anti-pan Akt (Cell Signaling, #4691S, Beverly, Mass.) at a 1:1000 dilution, anti-pan Erk (Cell Signaling, #4695, Beverly, Mass.) at a 1:1000 dilution, anti-phospho Akt (Cell Signaling, #9271 L, Beverly, Mass.) at a 1:500 dilution, anti-phospho Erk (Cell Signaling, #4370S, Beverly, Mass.) at a 1:500 dilution, anti-Src (Cell Signaling, #2110, Beverly, Mass.) at a 1:500 dilution, and anti-phospho Src (Y416) (Cell Signaling, #2113, Beverly, Mass.) at a 1:500 dilution. The secondary antibodies used were HRP-conjugated anti-goat IgG (Santa Cruz, Dallas, Tex.) and anti-rabbit IgG (Santa Cruz, Dallas, Tex.). Chemiluminescent signals were detected using Immun-Star HRP (BioRad, Hercules, Calif.).
(77) In Vivo Bone Labeling and Histomophometry.
(78) To label bones, mice were intraperitoneally injected with 20 mg/kg of calcein (Sigma-Aldrich, St. Louis, Mo.) or 30 mg/kg of Alizarin Complexone (Sigma-Aldrich, St. Louis, Mo.) in a 2% sodium bicarbonate solution. Mice 6 to 8 months of age were labeled 8 days and 2 days prior to euthanasia, respectively. Tibia were fixed in 70% ethanol, embedded in methylmethacrylate and sectioned. Bone histomorphometry on H and E sections and bone labeled sections were performed as previously described (Parfitt, et al. Report of the ASBMR Histomorphometry Nomenclature Committee. J. Bone Miner. Res. 1987, 2, 595-610). Analysis of bone volume (BV/TV), and trabecular spacing (Tb. Sp.) were performed on the metaphyseal region of tibia sections stained with H and E. Bone formation rate (BFR) per bone surface (BS) and mineral apposition rate (MAR) of trabeculae were calculated within the metaphyseal region of the tibia. For all histomorphometry, three sections per mouse with 4 to 5 mice per group were analyzed. Analysis was performed using Bioquant Osteo software (Bioquant Image Analysis Corporation, Nashville, Tenn.).
(79) Assessment of Human Plasma CTX and BSAP Levels.
(80) All samples were de-identified and the experiments were approved by the University of Utah Institutional Review Board. Plasma samples were submitted to ARUP for clinical testing of CTX. For BSAP, the Human Bone Panel I capture plate with the Human Alkaline Phosphatase detection kit was utilized (Meso Scale Discovery, Rockville, Md.; K151HEC-2) to measure BSAP levels in undiluted plasma samples per the manufacturer's protocol.
(81) Statistical Analysis.
(82) Data are shown as mean+/ SEM. All experiments were analyzed using 2-tailed, unpaired, Student's t test using Prism 6 (GraphPad Software, La Jolla, Calif.).
