SYNTHETIC TRANSCRIPTIONAL AND EPIGENETIC REGULATORS BASED ON ENGINEERED, ORTHOGONAL ZINC FINGER PROTEINS

20180057838 ยท 2018-03-01

Assignee

Inventors

Cpc classification

International classification

Abstract

Embodiments disclosed herein provide artificial expression systems comprising the zinc-finger containing transcription factors and engineered promoters to modulate expression of genes of interest. Engineered zinc-finger transcription factors that interact with engineered promoters constitute synthetic and regulatable expression systems which facilitate the modulation of gene expression as desired.

Claims

1. An engineered gene expression system for the in vivo or in vitro regulatable expression of an exogenous gene, the system comprising: a) an engineered zinc-finger-containing synthetic transcription factor (synTF) protein comprising two main domains: (a) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (b) a second domain through which the synTF exerts its effect (effector domain), wherein the synTF having the formula I: [ZF protein domain]-[effector domain] or the formula IV: [effector domain]-[ZF protein domain], wherein the ZF protein domain is modular in design and is composed zinc finger arrays (ZFA), wherein there is one or more and up to ten ZFAs, wherein the ZFA comprising a sequence: N-[(formula II)-L.sub.2].sub.6-8-C, wherein formula II is that of a ZF motif and is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19), where the subscript 6-8 indicates the number of ZF motifs in a ZFA, the ZF motifs that are linked together by the linker L.sub.2, the L.sub.2 is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence, and b) an engineered responsive promoter comprising i) at least one orthogonal target DNA sequence element selected from the group consisting of 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and, ii) a promoter sequence, wherein the at least one target DNA sequence element is operably linked to the 5 end of the promoter sequence in order to influence transcription initiation of a nearby coding sequence, wherein the influence is to upregulate or downregulate transcription initiation, and wherein the gene is operably linked to the promoter in the engineered responsive promoter, wherein the ZFA of the synTF binds the at least one orthogonal target DNA sequence element in the engineered responsive promoter.

2. The system of claim 1, wherein formula II is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20).

3. The system of claim 1, wherein the sequences of all the helices of each ZFA or at least four of the helices in each ZFA are selected from within a group selected from the Groups 1-11.

4. The system of claim 1, wherein all the helices within a ZFA of the synTF are linked by peptide linkers (L.sub.2).

5. The system of claim 1, wherein the effector domain of the synTF is a transcription activating domain, or a transcription repressor domain, or an epigenetic effector domain.

6. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from helices disclosed in Group 1, and the ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81).

7. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 2, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82).

8. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices disclosed in Group 3, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83).

9. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 4, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84).

10. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 5, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85).

11. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 6, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86).

12. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected the helices disclosed in Group 7, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87).

13. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 8, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88).

14. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 9, and the ZFA specifically binds the orthogonal DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89).

15. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 10, from Group 10, and the at least one ZFA specifically binds the orthogonal DNA sequence Target 10: 5 C GGC GTA GCC GAT GTC GCG C 3 (SEQ ID NO: 90).

16. The system of claim 1, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 11-1, from Group 11, and the at least one ZFA specifically binds the orthogonal DNA sequence Target 11: 5 G GTC GTT GCG GTA GTC GAA G 3 (SEQ ID NO: 91).

17. A method of regulating gene activation or repression comprising contacting a cell with an engineered gene expression system of claim 1.

18. A kit for regulating gene activation or repression comprising an engineered expression system of claim 1.

19. An engineered zinc-finger-containing synthetic transcription factor (synTF) protein comprising two main domains: (a) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (b) a second domain through which the synTF exerts its effect (effector domain), wherein the synTF having the formula I: [ZF protein domain]-[effector domain] or the formula IV: [effector domain]-[ZF protein domain], wherein the ZF protein domain is modular in design and is composed zinc finger arrays (ZFA), wherein there is one or more and up to ten ZFAs, wherein the ZFA comprising a sequence: N-[(formula II)-L2].sub.6-8-C, wherein formula II is that of a ZF motif and is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19), where the subscript 6-8 indicates the number of ZF motifs in a ZFA, the ZF motifs that are linked together by the linker L.sub.2, the L.sub.2 is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence.

20. An engineered responsive promoter comprising (a) at least one target DNA sequence element selected from the group consisting of 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and (b) a promoter sequence, wherein the at least one target DNA sequence element is operably linked 5 end of the promoter sequence in order to influence transcription initiation of a nearby coding sequence.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0058] FIG. 1 show an engineered regulatable gene expression system composed of a zinc finger-containing synthetic transcription factor protein (synTF), and an engineered promoter, a nucleic acid sequence. The synTF is composed of two main domains: (a) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (b) a second domain through which the synTF exerts its effect (effector domain). The ZF protein domain is modular in design, composed zinc finger arrays (ZF arrays). The engineered protomer is composed of at least two main segment of sequences: (a) zinc finger binding target sequence (target site) and (b) a promoter sequence. The target site is specific for the particular ZF protein domain of the synTF, and constitutes the response element in the engineered regulatable gene expression system. When the target site is bound by the ZF protein domain of the respective synTF, the effector domain of that synTF would able to exert its effect on the promoter linked with the target site.

[0059] FIG. 2A shows the main components or domains of an engineered zinc finger-containing synthetic transcription factor (synTF).

[0060] FIG. 2B shows the main components of a DNA-binding zinc finger protein domain (ZF protein domain), and a zinc finger array (ZFA) consisting of seven zinc fingers (ZFs). A ZF protein domain can have up to eight ZYs.

[0061] FIG. 2C shows the modular design of ZF protein domains where ZF protein domains can have a single zinc finger array (ZFA) or have as many as up to ten ZFAs.

[0062] FIG. 3 shows the architecture of engineered zinc finger-containing synthetic transcription factors (synTF) having a single zinc finger array (ZFA) or up to ten ZFAs.

[0063] FIGS. 4A-4C show the modular design of responsive promoters having one orthogonal target DNA site (1) (SEQ ID NOS 104-105, respectively, in order of appearance), four orthogonal target DNA sites (4) (SEQ ID NOS 106-110, respectively, in order of appearance), eight orthogonal target DNA sites (8) (SEQ ID NOS 111-118, respectively, in order of appearance), and five orthogonal target DNA sites (5) (SEQ ID NOS 119-124, respectively, in order of appearance) incorporated into the promoter. The individual orthogonal target DNA site is about 20 base pairs (bp) long and is indicated as [Target] described in the modular design shown.

[0064] FIG. 5A shows the modular designs of a DNA-binding zinc finger protein domain (ZF protein domain) suitable for constructing into a synTF with an effector domain (SEQ ID NOS 125 and 18, respectively, in order of appearance). Here, the ZF protein domain is composed of a single zinc finger array (ZFA) consisting of six zinc fingers (ZF) where each ZF is linked to the adjacent by a linker peptide having the sequence TGEKP (SEQ ID NO: 2) or TGSQKP (SEQ ID NO: 3). The single ZFA is a 6-finger ZFA. TGEKP (SEQ ID NO: 2) is a rigid linker peptide and TGSQKP (SEQ ID NO: 3) is a flexible linker peptide. Each ZF has the conserved ZF secondary structural motif of beta-beta-alpha helix of a CysHis zinc finger (ZF), and has the formula II of [X.sub.2CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 18) or [XXCXXCXXXXX-(Variable helix)-HXXXH] (SEQ ID NO: 18). C=Cys, H=His, these are the Cys and His of the ZF.

[0065] FIG. 5B shows another DNA-binding zinc finger protein domain (ZF protein domain) having the modular design (SEQ ID NO: 126). Here, the ZF protein domain is composed of a single 6-finger zinc finger array (ZFA).

[0066] FIGS. 6A-6D show the modular design of engineered of ZF-containing synTFs (synTFs). Each synTF is composed of two main domain: (a) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (b) a second domain through which the synTF exerts its effect (effector domain). In each synTF, the ZF protein domain is composed of a single zinc finger array (ZFA) consisting of six zinc fingers (ZF) where each ZF is linked to the adjacent by a linker peptide having the sequence TGEKP (SEQ ID NO: 2) or TGSQKP (SEQ ID NO: 3). The effector domain shown in each synTF is either an activation or repression effector domain. The synTF is designed to have a nuclear localization domain so the protein is translocated into the nucleus of a cell.

[0067] FIG. 6A shows a synTF composed of a ZF protein domain covalently linked to a VP64 activation domain, the ZF protein domain is composed of having a single 6-finger ZFA (SEQ ID NO: 127).

[0068] FIG. 6B shows a synTF composed of a ZF protein domain covalently linked to a KRAB repressive domain, the ZF protein domain is composed of having a single 6-finger ZFA (SEQ ID NO: 128).

[0069] FIG. 6C shows a synTF composed of a ZF protein domain covalently linked to a HP1 repressive domain, the ZF protein domain is composed of having a single 6-finger ZFA (SEQ ID NO: 129).

[0070] FIG. 6D shows a synTF composed of a ZF protein domain covalently linked to a p65 activation domain of NFB, the ZF protein domain is composed of having a single 6-finger ZFA (SEQ ID NO: 130).

[0071] FIG. 7 demonstrates results obtained where each synTF having VP64 as the effector domain described herein was tested with its corresponding 1 responsive reporter in HEK 293 cells to determine the most potent activators. In addition, each synTF was tested with its corresponding 4 responsive reporter to determine the most potent activators. Experiments were done using transient transfection. A1 responsive reporter is a reporter gene operable linked to a responsive promoter engineered with one orthogonal DNA target site for the zinc finger binding of a synTF having a single zinc finger array. A4 responsive reporter is a reporter gene operable linked to a responsive promoter engineered with one orthogonal DNA target site for the zinc finger binding of a synTF having four zinc finger arrays.

[0072] FIG. 8 shows results obtained for designated synTFs 1-3, 2-6, 3-5, 4-8, 5-7, 6-4, 7-3, 8-1, and 9-2 (fusions to VP64) were tested against all respective 1 responsive reporters using transient transfection to assay for cross-activity.

[0073] FIG. 9 shows a comparison of synTF transcriptional activation versus full length (strong) CMV promoter in HEK293 cells. The figure shows that synTF transcriptional activators can achieve activation levels greater than that of the (strong) full length CMV promoter in HEK293 cells. Experiment was done using transient transfection.

[0074] FIG. 10 shows that synTF transcriptional repressors can fully silence full length CMV promoter in HEK293 cells. Experiment was done using transient transfection.

[0075] FIG. 11 demonstrates that synTFs have broad functionality across mammalian cell lines and eukaryotic systems. Data shown is for HEK293 cells and TE671/RD cells.

[0076] FIG. 12 demonstrates one example of synTF KRAB repressor activity in an engineered gene expression system. Repressor can silence strong promoters such as full-length CMV promoter.

[0077] FIG. 13 demonstrates another example of synTF HP1 repressor activity in an engineered gene expression system. Repressor can silence strong promoters such as full-length CMV promoter.

[0078] FIG. 14 demonstrates that the synTF can robustly activate responsive promoters in both transfected plasmid and genome integrated synthetic reporters.

[0079] FIG. 15 demonstrates that the synTF transcriptional activators specifically activate their respective responsive promoters in genome integrated reporters in HEK293 cells (promoters consisting of 4ZF binding sites). The synTF transcriptional activators are fusion proteins with the p65 activation domain as the effector domain. The x-axis on the top indicates the various synTF transcriptional activators having the respective ZF combination. The y-axis on the left indicates the various responsive promoters for the respective ZF protein in the synTF transcriptional activators. Experiment was done using synTFs transient transfection into stable integration reporter cell lines (AAVS1-integrated). Control experiment was conducted with Gal4 transcriptional activator and UAS responsive promoter. The ZF-containing synTF transcriptional activators were compared to the control Gal4-UAS activation.

DETAILED DESCRIPTION

[0080] Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. It should be understood that this disclosure is not limited to the particular methodology, protocols, and reagents, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present disclosure, which is defined solely by the claims.

[0081] Definitions of common terms in molecular biology can be found in The Encyclopedia of Molecular Cell Biology and Molecular Medicine, published by Blackwell Science Ltd., 1999-2012 (ISBN 9783527600908); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8); Lewin's Genes XI, published by Jones & Bartlett Publishers, 2014 (ISBN-1449659055); Michael Richard Green and Joseph Sambrook, Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2012) (ISBN 1936113414); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (2012) (ISBN 044460149X); Current Protocols in Molecular Biology (CPMB), Frederick M. Ausubel (ed.), John Wiley and Sons, 2014 (ISBN 047150338X, 9780471503385), and Current Protocols in Protein Science (CPPS), John E. Coligan (ed.), John Wiley and Sons, Inc., 2005, the contents of which are all incorporated by reference herein in their entireties. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.

[0082] Unless otherwise stated, the present disclosure was performed using standard procedures known to one skilled in the art, for example, in Michael R. Green and Joseph Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2012); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (1986): Current Protocols in Molecular Biology (CPMB) (Fred M. Ausubel, et al. ed., John Wiley and Sons, Inc.), Current Protocols in Cell Biology (CPCB) (Juan S. Bonifacino et. al. ed., John Wiley and Sons, Inc.), Culture of Animal Cells: A Manual of Basic Technique by R. Ian Freshney, Publisher: Wiley-Liss; 5th edition (2005), Animal Cell Culture Methods (Methods in Cell Biology, Vol. 57, Jennie P. Mather and David Barnes editors, Academic Press, 1st edition, 1998), Methods in Molecular biology, Vol. 180, which are all herein incorporated by reference in their entireties.

[0083] It should be understood that this disclosure is not limited to the particular methodology, protocols, and reagents, etc., described herein and as such may vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present disclosure, which is defined solely by the claims.

[0084] Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term about. The term about when used in connection with percentages will mean1%.

[0085] All patents and publications identified are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the present disclosure. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior disclosure or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.

[0086] Disclosed herein are (1) engineered, synthetic, zinc-finger containing transcription factor proteins (synTF) that are designed to bind unique DNA sequence elements that are orthogonal to a eukaryotic genome (hereafter referred to as an orthogonal target DNA sequence or orthogonal DNA sequence). The orthogonal DNA sequence elements are also referred to as target DNA, target, target DNA sequence or target DNA sequence elements in the context of the synthetic transcription factor, and are used interchangeably. These synTF are used to modulate gene expressions from promoters constructed with the orthogonal target DNA, that is, these synTF, when interacting (ie., binding) with the orthogonal target DNA, can either activate gene expression or repress gene transcription of the gene operable linked with that promoter. In essense, the promoter is responsive to the synTF. The activation or repression is executed by an effector domain that is covalently conjugated to the zinc-fingers in the synTF. (2) Engineered promoters having the orthogonal target DNA for the regulation of expressions of genes of interest (GOI). These are synTF responsive promoters. (3) A modulated or regulatable gene expression system comprising a synTF of (1) and an engineered promoter of (2) where there is minimal or no off-target endogenous gene modulation because of the orthogonal target DNA used in the system. (4) Engineered synTF that are further fused to a ligand binding domain or a dimerization domain. Engineered fusion protein comprising of synTF-[ligand binding domain] or [ligand binding domain]-synTF would facilitate nuclear translocation of the synTF in the presence of the ligand. (5) engineered zinc finger-containing fusion proteins, each fusion protein comprising an engineered zinc finger (ZF) arrays and a ligand binding domain or a protein interaction/dimerization domain, wherein the engineered ZF arrays are coupled to the ligand binding domain or the protein interaction/dimerization domain. The ZF-protein domain can be located at the N-terminus or the C-terminus of the described fusion containing a ligand binding domain or a protein interaction/dimerization domain. The design of the engineered zinc finger-containing fusion proteins are as follows: [ZF domain]-[ligand binding domain], [ZF domain]-[protein interaction/dimerization domain], [ligand binding domain]-[ZF domain], and [protein interaction/dimerization domain]-[ZF domain].

[0087] Provided herein are a class of engineered transcription factor proteins (synTFs) and corresponding responsive promoters capable of precisely controlling gene expression in eukaryotic cells. These synTFs are designed to have reduced or minimal binding potential in the host genome (i.e., orthogonal to the host mammalian genome). The synTF proteins described herein are based on engineered zinc finger arrays (ZFA), designed to bind a specific target DNA sequence that is about 10-20 nucleotide in length and that is distant (ie., orthogonal to) from host genome sequences.

Engineered, Zinc-Finger (ZF) Containing Transcription Factor Proteins (synTF) and otherZF Containing Fusion Proteins

[0088] In one aspect, disclosed herein is an engineered synTF protein comprising of two main protein domains: (a) a first main domain which is a DNA-binding zinc finger protein domain, the ZF protein domain, and (b) a second domain through which the synTF exerts its effect, the effector domain, wherein the ZF protein domain and the effector domain are covalently linked together. See FIG. 2A.

[0089] In one embodiment, the engineered synTF protein further (c) a third main protein domain, a ligand binding domain or a protein interaction/dimerization domain, wherein the third main protein domain is covalently linked the synTF.