Example 2
RON Expression in the Host is Required for MSP-Driven Breast Cancer Osteolysis
(83) MSP drives spontaneous osteolytic bone metastasis. To investigate whether MSP-mediated bone metastasis depends on non cell-autonomous activation of RON, PyMT or PyMT-MSP tumor cells were injected into the tibias of wild-type (WT) mice or mice in which the tyrosine kinase domain of RON had been deleted from the genome (RonTK/) (Waltz et al. J. Clin. Invest. 2001, 108, 567-76). Expression of MSP in the tumor cells significantly increased the ability of these tumors to induce osteolysis in WT bones (
(84) To determine if MSP-driven osteolysis was due to an increase in the number of osteoclasts present within the microenvironment, bone sections were stained for the osteoclast-specific protein tartrate resistant acid phosphatase (TRAP), and the number of TRAP-positive (TRAP+) multinuclear cells was quantified. No significant difference in the number of TRAP+ osteoclasts was detected when comparing bones harboring control tumors versus MSP expressing tumors (
(85) To determine if protection from osteolysis in the RonTK/ mice was due to an increase in bone formation due to elevated osteoblast activity, WT and RonTK/ bones were labeled in vivo and histomorphometric bone parameters were analyzed. There were no significant differences in the mineral apposition rate (MAR) or the bone formation rate (BFR), indicating that there was no inherent difference in osteoblast activity between WT and RonTK/ mice (
Example 3
Host RON Activity Drives Osteolysis from Metastatic Human Breast Cancer
(86) To ensure that the findings were not restricted to the effects of mouse tumors or tumors engineered to overexpress MSP, the expression levels of MSP, RON, and matriptase in a panel of human breast cancer cell lines was examined and a cell line (DU4475) chosen that expressed each of these genes above an average expression level, similar to patient tumor samples (
Example 4
T Cells are Dispensable for MSP-Induced Osteolysis
(87) Because the above xenograft experiments had to be performed in immune-compromised mice, and because T cells have previously been shown to influence osteoclast activity, it was destired to ensure that the lack of tumor-induced osteolysis from human DU4475 cells in NOD.SCID/RonTK/ mice was not due to a combination effect of RON TK deletion and the compromised immune system. To test whether T cells were required for MSP/RON-dependent osteolysis, the effects of injecting PyMT-MSP tumor cells into the tibias of syngenic immune-competent (FVB/RonTK+/+ or FVB/RonTK/), or immune-compromised (NOD.SCID/RonTK+/+ or NOD.SCID/RonTK/) mice were compared. MSP-mediated osteolysis was not significantly altered in the immune-compromised mice and still demonstrated the necessity for RON activity in the host (
Example 5
Treatment with RON Inhibitors Blocks Osteolysis
(88) Based on the data obtained using RonTK/ mice, it was tested whether pharmacological inhibition of RON could provide protection from osteolysis. Tibias were injected with MSP-expressing PyMT tumor cells or DU4475 breast cancer cells and treated them with two different small molecule tyrosine kinase inhibitors that are selective for RON and Met (OSI-296 and ASLAN002). OSI-296 is more selective for Met (IC.sub.50 of 42 nM for Met and 200 nM for RON; Steinig et al. Bioorg. Med. Chem. 2013, 23, 4381-4387), while ASLAN002 (also known as BMS-777607) is more selective for RON (IC.sub.50 of 3.9 nM for Met and 1.8 nM for RON; Schroeder et al. J. Med. Chem. 2009, 52, 1251-1254). When animals were treated with either drug, beginning three days after tumor injection, osteolysis from PyMT-MSP tumors was significantly inhibited, phenocopying the results obtained with RonTK/ mice. OSI-296 caused an average 4-6 fold inhibition of osteolysis, and ASLAN002 caused 6-10 fold inhibition of osteolysis (
Example 6
MSP/RON Signaling is a Novel Mechanism of Osteolysis that is not Dependent on RANKL or TGF Signaling