[0090] In one aspect, provided herein is a (synTF-[ligand binding domain]) fusion protein or ([ligand binding domain]-synTF) fusion protein. This design would cover any ZF-containing fused or covalently linked to a ligand binding domain, such as ERT2 (estrogen receptor ligand binding domain), thereby covering fusion proteins that are regulatable by chemical inducible systems. ERT2 is tamoxifen inducible. In one embodiment, the presence of tamoxifen or estrogen analogs induces the nuclear localization of a synTF-ERT2 or an ERT2-synTF fusion protein.

[0091] In one aspect, provided herein is a (synTF-[protein interaction domain]) or ([protein interaction domain]-synTF) fusion protein. This design would cover any ZF-containing fusion to a protein-protein interaction domain that could be used to mediate synTF multimerization. In one embodiment, the protein interaction domain allows dimerization of protein domains.

[0092] In one embodiment, the ligand binding domain is a steroid receptor ligand binding domain such as estrogen receptor. In one embodiment, the ligand is tamoxifen or other estrogen analogs. The fusion protein can have be designed as a synTF-[ligand binding domain] fusion protein or a [ligand binding domain]-synTF fusion protein, wherein the synTF is located at the N-terminus or the C-terminus of the ligand binding domain in the fusion protein, and wherein the conjugated ligand binding domain would facilitate nuclear translocation of the synTF in the presence of the ligand. Hence, the translocation of the synTF can be regulated by the presence of the ligand. The sequence of the exemplary estrogen receptor ligand binding domain is SEQ ID NO: 146.

[0093] In one embodiment, the ligand binding domain is VWF A1 domain and the corresponding ligand is the GP1b subunit. The VWF A1 domain/GP1b subunit forms a receptor ligand binding domain-ligand pair.

[0094] In other embodiments, the receptor ligand binding-ligand pair is selected from the group consisting of 4b7 integrin-madcam-1, L integrin I domain-ICAM-1(D1+D2), L integrin I domain-ICAM-3 (D1); and fimH pilin+lectin domain-N-linked carbohydrate.

[0095] Numerous receptor ligand binding-ligand pairs are known in the art, for examples, (1) the receptor-ligand pair is a WVF A1 domain and a GP1b subunit, the template mRNAs for PCR cloning of a DNA encoding an A1 domain and a GP1b can be the Homo sapiens glycoprotein Ib (platelet), alpha polypeptide (GP1BA) mRNA GENBANK Accession No. NM_000173.4; the von Willebrand factor A1 domain isoform 1 precursor mRNA GENBANK Accession No. NM_022834.4; and the von Willebrand factor A1 domain isoform 2 precursor mRNA GENBANK Accession No. NM_199121.2; (2) the receptor-ligand pair is an 4b7 integrin and a madcam-1, the template mRNAs for PCR cloning of a DNA encoding an 4b7 integrin and a madcam-1 can be the Homo sapiens integrin alpha L isoform b precursor GENBANK Accession No. NM_001114380.1; the integrin alpha L isoform a precursor GENBANK Accession No. NM_002209.2; and the intercellular adhesion molecule 1 (ICAM-1) precursor GENBANK Accession No. NM_000201.2; (3) the receptor-ligand pair is an aL integrin I domain and an ICAM-1(D1+D2), the template mRNAs for PCR cloning of the DNAs encoding an aL integrin I domain and an ICAM-1(D1+D2) can be the mRNA of the integrin alpha L isoform a precursor GENBANK Accession No. NM_002209.2 and the mRNA of the Homo sapiens intercellular adhesion molecule 1 precursor (ICAM-1) GENBANK Accession No. NM_000201.2; (4) the receptor-ligand pair is the aL integrin I domain and ICAM-3(D1), the template mRNAs for PCR cloning of the DNAs encoding an aL integrin I domain and an ICAM-3(D1) can be the mRNA of the integrin alpha L isoform a precursor GENBANK Accession No. NM_002209.2 and the mRNA of the Homo sapiens intercellular adhesion molecule 3 precursor (ICAM-3) GENBANK Accession No. NM_002162.3. The I domain encompasses amino acid residues 145-324 of the 1145 amino acid long mature L integrin subunit protein (amino acid residues 26-1170 of GenBank Accession No. NP_002200); and (5) the receptor-ligand pair is a fimH pilin+lectin domain and a N-linked carbohydrates, the template mRNA for PCR cloning the DNA encoding a fimH pilin+lectin domain can be the Escherichia coli strain J96 type 1 fimbrial adhesin precursor (fimH) gene, GENBANK Accession No. AY914173, described in PCT publication WO2011103049, the contents of which are incorporated herein by reference in its entirety.

[0096] In one embodiment, the protein interaction/dimerization domain is the dimerization domain of ABI1, PYL1, FKBP (FK506 binding protein) or Frb (FKBP-Fap binding domain of mTOR). The protein interaction/dimerization domains of ABI1 and PYL1 dimerized upon the presence of ABA (Abscisic acid). FKBP and Frb dimerized upon the presence of rapamycin. Exemplary sequences of ABI1, PYL1, FKBP, and Frb are SEQ ID NO: 142-145 respectively. In some embodiments, the dimerizations are inducible by the presence of a chemical, e.g., abscisic acid induces the dimerization of ABI1 and PYL1, and rapamycin induces the dimerization of FKBP and Frb.

[0097] Alternatively, the two main protein domains (a) and (b) described herein in the engineered synTFs can be split into two separate and distinct fusion proteins, a first fusion protein containing the ZF protein domain and a second fusion protein containing the effector domain, wherein the ZF domains and effector domains are each fused to one half of a chemically-inducible dimerization domain.

[0098] In another aspect, provided herein is a novel class of engineered zinc finger-containing fusion proteins, each fusion protein comprising (1) an engineered zinc finger (ZF) arrays and (2) a ligand binding domain or a protein interaction/dimerization domain, wherein the engineered ZF arrays are coupled to the ligand binding domain or the protein interaction/dimerization domain. The ZF-containing protein domain (ZF protein domain) can be located at the N-terminus or the C-terminus of the described fusion containing a ligand binding domain or a protein interaction/dimerization domain. The various designs of the engineered zinc finger-containing fusion proteins are as follows: [ZF domain]-[ligand binding domain], [ZF domain]-[protein interaction/dimerization domain], [ligand binding domain]-[ZF domain], and [protein interaction/dimerization domain]-[ZF domain].

[0099] As described above, in one embodiment, the ligand binding domain is a steroid receptor ligand binding domain such as estrogen receptor. In one embodiment, the ligand is tamoxifen or other estrogen analogs. The conjugated ligand binding domain would facilitate nuclear translocation of the ZF in the presence of the ligand. Hence, the translocation of the ZF domain can be regulated by the presence of the ligand.

[0100] In one embodiment, the ligand binding domain is VWF A1 domain and the corresponding ligand is the GP1b subunit. The VWF A1 domain/GP1b subunit forms a receptor ligand binding domain-ligand pair.

[0101] In other embodiments, the receptor ligand binding-ligand pair is selected from the group consisting of 4b7 integrin-madcam-1, L integrin I domain-ICAM-1(D1+D2), L integrin I domain-ICAM-3 (D1); and fimH pilin+lectin domain-N-linked carbohydrate.

[0102] In one embodiment, provided is a first fusion protein comprising a ZF protein domain that is fused to a first protein interaction/dimerization domain, e.g., PYL1 (Abscisic Acid Receptor) or ABI1 (Abscisic Acid Insensitive 1), forming a fusion ZF-containing protein.

[0103] In another example, the ZF protein domain is fused to FKBP (FK506 Binding Protein) or Frb, each is another example of a protein interaction/dimerization domain.

[0104] In one embodiment, provided is a second fusion protein comprising an effector domain or an epigenetic effector domain that is fused to a second protein interaction/dimerization domain, e.g., PYL1 (Abscisic Acid Receptor) or ABI1 (abscisic acid Insensitive 1), forming a fusion effector-containing protein. The first and second protein interaction/dimerization domains in the first and second fusion are not the same, and that first and second protein interaction/dimerization domains can dimerize together. The inventors constructed and test a chemical inducible ZF-VP64 system, based on the ABI1/PYL1 plant abscisic acid system. SEQ ID NO: 133 shows the nucleic acid construct for the expression of a first fusion protein and second fusion protein from a single expression vector. The ZF protein domain comprising the ZF10-1 helix combo is linked to ABI1, forming the first fusion protein. A nuclear locatization signal (NLS) is included in the design. The second fusion protein comprises the VP64 transactivation effector domain linked to PYL1. A P2A sequence is include to facilate the separation of the first and second fusion proteins from each other in the primary transcript.

[0105] For example, the first fusion protein comprises the ZF protein domain that is fused to PYL1 and the second fusion protein comprises the effector domain that is fused to ABI1. When these first and second fusion proteins are mixed together in the presence of abscisic acid, the dimerization of PYL1 with ABI1 is induced and the ZF protein domain of the first fusion protein would be brought in closer proximity to the effector domain of the second fusion protein.

[0106] For another example, the first fusion protein comprises the ZF protein domain that is fused to FKBP (FK506 Binding Protein) and the second fusion protein comprises the effector domain that is fused to Frb (FKBP-Rap binding domain of mTOR). When these first and second fusion proteins are mixed together in the presence of rapamycin or rapalogs, the dimerization of FKBP with Frb is induced and the ZF protein domain of the first fusion protein would be brought in closer proximity to the effector domain of the second fusion protein.

[0107] In one embodiment of any aspect described herein, the ZF protein domain of any engineered fusion protein described herein is located at the N-terminus or the C-terminus of the effector domain (Formula I and Formula IV respectively), or the N-terminus or the C-terminus of the ligand binding domain or the protein interaction/dimerization domain. See FIGS. 2A and 3. For example, the ZF protein domain and the effector domain are covently conjugated to each other by a peptide linker to form a chimeric fusion protein.

[0108] The ZF protein domain is modular in design, with zinc finger arrays (ZFA) as the main components, and each ZFA is made of 6-8 ZF motifs. See FIG. 2B. The ZF protein domain comprises at least one ZFA, and can contain as many as up to ten ZFA. The ZF protein domain can have one and up to ten ZFA. See FIG. 2C.

[0109] In some embodiments of any aspect described herein, the effector domain is replaced with the ligand binding domain or the protein interaction/dimerization domain.

[0110] The design of the synTF or any engineered fusion protein described herein is also modular, meaning the synTF is made up of modules of ZF domains (ZFA) and modules of effector domains/protein interaction domains/ligand binding domains/dimerization domains, the individual modules are covalently conjugated together as described herein, and the individual modules function independently of each other. See FIG. 2A. The number of ZFA can range from one, two, three, four, five, six, seven, eight, nine, and up to ten. When there are two or more ZFA, the ZFAs are covalently conjugated to each other in tandem, e.g., by a peptide linker, L1, in an NH.sub.2 to COOH terminus arrangement to form an array of ZFA. See FIG. 2B. The ZFAs, as a whole, forms the ZF protein domain, is covalently linked to the N-terminus or the C-terminus of the effector domain. See FIG. 2A. There is at least one effector domain in each synTF.

[0111] According, disclosed herein is an engineered zinc-finger-containing synTF protein comprising (a) a DNA-binding zinc finger protein domain, and (b) an effector domain. In one aspect, disclosed herein is an engineered zinc-finger-containing synTF protein having the formula I: [DNA-binding zinc finger protein domain]-[effector domain] or having the formula IV: [effector domain]-[DNA-binding zinc finger protein domain]. Non-limiting examples of synTF proteins having ZF protein domains consisting of two, three, five, six, or eight ZFAs are as follows:

[(ZFA-1)-(ZFA-2)]-[effector domain];
[(ZFA-1)-(ZFA-2)-(ZFA-3)]-[effector domain];
(ZFA-1)-(ZFA-2)-(ZFA-3)-(ZFA-4)-(ZFA-5)]-[effector domain];
[(ZFA-1)-(ZFA-2)-(ZFA-3)-(ZFA-4)-(ZFA-5)-(ZFA-6)]-[effector domain]; and
[(ZFA-1)-(ZFA-2)-(ZFA-3)-(ZFA-4)-(ZFA-5)-(ZFA-6)-(ZFA-7)-(ZFA-8)]-[effector domain]

[0112] FIG. 3 shows more designs of several embodiments of synTFs encompassed in this disclosure.

[0113] When there are two or more ZFAs present in the ZF protein domain of a synTF or a ZF containing fusion protein described herein, the ZFAs can be the same, or different. For example, in a two-ZFA containing synTF, [(ZFA-1)-(ZFA-2)]-[effector domain], the ZFA-1 and ZFA-2 are the same, and have the same amino acid sequence. Alternatively, ZFA-1 and ZFA-2 are different, and have different amino acid sequence.

[0114] Each modular ZFA in the ZF protein domain of a synTF disclosed herein or a ZF containing fusion protein described herein is comprised of six to eight ZF motifs. See FIG. 2B for an example of a single ZFA having seven ZF motifs, a seven-finger ZFA. The ZF motif is a small protein structural motif consisting of an helix and an antiparallel sheet () and is characterized by the coordination of one zinc ion by two histidine residues and two cysteine residues in the motif in order to stabilize the finger-like protrusion fold, the finger. The ZF motif in the ZF protein domain of a synTF disclosed herein is a Cys.sub.2His.sub.2 zinc finger motif. In one embodiment, the ZF motif comprises, consisting essentially of, or consisting of a peptide of formula II: [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19) wherein X is any amino acid, the subscript numbers indicate the possible number of amino acid residues, C is cysteine, H is histidine, and (helix) is a-six contiguous amino acid residue peptide that forms a short alpha helix. The helix is variable. This short alpha helix forms one facet of the finger formed by the coordination of the zinc ion by two histidine residues and two cysteine residues in the ZF motif. For each ZFA, the six to eight ZF motifs therein are linked to each other, NH.sub.2 to COOH terminus by a peptide linker having about four to six amino acid residues to form an array of ZF motifs or ZF. The finger-like protrusion fold of each ZF motif interacts with and binds nucleic acid sequence. Approximately a peptide sequence for two ZF motif interacts with and binds a six-base pair (bp) nucleic acid sequence. The multiple ZF motifs in a ZFA form finger-like protrusions that would make contact with an orthogonal target DNA sequence. Hence, for example, a ZFA with six ZF motifs or finger-like protrusions (a six-finger ZFA) interacts and binds a 18-20 bp nucleic acid sequence, and a eight-finger ZFA would bind a 24-26 bp nucleic acid sequence. Accordingly, in one embodiment, the ZFA in the ZF protein domain of a synTF comprises, consists essentially of, or consists of a sequence: N-[(formula II)-L.sub.2].sub.6-8-C, where the subscript 6-8 indicates the number of ZF motifs, the L.sub.2 is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence. For example, for a ZFA consists essentially of six ZF motifs, the sequence is N-[(formula II)-L]-[(formula II)-L.sub.2]-[(formula II)-L.sub.2]-[(formula II)-L.sub.2]-[(formula II)-L.sub.2-[(formula II)-L.sub.2]-C, and a ZFA consists essentially of eight ZF motifs, the sequence is N-[(formula II)-L.sub.2]-[(formula II)-L.sub.2]-[(formula I)-L.sub.2]-[(formula II)-L.sub.2]-[(formula II)-L.sub.2]-[(formula II)-L.sub.2]-]-[(formula II)-L.sub.2]-[(formula II)-L.sub.2]-C.

[0115] In another embodiment of any aspect described herein, the ZF motif comprises a peptide of formula III: [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20) wherein X is any amino acid, the subscript numbers indicate the possible number of amino acid residues, C is cysteine, H is histidine, and (helix) is a-six contiguous amino acid residue peptide that forms a short alpha helix. Accordingly, in one embodiment, the ZFA in the ZF protein domain of a synTF comprises, consists essentially of, or consists of a sequence: N-[(formula III)-L.sub.2].sub.6-8-C, where the subscript 6-8 indicates the number of ZF motifs, the L, is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence. For example, for a ZFA consists essentially of six ZF motifs, the sequence is N-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-C and a ZFA consists essentially of eight ZF motifs, the sequence is N-[(formula III)-L.sub.2-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-[(formula III)-L]-[(formula III)-L]-[(formula III)-L.sub.2]-]-[(formula III)-L.sub.2]-[(formula III)-L.sub.2]-C.

[0116] In one embodiment of any aspect described herein, for a single ZFA is the ZF protein domain of a synTF disclosed herein, the ZFA in the ZF protein domain comprises, consists essentially of, or consists of a sequence: N-PGERPFQCRICMRNFS-(Helix 1)-HTRTHTGEKPFQCRICMRNFS-(Helix 2)-HLRTHTGSQK PFQCRICMRNFS-(Helix 3)-HTRTHTGEK PFQCRICMRNFS-(Helix 4)-HLRTHTGSQKPFQCRICMRNFS-(Helix 5)-HTRTHTGEK PFQCRICMRNFS-(Helix 6)-HLRTHLR-C (SEQ ID NO: 21), wherein the (Helix) is a-six contiguous amino acid residue peptide that forms a short alpha helix. In one embodiment, all six of the helix 1, 2, 3, 4, 5 and 6 are distinct and different from each other. In another embodiment, all six of the helix 1, 2, 3, 4, 5 and 6 are identical to each other. Alternatively, at least two of the six helices are identical and the same with each other. In other embodiments, at least three of the six helices in a ZFA are identical and the same with each other, at least four of the six helices in a ZFA are identical and the same with each other, or at least five of the six helices in a ZFA are identical and the same with each other.