(89) Both RANKL and TGF have been shown to play major roles in osteoclast activation and the vicious cycle. Denosumab, a RANKL antagonist, was recently FDA-approved to treat bone metastases and osteoporosis based on demonstration of increased time to development of skeletal-related events, such as fracture, in patients. Mechanistically, we wanted to determine if MSP/RON functionally interacts with RANKL and/or TGF pathways. To test whether MSP-driven osteolysis is dependent on activation of RANK by RANKL, mice were treated with the murine RANKL antagonist, muRANK-Fc, three days after intratibial injection of tumor cells. Destruction of bone in PyMT control tumors was significantly impaired upon treatment with the RANKL antagonist (
(90) The TGF pathway has also been shown to be an integral part of the vicious cycle. TGF is released from the bone matrix by osteoclasts and binds to its receptor on tumor cells, stimulating production of pro-osteoclastogenic cytokines. RANKL-independent mechanisms of osteolysis involving TGF may exist; therefore, it is possible that MSP/RON functionally interacts with the TGF pathway to induce osteoclast activation. To test this possibility, PyMT tumor cells were used in which the TGF type-II receptor (TGFRII) had been deleted using a Cre-lox system (Forrester et al. Cancer Res. 15 2005, 65, 2296-302). MSP was then overexpressed and these cells were injected into WT mice. While the absence of TGF signaling did not affect tumor growth, it did affect the ability of control tumors to induce basal levels of osteolysis (
(91) To further test the hypothesis that MSP/RON is sufficient to stimulate osteolysis in a manner that does not rely on the RANKL pathway, another human breast cancer model (MDA-MB-231) was used, which has been shown to be highly dependent on RANKL for osteolysis. Concordant with this, MDA-MB-231 cells did not express MSP at detectable levels (
Example 7
MSP/RON Signaling Promotes Bone Degradation by Stimulating RANK-Independent Osteoclast Survival, c-Src Phosphorylation, and Osteolytic Activity
(92) To determine the cellular mechanism by which RON signaling functions in specific steps during osteoclastogenesis and osteoclast activation, the effect of MSP on osteoclasts was analyzed in vitro. Differentiated osteoclasts were stimulated with recombinant MSP, and their ability to resorb an artificial bone matrix was analyzed. Addition of MSP to WT osteoclasts led to a significant increase in the resorptive capacity of these cells, while having no effect on RonTK/ osteoclasts (
(93) As expected from the observations in vivo, MSP stimulation did not increase osteoclast differentiation, and even demonstrated an inhibitory effect when added at early time points relative to the onset of differentiation (
(94) Because RANK signaling is thought to be required for osteoclast survival, it was questioned whether MSP could affect the survival of existing osteoclasts in the absence of RANKL. To determine this, osteoclasts were fully differentiated in the presence of M-CSF and RANKL. These factors were then removed from the culture and MSP was added, see schematic in
(95) MSP promoted osteoclast survival (
(96) c-Src is critical in the regulation of osteoclast survival, motility, cytoskeletal reorganization, and resorption ability. To determine whether MSP/RON signaling stimulates c-Src activity independently of RANK, c-src phosphorylation was tested in the presence or absence of RANKL signaling. Addition of the RANKL antagonist to WT osteoclasts resulted in a decrease in phosphorylated c-Src. Addition of MSP to WT osteoclasts increased Src phosphorylation, which was blocked by ASLAN002, but not muRANK-Fc (
(97) ASLAN002 treatment also reduced downstream Src signaling, as demonstrated by the decrease in phosphorylated AKT, while having no effect on ERK activity. To determine whether Src activation could rescue the poor resorptive activity of RonTK/ osteoclasts, RonTK/ osteoclast precursors were transduced with WT Src, constitutively-active Src, or kinase-dead Src mutants. Expression of WT Src led to a slight but statistically significant increase in the resorptive ability of RonTK/ osteoclasts, while constitutively active Src fully rescued resorption, and the kinase-dead Src mutant had no effect (
Example 8
RON Expression in the Host is Required for Ovariectomy-Induced Bone Loss