[0117] In some embodiments of any aspect described herein, the helices of the six to eight ZF motifs of an individual ZFA disclosed herein are selected from the six-amino acid residue peptide sequences disclosed in one of the following Groups 1-11. In some embodiments, at least four of the ZF motifs in an individual ZFA disclosed herein are selected from the six-amino acid residue peptide sequences disclosed in one of the following Groups 1-11. In other embodiments, all of the ZF motifs, ie. the six, seven or eight ZF motifs in an individual ZFA disclosed herein, are selected from the six amino acid residue peptide sequences disclosed in one of the following Groups 1-11. In any individual ZFA, the helix selected for a single ZF comprising the ZFA can be repeated twice or more in the ZFA. This means that for any given single ZFA, at least four or all the helices in the ZFA are selected from the same group disclosed herein. For example, wherein a ZFA consists essentially of six ZF motifs, that means there are six alpha helices. All the 6-8 helices (Helix 1; Helix 2; Helix 3; Helix 4; Helix 5; Helix 6; Helix 7; Helix 8) of the ZFs in an individual ZFA is selected from one of the following group 1-11, for example, all six helices are selected from group 2. That is, all the helices for all the ZF comprising a single ZFA come from the same group. Alternatively, at least four of the six helices are selected from the same group, a group selected from group 1-11. For example, four of the six helices are selected from group 5, and the reminder two helices of the six-ZF motif ZFA are selected from the other groups 1-4, 6-11, or can be any other helices that would form a short alpha helix. The other remaining helices making up the ZFA can those that are known in the art.

TABLE-US-00001 SEQID SEQID SEQID SEQID Group1 NO: Group2 NO: Group3 NO: Group4 NO: DEANLRR 22 QRSSLVR 31 QRSSLVR 31 QQTNLTR 26 DPSVLKR 23 DMGNLGR 32 DKSVLAR 40 QGTSLAR 46 QSANLLR 24 RSHDLTR 33 QTNNLGR 41 VRHNLTR 47 DPSSLKR 25 HKSSLTR 34 THAVLTR 42 DKSVLAR 40 QQTNLTR 26 DSSNLRR 35 DRGNLTR 38 DSSNLRR 35 DATQLVR 27 DQGNLIR 36 TKSLLAR 43 DQGNLIR 36 ERRSLAR 28 QKQALTR 37 QKQALDR 44 EKQNLAR 48 EEANLRR 29 DRGNLTR 38 DTSVLNR 45 DPSNLRR 49 DHSSLKR 30 RSHDLTV 39 DHSNLSR 50 QSTSLQR 51 SEQID SEQID SEQID Group5 NO: Group6 NO: Group7 NO: NMSNLTR 52 QQTNLTR 26 QRSSLVR 31 DRSVLRR 53 QGGNLAL 60 QRGNLNM 64 LQENLTR 54 DHSSLKR 30 RPQELRR 65 DRSSLRR 55 RADMLRR 61 DHSSLKR 30 QSGTLHR 56 DSSNLRR 35 RQDNLGR 66 QLANLAR 57 DQGNLIR 36 DGGNLGR 67 DQTTLRR 58 EKQNLAR 48 QQGNLQL 68 DPSNLAR 59 DPSNLRR 49 RRQELTR 69 QKANLGV 62 DPSNLRR 49 RLDMLAR 63 SEQID SEQID Group SEQID Group SEQID Group8 NO: Group9 NO: 10 NO: 11 NO: QASNLTR 70 DSSNLRR 35 RRHGLDR 75 QLSNLTR 77 DHSSLKR 30 DQGNLIR 36 DHSSLKR 30 DRSSLKR 78 RAHNLLL 71 RAHNLLL 71 VRHNLTR 47 QRSSLVR 31 QRSSLVR 31 QRSSLVR 31 DHSNLSR 50 RLDMLAR 63 QSTTLKR 72 QSTTLKR 72 QRSSLVR 31 VRHSLTR 79 DPSNLRR 49 DPSNLRR 49 ESGHLKR 76 ESGALRR 80 QGTTLKR 73 EKQNLAR 48 QRSNLAR 74 DSSNLRR 35

[0118] Non-limiting examples of the combinations and arrangements of six helices in a single ZFA where the helices are selected from Group 1 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 1 ZFA helix combo), are as follows:

ZF 1-1: N-DEANLRR, DPSVLKR, QSANLLR, DPSSLKR, QQTNLTR, DATQLVR-C (SEQ ID NOS 22, 23, 24, 25, 26, and 27, respectively, in order of appearance)
ZF 1-2: N-DEANLRR, DPSVLKR, QSANLLR, DPSSLKR, QQTNLTR, ERRSLAR-C (SEQ ID NOS 22, 23, 24, 25, 26, and 28, respectively, in order of appearance)
ZF 1-3: N-EEANLRR, DHSSLKR, QSANLLR, DPSSLKR QQTNLTR, DATQLVR-C (SEQ ID NOS 29, 30, 24, 25, 26, and 27, respectively, in order of appearance)
ZF 1-4: N-EEANLRR, DHSSLKR, QSANLLR, DPSSLKR QQTNLTR, ERRSLAR-C (SEQ ID NOS 29, 30, 24, 25, 26, and 28, respectively, in order of appearance)
ZF 1-5: N-DEANLRR, DPSVLKR, QQTNLTR, ERRSLAR QQTNLTR, DATQLVR-C (SEQ ID NOS 22, 23, 26, 28, 26, and 27, respectively, in order of appearance)
ZF 1-6: N-DEANLRR, DPSVLKR, QQTNLTR, ERRSLAR QQTNLTR, ERRSLAR-C (SEQ ID NOS 22, 23, 26, 28, 26, and 28, respectively, in order of appearance)
ZF 1-7: N-EEANLRR, DHSSLKR, QQTNLTR, ERRSLAR QQTNLTR, DATQLVR-C (SEQ ID NOS 29, 30, 26, 28, 26, and 27, respectively, in order of appearance)
ZF 1-8: N-EEANLRR, DHSSLKR, QQTNLTR, ERRSLAR QQTNLTR, ERRSLAR-C (SEQ ID NOS 29, 30, 26, 28, 26, and 28, respectively, in order of appearance)

[0119] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 2 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 2 ZFA helix combo), are as follows:

ZF 2-1: N-QRSSLVR, DMGNLGR, RSHDLTR, HKSSLTR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 31, 32, 33, 34, 35, and 36, respectively, in order of appearance)
ZF 2-2: N-QKQALTR, DRGNLTR, RSHDLTR, HKSSLTR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 37, 38, 33, 34, 35, and 36, respectively, in order of appearance)
ZF 2-3: N-QRSSLVR, DMGNLGR, RSHDLTV, HKSSLTR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 31, 32, 39, 34, 35, and 36, respectively, in order of appearance)
ZF 2-4: N-QKQALTR, DRGNLTR, RSHDLTV, HKSSLTR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 37, 38, 39, 34, 35, and 36, respectively, in order of appearance)
ZF 2-5: N-QRSSLVR, DMGNLGR, RSHDLTR, HKSSLTR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 31, 32, 33, 34, 48, and 49, respectively, in order of appearance)
ZF 2-6: N-QKQALTR, DRGNLTR, RSHDLTR, HKSSLTR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 37, 38, 33, 34, 48, and 49, respectively, in order of appearance)
ZF 2-7: N-QRSSLVR, DMGNLGR, RSHDLTV, HKSSLTR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 31, 32, 39, 34, 48, and 49, respectively, in order of appearance)
ZF 2-8: N-QKQALTR, DRGNLTR, RSHDLTV, HKSSLTR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 37, 38, 39, 34, 48, and 49, respectively, in order of appearance)

[0120] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 3 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 3 ZFA helix combo), are as follows:

ZF 3-1: N-QRSSLVR, DKSVLAR, QRSSLVR, QTNNLGR, THAVLTR, DRGNLTR-C (SEQ ID NOS 31, 40, 31, 41, 42, and 38, respectively, in order of appearance)
ZF 3-2: N-QRSSLVR, DKSVLAR, QRSSLVR, QTNNLGR, TKSLLAR, DRGNLTR-C (SEQ ID NOS 31, 40, 31, 41, 43, and 38, respectively, in order of appearance)
ZF 3-3: N-QKQALDR, DTSVLNR, QRSSLVR, QTNNLGR, THAVLTR, DRGNLTR-C (SEQ ID NOS 44, 45, 31, 41, 42, and 38, respectively, in order of appearance)
ZF 3-4: N-QKQALDR, DTSVLNR, QRSSLVR, QTNNLGR, TKSLLAR, DRGNLTR-C (SEQ ID NOS 44, 45, 31, 41, 43, and 38, respectively, in order of appearance)
ZF 3-5: N-QRSSLVR, DKSVLAR, QRSSLVR, QTNNLGR, THAVLTR, DRGNLTR-C (SEQ ID NOS 31, 40, 31, 41, 42, and 38, respectively, in order of appearance)
ZF 3-6: N-QRSSLVR, DKSVLAR, QRSSLVR, QTNNLGR, TKSLLAR, DRGNLTR-C (SEQ ID NOS 31, 40, 31, 41, 43, and 38, respectively, in order of appearance)
ZF 3-7: N-QKQALDR, DTSVLNR, QRSSLVR, QTNNLGR, THAVLTR, DRGNLTR-C (SEQ ID NOS 44, 45, 31, 41, 42, and 38, respectively, in order of appearance)
ZF 3-8: N-QKQALDR, DTSVLNR, QRSSLVR, QTNNLGR, TKSLLAR, DRGNLTR-C (SEQ ID NOS 44, 45, 31, 41, 43, and 38, respectively, in order of appearance)

[0121] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 4 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 4 ZFA helix combo), are as follows:

ZF 4-1: N-QQTNLTR, QGTSLAR, VRHNLTR, DKSVLAR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 46, 47, 40, 35, and 36, respectively, in order of appearance)
ZF 4-2: N-QQTNLTR, QGTSLAR, VRHNLTR, DKSVLAR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 46, 47, 40, 48, and 49, respectively, in order of appearance)
ZF 4-3: N-QQTNLTR, QGTSLAR, VRHNLTR, DHSNLSR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 46, 47, 50, 35, and 36, respectively, in order of appearance)
ZF 4-4: N-QQTNLTR, QGTSLAR, VRHNLTR, DHSNLSR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 46, 47, 50, 48, and 49, respectively, in order of appearance)
ZF 4-5: N-QQTNLTR, QSTSLQR, VRHNLTR, DKSVLAR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 51, 47, 40, 35, and 36, respectively, in order of appearance)
ZF 4-6: N-QQTNLTR, QSTSLQR, VRHNLTR, DKSVLAR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 51, 47, 40, 48, and 49, respectively, in order of appearance)
ZF 4-7: N-QQTNLTR, QSTSLQR, VRHNLTR, DHSNLSR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 51, 47, 50, 35, and 36, respectively, in order of appearance)
ZF 4-8: N-QQTNLTR, QSTSLQR, VRHNLTR, DHSNLSR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 51, 47, 50, 48, and 49, respectively, in order of appearance)

[0122] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 5 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 5 ZFA helix combo), are as follows:

ZF 5-1: N-NMSNLTR, DRSVLRR, LQENLTR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 52, 53, 54, 55, 56, and 56, respectively, in order of appearance)
ZF 5-2: N-QLANLAR, DQTTLRR, LQENLTR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 57, 58, 54, 55, 56, and 56, respectively, in order of appearance)
ZF 5-3: N-NMSNLTR, DRSVLRR, DPSNLAR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 52, 53, 59, 55, 56, and 56, respectively, in order of appearance)
ZF 5-4: N-QLANLAR, DQTTLRR, DPSNLAR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 57, 58, 59, 55, 56, and 56, respectively, in order of appearance)
ZF 5-5: N-NMSNLTR, DRSVLRR, LQENLTR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 52, 53, 54, 55, 56, and 56, respectively, in order of appearance)
ZF 5-6: N-QLANLAR, DQTTLRR, LQENLTR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 57, 58, 54, 55, 56, and 56, respectively, in order of appearance)
ZF 5-7: N-NMSNLTR, DRSVLRR, DPSNLAR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 52, 53, 59, 55, 56, and 56, respectively, in order of appearance)
ZF 5-8: N-QLANLAR, DQTTLRR, DPSNLAR, DRSSLRR, QSGTLHR, QSGTLHR-C (SEQ ID NOS 57, 58, 59, 55, 56, and 56, respectively, in order of appearance)

[0123] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 6 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 6 ZFA helix combo), are as follows:

ZF 6-1: N-QQTNLTR, QGGNLAL, DHSSLKR, RADMLRR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 60, 30, 61, 35, and 36, respectively, in order of appearance)
ZF 6-2: N-QQTNLTR, QGGNLAL, DHSSLKR, RADMLRR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 60, 30, 61, 48, and 49, respectively, in order of appearance)
ZF 6-3: N-QQTNLTR, QKANLGV, DHSSLKR, RADMLRR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 62, 30, 61, 35, and 36, respectively, in order of appearance)
ZF 6-4: N-QQTNLTR, QKANLGV, DHSSLKR, RADMLRR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 62, 30, 61, 48, and 49, respectively, in order of appearance)
ZF 6-5: N-QQTNLTR, QGGNLAL, DHSSLKR, RLDMLAR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 60, 30, 63, 35, and 36, respectively, in order of appearance)
ZF 6-6: N-QQTNLTR, QGGNLAL, DHSSLKR, RLDMLAR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 60, 30, 63, 48, and 49, respectively, in order of appearance)
ZF 6-7: N-QQTNLTR, QKANLGV, DHSSLKR, RLDMLAR, DSSNLRR, DQGNLIR-C (SEQ ID NOS 26, 62, 30, 63, 35, and 36, respectively, in order of appearance)
ZF 6-8: N-QQTNLTR, QKANLGV, DHSSLKR, RLDMLAR, EKQNLAR, DPSNLRR-C (SEQ ID NOS 26, 62, 30, 63, 48, and 49, respectively, in order of appearance)

[0124] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 7 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 7 ZFA helix combo), are as follows:

ZF 7-1: N-QRSSLVR, QRGNLNM, RPQELRR, DHSSLKR, RQDNLGR, DGGNLGR-C (SEQ ID NOS 31, 64, 65, 30, 66, and 67, respectively, in order of appearance)
ZF 7-2: N-QRSSLVR, QQGNLQL, RPQELRR, DHSSLKR, RQDNLGR, DGGNLGR-C (SEQ ID NOS 31, 68, 65, 30, 66, and 67, respectively, in order of appearance)
ZF 7-3: N-QRSSLVR, QRGNLNM, RRQELTR, DHSSLKR, RQDNLGR, DGGNLGR-C (SEQ ID NOS 31, 64, 69, 30, 66, and 67, respectively, in order of appearance)
ZF 7-4: N-QRSSLVR, QQGNLQL, RRQELTR, DHSSLKR, RQDNLGR, DGGNLGR-C (SEQ ID NOS 31, 68, 69, 30, 66, and 67, respectively, in order of appearance)
ZF 7-5: N-QRSSLVR, QRGNLNM, RPQELRR, DHSSLKR, RQDNLGR, DPSNLRR-C (SEQ ID NOS 31, 64, 65, 30, 66, and 49, respectively, in order of appearance)
ZF 7-6: N-QRSSLVR, QQGNLQL, RPQELRR, DHSSLKR, RQDNLGR, DPSNLRR-C (SEQ ID NOS 31, 68, 65, 30, 66, and 49, respectively, in order of appearance)
ZF 7-7: N-QRSSLVR, QRGNLNM, RRQELTR, DHSSLKR, RQDNLGR, DPSNLRR-C (SEQ ID NOS 31, 64, 69, 30, 66, and 49, respectively, in order of appearance)
ZF 7-8: N-QRSSLVR, QQGNLQL, RRQELTR, DHSSLKR, RQDNLGR, DPSNLRR-C (SEQ ID NOS 31, 68, 69, 30, 66, and 49, respectively, in order of appearance)

[0125] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 8 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 8 ZFA helix combo), are as follows:

ZF 8-1: N-QASNLTR, DHSSLKR, RAHNLLL, QRSSLVR, QSTTLKR, DPSNLRR-C (SEQ ID NOS 70, 30, 71, 31, 72, and 49, respectively, in order of appearance)
ZF 8-2: N-QASNLTR, DHSSLKR, RAHNLLL, QRSSLVR, QGTTLKR, DPSNLRR-C (SEQ ID NOS 70, 30, 71, 31, 73, and 49, respectively, in order of appearance)
ZF 8-3: N-QRSNLAR, DHSSLKR, RAHNLLL, QRSSLVR, QSTTLKR, DPSNLRR-C (SEQ ID NOS 74, 30, 71, 31, 72, and 49, respectively, in order of appearance)
ZF 8-4: N-QRSNLAR, DHSSLKR, RAHNLLL, QRSSLVR, QGTTLKR, DPSNLRR-C (SEQ ID NOS 74, 30, 71, 31, 73, and 49, respectively, in order of appearance)