(98) Pathways involved in tumor-driven osteolysis are also often implicated in other pathologies leading to bone destruction. To investigate the role of the MSP/RON pathway in bone loss due to post-menopausal osteoporosis, ovariectomies were performed in WT and RonTK/ mice and bone loss was analyzed by dual-energy X-ray absorptiometry (DXA) and bone histomorphometry 28 days later. The ovarectomized RonTK/ mice were more resistant to loss of bone mineral density (BMD), bone volume, and trabecular thickness, with a concomitant decrease in trabecular spacing as compared to WT mice or sham-operated controls (
(99) In fact, loss of RON resulted in complete protection from osteoporosis, as RonTK/ bones were not statistically different than sham-operated controls. There also was no difference in the bone histomorphometric parameters between sham-operated mice of either genotype, demonstrating that there are no basal differences in bone density in the RonTK/ mice under normal physiologic conditions. Importantly, treatment with ASLAN002 after ovary removal also completely prevented bone loss (
Example 9
ASLAN002 Reduces Bone Turnover in Postmenopausal Women
(100) ASLAN002 is currently in Phase I testing as an anti-cancer agent (NCT01721148). Regardless of cancer diagnosis, and even in the absence of bone metastasis, RON inhibition might affect normal bone turnover, especially in postmenopausal women due to their high rate of bone loss. Plasma samples from early cohorts of Phase I patients were examined for evidence of bone turnover at baseline and after treatment with ASLAN002, using a standard clinical test to detect cleaved bone-derived collagen in plasma (beta-cross-linked C-telopeptide, or CTX). These data showed that 11/18 (61%) of patients exhibited decreased CTX levels with ASLAN002 treatment, and 64% of those had a sufficient drop in CTX levels (25% reduction) to meet the Mayo clinic guidelines for response to bone anti-resorptive therapies (
(101) The foregoing description of the specific aspects will so fully reveal the general nature of the invention that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific aspects, without undue experimentation, without departing from the general concept of the present disclosure. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed aspects, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.
(102) The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary aspects, but should be defined only in accordance with the following claims and their equivalents.
(103) All publications, patents, patent applications, and/or other documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, and/or other document were individually indicated to be incorporated by reference for all purposes.
(104) For reasons of completeness, various aspects of the invention are set out in the following numbered clauses:
(105) Clause 1. A method for inhibiting osteolysis or treating osteoporosis in a subject in need thereof, the method comprising administering to the subject an effective amount of at least one RON inhibitor.
(106) Clause 2. The method of clause 1, wherein the subject has been diagnosed with a condition selected from the group consisting of inflammation, cyst, and cancer.
(107) Clause 3. The method of any one of the above clauses, wherein the subject has been diagnosed with cancer with bone metastasis or cancer-mediated bone destruction.
(108) Clause 4. The method of any one of clauses 2-3, wherein the cancer is selected from the group consisting of lymphoma, lung cancer, pancreatic cancer, breast cancer, rectal cancer, colon cancer, stomach cancer, larynx cancer, liver cancer, brain cancer, and skin cancer.
(109) Clause 5. The method of clause 1, wherein the osteolysis is caused by a condition selected from the group consisting of tumor, inflammation, and cyst.
(110) Clause 6. The method of clause 5, wherein the condition comprises a bone tumor or a tumor located in bone.
(111) Clause 7. The method of clause 1, wherein the subject is premenopausal.
(112) Clause 8. The method of clause 1, wherein the subject is menopausal.
(113) Clause 9. The method of clause 1, wherein the subject is postmenopausal.
(114) Clause 10. The method of any one of clauses 1-9, wherein the RON inhibitor is OSI-296.
(115) Clause 11. The method of any one of clauses 1-9, wherein the RON inhibitor is a RON-selective inhibitor.
(116) Clause 12. The method of clause 11, wherein the RON-selective inhibitor is ASLAN002.
(117) Clause 13. The method of any one of clauses 1-12, wherein the RON inhibitor does not depend on the function of RANKL or TGF.