[0126] Non-limiting examples of the combinations and arrangements of six helices in a single six-finger ZFA where the helices are selected from Group 9 and where the motifs are in an NH.sub.2 to COOH terminus arrangement, (Group 9 ZFA helix combo), are as follows:

ZF 9-1: N-DSSNLRR, DQGNLIR, RAHNLLL, QRSSLVR, QSTTLKR, DPSNLRR-C (SEQ ID NOS 35, 36, 71, 31, 72, and 49, respectively, in order of appearance)
ZF 9-2: N-EKQNLAR, DPSNLRR, RAHNLLL, QRSSLVR, QSTTLKR, DPSNLRR-C (SEQ ID NOS 48, 49, 71, 31, 72, and 49, respectively, in order of appearance)
ZF 9-3: N-DSSNLRR, DQGNLIR, RAHNLLL, QRSSLVR, QGTTLKR, DPSNLRR-C (SEQ ID NOS 35, 36, 71, 31, 73, and 49, respectively, in order of appearance)
ZF 9-4: N-EKQNLAR, DPSNLRR, RAHNLLL, QRSSLVR, QGTTLKR, DPSNLRR-C (SEQ ID NOS 48, 49, 71, 31, 73, and 49, respectively, in order of appearance)

[0127] A non-limiting example of the combination and arrangement of six helices in a single six-finger ZFA where the helices are selected from Group 10 and where the motif are in an NH.sub.2 to COOH terminus arrangement, (Group 10 ZFA helix combo), is as follows:

ZF 10-1: N-RRHGLDR, DHSSLKR, VRHNLTR, DHSNLSR, QRSSLVR, ESGHLKR-C (SEQ ID NOS 75, 30, 47, 50, 31, and 76, respectively, in order of appearance)

[0128] A non-limiting example of the combination and arrangement of six helices in a single six-finger ZFA where the helices are selected from Group 11 and where the motif are in an NH.sub.2 to COOH terminus arrangement, (Group 11 ZFA helix combo), is as follows:

ZF 11-1: N-QLSNLTR, DRSSLKR, QRSSLVR, RLDMLAR, VRHSLTR, ESGALRR-C (SEQ ID NOS 77, 78, 31, 63, 79, and 80, respectively, in order of appearance)

[0129] Accordingly, provided herein, in some aspects, are engineered synTF or ZF-containing fusion proteins described herein comprising a ZF protein domain and an effector domain, or comprising a ZF protein domain, an effector domain, and a ligand binding domain, or comprising a ZF protein domain and a ligand binding domain or a dimerization domain, wherein the ZF protein domain comprises at least one ZFA having the ZFA helix combo selected from one of the ZFA helix combo Groups 1-11 disclosed herein. Where there are two or more ZFAs, (i.e., a ZF array) in the ZF protein domain, each ZFAs in the domain has a ZFA helix combo selected from one of the ZFA helix combo Groups 1-11 disclosed herein, and the selected ZFA helix combo groups can be different or duplicated for the each ZFAs in the ZF protein domain of the synTF. For example, when a synTF comprises a ZF protein domain consisting essentially of three ZFAs (ZFA-1-ZFA-2-ZFA-3 in a three-ZFA array) and an effector domain, ZFA-1 has a ZFA helix combo selected from the Group 1 ZFA helix combo, ZFA-2 has a ZFA helix combo selected from the Group 5 ZFA helix combo, and ZFA-3 has a ZFA helix combo selected from the Group 7 ZFA helix combo. In other embodiments, the selected ZFA helix combo groups can be duplicated or triplicated for the ZF array in the synTF. For example, in a three-ZFA array-containing ZF protein domain of a synTF, two of the ZFAs comprises ZFA helix combo selected from the same ZFA helix combo group, e.g., Group 2, and the third ZFA has a ZFA helix combo selected from a different ZFA helix combo group, e.g., Group 4. The two ZFAs having ZFA helix combos selected from the same Group 2 ZFA helix combo can have different or the same actual combination and arrangement of the helices ZFAs. For example, when the synTF comprises of a ZF protein domain consisting essentially of five ZFAs (ZFA-1-ZFA-2-ZFA-3-ZFA-4-ZFA-5 in a five-ZFA array) and an effector domain, ZFA-1 has a ZFA helix combo selected from the Group 1 ZFA helix combo, ZFA-2 has a ZFA helix combo selected from the Group 5 ZFA helix combo, ZFA-3 has a ZFA helix combo also selected from the Group 1 ZFA helix combo, ZFA-4 has a ZFA helix combo selected from the Group 4 ZFA helix combo, and ZFA-5 has a ZFA helix combo selected from the Group 2 ZFA helix combo. While ZFA-1 and ZFA-3 both have ZFA helix combo selected from the Group 1 ZFA helix combo, the actual combination and arrangement of the helices within ZFA-1 and ZFA-3 can be different or the same. For example, ZFA-1 and ZFA-3 have the ZFA helix combo ZF 1-1 and ZF 1-5 respectively, or both ZFA-1 and ZFA-3 have the ZFA helix combo ZF 1-1.

[0130] In other aspects, provided herein are engineered synTF or a ZF-containing fusion protein described herein comprising a ZF protein domain and an effector domain, or comprising a ZF protein domain, an effector domain, and a ligand binding domain, or comprising a ZF protein domain and a ligand binding domain or a dimerization domain, wherein the ZF protein domain comprises at least one ZFA having a ZFA helix combo selected from the group consisting of ZF 1-1, ZF 1-2, ZF 1-3, ZF 1-4, ZF 1-5, ZF 1-6, ZF 1-7, ZF 1-8, ZF 2-1, ZF 2-2, ZF 2-3, ZF 2-4, ZF 2-5, ZF 2-6, ZF 2-7, ZF 2-8, ZF 3-1, ZF 3-2, ZF 3-3, ZF 3-4, ZF 3-5, ZF 3-6, ZF 3-7, ZF 3-8, ZF 4-1, ZF 4-2, ZF 4-3, ZF 4-4, ZF 4-5, ZF 4-6, ZF 4-7, ZF 4-8, ZF 5-1, ZF 5-2, ZF 5-3, ZF 5-4, ZF 5-5, ZF 5-6, ZF 5-7, ZF 5-8, ZF 6-1, ZF 6-2, ZF 6-3, ZF 6-4, ZF 6-5, ZF 6-6, ZF 6-7, ZF 6-8, ZF 7-1, ZF 7-2, ZF 7-3,ZF 7-4, ZF 7-5, ZF 7-6, ZF 7-7, ZF 7-8, ZF 8-1, ZF 8-2, ZF 8-3, ZF 8-4, ZF 9-1, ZF 9-2, ZF 9-3, ZF 9-4, ZF 10-1, and ZF 11-1 disclosed herein.

[0131] In some embodiments of any aspect described herein, in the synTF described or any ZF-containing fusion protein described herein, the individual ZFA therein described are specifically designed to bind orthogonal target DNA sequences such as the following:

TABLE-US-00002 Target1: (SEQIDNO:81) 5 CGTCGAAGTCGAAGTCGACC3 Target2: (SEQIDNO:82) 5 GGACGACGTTACGGACGTAC3 Target3: (SEQIDNO:83) 5 AGACGTCGAAGTAGCCGTAG3 Target4: (SEQIDNO:84) 5 GGACGACGCCGATGTAGAAG3 Target5: (SEQIDNO:85) 5 TGAAGCAGTCGACGCCGAAG3 Target6: (SEQIDNO:86) 5 GGACGACGCGGTCTAAGAAG3 Target7: (SEQIDNO:87) 5 CGACGAGGTCGCATAAGTAG3 Target8: (SEQIDNO:88) 5 AGACGCAGTATAGGTCGAAC3 Target9: (SEQIDNO:89) 5 AGACGCAGTATAGGACGACG3 Target10: (SEQIDNO:90) 5 CGGCGTAGCCGATGTCGCGC3 Target11: (SEQIDNO:91) 5 GGTCGTTGCGGTAGTCGAAG3

[0132] In one embodiment of any aspect described herein, provided herein is a ZFA that comprises, consists of, or consist essentially of a sequence: N-[(formula II)-L.sub.2].sub.6-8-C or a sequence N-[(formula III)-L.sub.2].sub.6-8-C that targets a target DNA sequence selected from Target 1-11, wherein the formula II is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19) and the formula III is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20).