(118) TABLE-US-00001 SEQUENCES SEQIDNO:1 RONpolypeptide,homosapiens,1351aminoacids,accessionno.NP_001231866. MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEVCVDGECHILGRVVRPG PDGVPQSTLLGILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLP ILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAE VKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFL REGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFG LQVARGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARL PVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQP EYCPDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSH EMNVRPEQPQFSPMPGNVRRPRPLSEPPRPT SEQIDNO:2 RONpolynucleotide,homosapiens,4638bp,accessionno.NM_001244937. agtgtacagcggcggctggggcggcaggtgaggcggctggggcgttgctgtcgtgcgtcc gcaggcgtcaggtgctcagacccgagggccgggaagggatttgggtttcacaggaacctg gggcgggggtccgctatcttggggctgtcgggaccgctgcttaaatttggcccagtccag acctcgagtcgggcccccagccaggcccacgcccaggtccaggcccaggccggtagggat cctctagggtcccagctcgcctcgatggagctcctcccgccgctgcctcagtccttcctg ttgctgctgctgttgcctgccaagcccgcggcgggcgaggactggcagtgcccgcgcacc ccctacgcggcctctcgcgactttgacgtgaagtacgtggtgcccagcttctccgccgga ggcctggtacaggccatggtgacctacgagggcgacagaaatgagagtgctgtgtttgta gccatacgcaatcgcctgcatgtgcttgggcctgacctgaagtctgtccagagcctggcc acgggccctgctggagaccctggctgccagacgtgtgcagcctgtggcccaggaccccac ggccctcccggtgacacagacacaaaggtgctggtgctggatcccgcgctgcctgcgctg gtcagttgtggctccagcctgcagggccgctgcttcctgcatgacctagagccccaaggg acagccgtgcatctggcagcgccagcctgcctcttctcagcccaccataaccggcccgat gactgccccgactgtgtggccagcccattgggcacccgtgtaactgtggttgagcaaggc caggcctcctatttctacgtggcatcctcactggacgcagccgtggctgccagcttcagc ccacgctcagtgtctatcaggcgtctcaaggctgacgcctcgggattcgcaccgggcttt gtggcgttgtcagtgctgcccaagcatcttgtctcctacagtattgaatacgtgcacagc ttccacacgggagccttcgtatacttcctgactgtacagccggccagcgtgacagatgat cctagtgccctgcacacacgcctggcacggcttagcgccactgagccagagttgggtgac tatcgggagctggtcctcgactgcagatttgctccaaaacgcaggcgccggggggcccca gaaggcggacagccctaccctgtgctgcgggtggcccactccgctccagtgggtgcccaa cttgccactgagctgagcatcgccgagggccaggaagtactatttggggtctttgtgact ggcaaggatggtggtcctggcgtgggccccaactctgtcgtctgtgccttccccattgac ctgctggacacactaattgatgagggtgtggagcgctgttgtgaatccccagtccatcca ggcctccggcgaggcctcgacttcttccagtcgcccagtttttgccccaacccgcctggc ctggaagccctcagccccaacaccagctgccgccacttccctctgctggtcagtagcagc ttctcacgtgtggacctattcaatgggctgttgggaccagtacaggtcactgcattgtat gtgacacgccttgacaacgtcacagtggcacacatgggcacaatggatgggcgtatcctg caggtggagctggtcaggtcactaaactacttgctgtatgtgtccaacttctcactgggt gacagtgggcagcccgtgcagcgggatgtcagtcgtcttggggaccacctactctttgcc tctggggaccaggttttccaggtacctatccaaggccctggctgccgccacttcctgacc tgtgggcgttgcctaagggcatggcatttcatgggctgtggctggtgtgggaacatgtgc ggccagcagaaggagtgtcctggctcctggcaacaggaccactgcccacctaagcttact gagttccacccccacagtggacctctaaggggcagtacaaggctgaccctgtgtggctcc aacttctaccttcacccttctggtctggtgcctgagggaacccatcaggtcactgtgggc caaagtccctgccggccactgcccaaggacagctcaaaactcagaccagtgccccggaaa gactttgtagaggagtttgagtgtgaactggagcccttgggcacccaggcagtggggcct accaacgtcagcctcaccgtgactaacatgccaccgggcaagcacttccgggtagacggc acctccgtgctgagaggcttctctttcatggagccagtgctgatagcagtgcaacccctc tttggcccacgggcaggaggcacctgtctcactcttgaaggccagagtctgtctgtaggc accagccgggctgtgctggtcaatgggactgagtgtctgctagcacgggtcagtgagggg cagcttttatgtgccacaccccctggggccacggtggccagtgtcccccttagcctgcag gtggggggtgcccaggtacctggttcctggaccttccagtacagagaagaccctgtcgtg ctaagcatcagccccaactgtggctacatcaactcccacatcaccatctgtggccagcat ctaacttcagcatggcacttagtgctgtcattccatgacgggcttagggcagtggaaagc aggtgtgagaggcagcttccagagcagcagctgtgccgccttcctgaatatgtggtccga gacccccagggatgggtggcagggaatctgagtgcccgaggggatggagctgctggcttt acactgcctggctttcgcttcctacccccaccccatccacccagtgccaacctagttcca ctgaagcctgaggagcatgccattaagtttgaggtctgcgtagatggtgaatgtcatatc ctgggtagagtggtgcggccagggccagatggggtcccacagagcacgctccttggtatc ctgctgcctttgctgctgcttgtggctgcactggcgactgcactggtcttcagctactgg tggcggaggaagcagctagttcttcctcccaacctgaatgacctggcatccctggaccag actgctggagccacacccctgcctattctgtactcgggctctgactacagaagtggcctt gcactccctgccattgatggtctggattccaccacttgtgtccatggagcatccttctcc gatagtgaagatgaatcctgtgtgccactgctgcggaaagagtccatccagctaagggac ctggactctgcgctcttggctgaggtcaaggatgtgctgattccccatgagcgggtggtc acccacagtgaccgagtcattggcaaaggccactttggagttgtctaccacggagaatac atagaccaggcccagaatcgaatccaatgtgccatcaagtcactaagtcgcatcacagag atgcagcaggtggaggccttcctgcgagaggggctgctcatgcgtggcctgaaccacccg aatgtgctggctctcattggtatcatgttgccacctgagggcctgccccatgtgctgctg ccctatatgtgccacggtgacctgctccagttcatccgctcacctcagcggaaccccacc gtgaaggacctcatcagctttggcctgcaggtagcccgcggcatggagtacctggcagag cagaagtttgtgcacagggacctggctgcgcggaactgcatgctggacgagtcattcaca gtcaaggtggctgactttggtttggcccgcgacatcctggacagggagtactatagtgtt caacagcatcgccacgctcgcctacctgtgaagtggatggcgctggagagcctgcagacc tatagatttaccaccaagtctgatgtgtggtcatttggtgtgctgctgtgggaactgctg acacggggtgccccaccataccgccacattgacccttttgaccttacccacttcctggcc cagggtcggcgcctgccccagcctgagtattgccctgattctctgtaccaagtgatgcag caatgctgggaggcagacccagcagtgcgacccaccttcagagtactagtgggggaggtg gagcagatagtgtctgcactgcttggggaccattatgtgcagctgccagcaacctacatg aacttgggccccagcacctcgcatgagatgaatgtgcgtccagaacagccgcagttctca cccatgccagggaatgtacgccggccccggccactctcagagcctcctcggcccacttga cttagttcttgggctggacctgcttagctgccttgagctaaccccaagctgcctctgggc catgccaggccagagggcagtggccctccaccttgttcctgccctttaactttcagaggc aataggtaaatggggcccattaggtccctcactccacagagtgagccagtgagggcagtc ctgcaacatgtatttatggagtgcctgctgtggaccctgtcttctgggcacagtggactc agcagtgaccacaccaacactgacccttgaaccaataaaggaacaaatgactattaaagc acaaaaaaaaaaaaaaaa SEQIDNO:3 Metpolypeptide,homosapiens,1390aminoacids,accessionno.NP_000236. MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD TRPASFWETS SEQIDNO:4 Metpolynucleotide,homosapiens,6641bp,accessionno.NM_000245. gccctcgccgcccgcggcgccccgagcgctttgtgagcagatgcggagccgagtggaggg cgcgagccagatgcggggcgacagctgacttgctgagaggaggcggggaggcgcggagcg cgcgtgtggtccttgcgccgctgacttctccactggttcctgggcaccgaaagataaacc tctcataatgaaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttacctt ggtgcagaggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaa tatgaagtatcagcttcccaacttcaccgcggaaacacccatccagaatgtcattctaca tgagcatcacattttccttggtgccactaactacatttatgttttaaatgaggaagacct tcagaaggttgctgagtacaagactgggcctgtgctggaacacccagattgtttcccatg tcaggactgcagcagcaaagccaatttatcaggaggtgtttggaaagataacatcaacat ggctctagttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacag agggacctgccagcgacatgtctttccccacaatcatactgctgacatacagtcggaggt tcactgcatattctccccacagatagaagagcccagccagtgtcctgactgtgtggtgag cgccctgggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtagg caataccataaattcttcttatttcccagatcatccattgcattcgatatcagtgagaag gctaaaggaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgtttt acctgagttcagagattcttaccccattaagtatgtccatgcctttgaaagcaacaattt tatttacttcttgacggtccaaagggaaactctagatgctcagacttttcacacaagaat aatcaggttctgttccataaactctggattgcattcctacatggaaatgcctctggagtg tattctcacagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatacttca ggctgcgtatgtcagcaagcctggggcccagcttgctagacaaataggagccagcctgaa tgatgacattcttttcggggtgttcgcacaaagcaagccagattctgccgaaccaatgga tcgatctgccatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgt caacaaaaacaatgtgagatgtctccagcatttttacggacccaatcatgagcactgctt taataggacacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgaac agagtttaccacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcct cttaacatctatatccaccttcattaaaggagacctcaccatagctaatcttgggacatc agagggtcgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaa ttttctcctggactcccatccagtgtctccagaagtgattgtggagcatacattaaacca aaatggctacacactggttatcactgggaagaagatcacgaagatcccattgaatggctt gggctgcagacatttccagtcctgcagtcaatgcctctctgccccaccctttgttcagtg tggctggtgccacgacaaatgtgtgcgatcggaggaatgcctgagcgggacatggactca acagatctgtctgcctgcaatctacaaggttttcccaaatagtgcaccccttgaaggagg gacaaggctgaccatatgtggctgggactttggatttcggaggaataataaatttgattt aaagaaaactagagttctccttggaaatgagagctgcaccttgactttaagtgagagcac gatgaatacattgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccat aattatttcaaatggccacgggacaacacaatacagtacattctcctatgtggatcctgt aataacaagtatttcgccgaaatacggtcctatggctggtggcactttacttactttaac tggaaattacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtac tttaaaaagtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaac tgagtttgctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagtta ccgtgaagatcccattgtctatgaaattcatccaaccaaatcttttattagtggtgggag cacaataacaggtgttgggaaaaacctgaattcagttagtgtcccgagaatggtcataaa tgtgcatgaagcaggaaggaactttacagtggcatgtcaacatcgctctaattcagagat aatctgttgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaa agcctttttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataa tcctgtgtttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtact ggaaattaagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttgg aaataagagctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaa tgacctgctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaac cgtccttggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgt tgtctcaatatcaacagcactgttattactacttgggtttttcctgtggctgaaaaagag aaagcaaattaaagatctgggcagtgaattagttcgctacgatgcaagagtacacactcc tcatttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaa tgaatctgtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaa cggttcatgccgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtgg ggactctgatatatccagtccattactgcaaaatactgtccacattgacctcagtgctct aaatccagagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgt gcatttcaatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgtt ggacaatgatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacat aggagaagtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaa tgtcctctcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctacc atacatgaaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgt aaaagatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaa aaagtttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagt caaggttgctgattttggtcttgccagagacatgtatgataaagaatactatagtgtaca caacaaaacaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactca aaagtttaccaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgac aagaggagccccaccttatcctgacgtaaacacctttgatataactgtttacttgttgca agggagaagactcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaa atgctggcaccctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatc agcgatcttctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaa cgtaaaatgtgtcgctccgtatccttctctgttgtcatcagaagataacgctgatgatga ggtggacacacgaccagcctccttctgggagacatcatagtgctagtactatgtcaaagc aacagtccacactttgtccaatggttttttcactgcctgacctttaaaaggccatcgata ttctttgctcttgccaaaattgcactattataggacttgtattgttatttaaattactgg attctaaggaatttcttatctgacagagcatcagaaccagaggcttggtcccacaggcca cggaccaatggcctgcagccgtgacaacactcctgtcatattggagtccaaaacttgaat tctgggttgaattttttaaaaatcaggtaccacttgatttcatatgggaaattgaagcag gaaatattgagggcttcttgatcacagaaaactcagaagagatagtaatgctcaggacag gagcggcagccccagaacaggccactcatttagaattctagtgtttcaaaacacttttgt gtgttgtatggtcaataacatttttcattactgatggtgtcattcacccattaggtaaac attcccttttaaatgtttgtttgttttttgagacaggatctcactctgttgccagggctg tagtgcagtggtgtgatcatagctcactgcaacctccacctcccaggctcaagcctcccg aatagctgggactacaggcgcacaccaccatccccggctaatttttgtattttttgtaga gacggggttttgccatgttgccaaggctggtttcaaactcctggactcaagaaatccacc cacctcagcctcccaaagtgctaggattacaggcatgagccactgcgcccagcccttata aatttttgtatagacattcctttggttggaagaatatttataggcaatacagtcaaagtt tcaaaatagcatcacacaaaacatgtttataaatgaacaggatgtaatgtacatagatga cattaagaaaatttgtatgaaataatttagtcatcatgaaatatttagttgtcatataaa aacccactgtttgagaatgatgctactctgatctaatgaatgtgaacatgtagatgtttt gtgtgtatttttttaaatgaaaactcaaaataagacaagtaatttgttgataaatatttt taaagataactcagcatgtttgtaaagcaggatacattttactaaaaggttcattggttc caatcacagctcataggtagagcaaagaaagggtggatggattgaaaagattagcctctg tctcggtggcaggttcccacctcgcaagcaattggaaacaaaacttttggggagttttat tttgcattagggtgtgttttatgttaagcaaaacatactttagaaacaaatgaaaaaggc aattgaaaatcccagctatttcacctagatggaatagccaccctgagcagaactttgtga tgcttcattctgtggaattttgtgcttgctactgtatagtgcatgtggtgtaggttactc taactggttttgtcgacgtaaacatttaaagtgttatattttttataaaaatgtttattt ttaatgatatgagaaaaattttgttaggccacaaaaacactgcactgtgaacattttaga aaaggtatgtcagactgggattaatgacagcatgattttcaatgactgtaaattgcgata aggaaatgtactgattgccaatacaccccaccctcattacatcatcaggacttgaagcca agggttaacccagcaagctacaaagagggtgtgtcacactgaaactcaatagttgagttt ggctgttgttgcaggaaaatgattataactaaaagctctctgatagtgcagagacttacc agaagacacaaggaattgtactgaagagctattacaatccaaatattgccgtttcataaa tgtaataagtaatactaattcacagagtattgtaaatggtggatgacaaaagaaaatctg ctctgtggaaagaaagaactgtctctaccagggtcaagagcatgaacgcatcaatagaaa gaactcggggaaacatcccatcaacaggactacacacttgtatatacattcttgagaaca ctgcaatgtgaaaatcacgtttgctatttataaacttgtccttagattaatgtgtctgga cagattgtgggagtaagtgattcttctaagaattagatacttgtcactgcctatacctgc agctgaactgaatggtacttcgtatgttaatagttgttctgataaatcatgcaattaaag taaagtgatgcaacatcttgtaaaaaaaaaaaaaaaaaaaa