[0133] In other aspects, provided herein are engineered synTF or the ZF containing fusion protein described herein comprising a ZF protein domain and an effector domain, or comprising a ZF protein domain, an effector domain, and a ligand binding domain, or comprising a ZF protein domain and a ligand binding domain or a dimerization domain, wherein the ZF protein domain comprises at least one ZFA, wherein the an least ZFA comprises, consists of, or consist essentially of a sequence: N-[(formula II)-L.sub.2].sub.6-8-C or a sequence N-[(formula III)-L.sub.2].sub.6-8-C, and wherein the ZFA(s) therein targets a target DNA sequence selected from Target 1-11, wherein the formula II is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H](SEQ ID NO: 19) and the formula III is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20).

[0134] In one embodiment of any aspect described herein, in the synTF described or the ZF-containing fusion protein described herein, the effector domain is a transcription activating domain or a transcription repressor domain. For example, the effector domain is selected from the group consisting of a Herpes Simplex Virus Protein 16 (VP16) activation domain; an activation domain consisting of four tandem copies of VP16, a VP64 activation domain; a p65 activation domain of NFB; an Epstein-Barr virus R transactivator (Rta) activation domain; a tripartite activator consisting of the VP64, the p65, and the Rta activation domains, the tripartite activator is known as a VPR activation domain; a histone acetyltransferase (HAT) core domain of the human E1A-associated protein p300, known as a p300 HAT core activation domain; a Krppel associated box (KRAB) repression domain; a Repressor Element Silencing Transcription Factor (REST) repression domain; a WRPW motif of the hairy-related basic helix-loop-helix repressor proteins, the motif is known as a WRPW repression domain; a DNA (cytosine-5)-methyltransferase 3B (DNMT3B) repression domain; and an HP1 alpha chromoshadow repression domain.

[0135] In another embodiment of any aspect described herein, in the synTF described or the ZF-containing fusion protein described herein, the effector domain is an epigenetic effector domain. For example, at least one ZF protein domain is fused to one or more chromatin regulating enzymes that (1) catalyze chemical modifications of DNA or histone residues (e.g. DNA methyltransferases, histone methyltransferases, histone acetyltransferases) or (2) remove chemical modifications (e.g. DNA demethylases, DNA di-oxygenases, DNA hydroxylases, histone demethylases, histone deacetylases). For example, a DNA methyltransferase DNMT (DNMT1, DNMT3) catalyzes the transfer of methyl group to cytosine, which typically results in transcriptional repression through the recruitment of repressive regulatory proteins. Another example is CBP/p300 histone acetyltransferase, which is typically associated with transcriptional activation through the interactions with multiple transcription factors. Related epigenetic effector domains associated with the deposition of biochemical marks on DNA or histone residue(s) include HAT1, GCN5, PCAF, MLL, SET, DOT1, SUV39H, G9a, KAT2A/B and EZH1/2. Related epigenetic effector domains associated with the removal of biochemical marks from DNA or histone residue(s) include TET1/2, SIRT family, LSD1, and KDM family.

[0136] In some embodiments of any aspect described herein, in the synTF described or the ZF-containing fusion protein described herein, all the helices within a ZFA are linked by peptide linkers (L.sub.2) having four to six amino acid residues.

[0137] In some embodiments of any aspect described herein, in the synTF described or the ZF-containing fusion protein described herein, all the helices within an individual ZFA are linked by rigid peptide linkers such as TGEKP (SEQ ID NO: 2) or TGSKP (SEQ ID NO: 92) or TGQKP (SEQ ID NO: 93) or TGGKP (SEQ ID NO: 94). The rigid linker aids in conferring synergistic binding of the ZF motifs to its target DNA sequence.

[0138] In one embodiment of any aspect described herein, in the synTF described or the ZF containing fusion protein described herein, the (L.sub.1) or (L.sub.2) is a flexible linker. Non-limiting examples include: TGSQKP (SEQ ID NO: 3) and TGGGEKP (SEQ ID NO: 1). In one embodiment, the linker flexible peptide is 1-20 amino acids long. The flexible linker aid in weakening cooperativity between adjacent ZF motifs.

[0139] In one embodiment of any aspect described herein, in the synTF described or the ZF containing fusion protein described herein, the (L1) or (L2) is a rigid linker. Non-limiting examples include: TGEKP (SEQ ID NO: 2), TGSKP (SEQ ID NO: 92), TGQKP (SEQ ID NO: 93) and TGGKP (SEQ ID NO: 94).

[0140] In some embodiments of any aspect described herein, in the synTF described or the ZF containing fusion protein described herein, where there are two or more ZFAs, the individual ZFAs are linked by flexible peptide linkers, such as TGSQKP (SEQ ID NO: 3). In another embodiment, the ZFAs are linked by chemical crosslinkers. Chemical crosslinkers are known in the art.

[0141] In some embodiments of any aspect described herein, in the synTF described or the ZF containing fusion protein described herein, all the helices within an individual ZFA are linked by a combination of rigid peptide linkers and flexible peptide linkers. See FIG. 5 for examples of rigid peptide linkers and flexible peptide linkers in a single ZFA. In FIG. 5, the rigid peptide linkers and flexible peptide linkers are used alternatingly to connect the fingers.

[0142] Additionally, provided herein, in some aspects, are compositions comprising any one or more of the engineered, ZF-containing synthetic transcription factors (synTFs) described herein or the ZF containing fusion protein described herein, the synTF comprising a DNA binding zinc finger containing protein domain (ZF protein domain) and an effector domain, or comprising a ZF protein domain, an effector domain, and a ligand binding domain, or comprising a ZF protein domain and a ligand binding domain or a dimerization domain, wherein the ZF protein domain comprises at least one ZFA.

[0143] In one embodiment of the synTF or compositions described, the synTF has a formula I: [DNA-binding zinc finger protein domain]-[effector domain]. In one embodiment of the synTF or compositions described, the synTF has a formula IV: [effector domain]-[DNA-binding zinc finger protein domain].

[0144] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of a sequence: N-[(formula II)-L.sub.2].sub.6-8-C wherein the formula II is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19), wherein X is any amino acid, the subscript numbers indicate the possible number of amino acid residues, C is cysteine, H is histidine, and (helix) is a-six contiguous amino acid residue peptide that forms a short alpha helix. In one embodiment of the synTF, the at least one ZFA therein comprises, consists of, or consist essentially of a sequence: N-[(formula III)-L.sub.2].sub.6-8-C wherein the formula III is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20), wherein X is any amino acid, the subscript numbers indicate the possible number of amino acid residues, C is cysteine, H is histidine, and (helix) is a-six contiguous amino acid residue peptide that forms a short alpha helix.

[0145] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein targets (ie. binds and interact with) a target DNA sequence selected from Target 1-11.

[0146] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of a ZFA helix combo selected from the group consisting of ZF 1-1, ZF 1-2, ZF 1-3, ZF 1-4, ZF 1-5, ZF 1-6, ZF 1-7, ZF 1-8, ZF 2-1, ZF 2-2, ZF 2-3, ZF 2-4, ZF 2-5, ZF 2-6, ZF 2-7, ZF 2-8, ZF 3-1, ZF 3-2, ZF 3-3, ZF 3-4, ZF 3-5, ZF 3-6, ZF 3-7, ZF 3-8, ZF 4-1, ZF 4-2, ZF 4-3, ZF 4-4, ZF 4-5, ZF 4-6, ZF 4-7, ZF 4-8, ZF 5-1, ZF 5-2, ZF 5-3, ZF 5-4, ZF 5-5, ZF 5-6, ZF 5-7, ZF 5-8, ZF 6-1, ZF 6-2, ZF 6-3, ZF 6-4, ZF 6-5, ZF 6-6, ZF 6-7, ZF 6-8, ZF 7-1, ZF 7-2, ZF 7-3,ZF 7-4, ZF 7-5, ZF 7-6, ZF 7-7, ZF 7-8, ZF 8-1, ZF 8-2, ZF 8-3, ZF 8-4, ZF 9-1, ZF 9-2, ZF 9-3, ZF 9-4, ZF 10-1, and ZF 11-1 disclosed herein.

[0147] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo selected from one of the ZFA helix combo Groups 1-11 disclosed herein.

[0148] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the six contiguous amino acid residue peptide sequences disclosed in one of the following Groups 1-11.

[0149] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 1-3: EEANLRR (SEQ ID NO: 29), DHSSLKR (SEQ ID NO: 30), QSANLLR (SEQ ID NO: 24), DPSSLKR (SEQ ID NO: 25), QQTNLTR (SEQ ID NO: 26), DATQLVR (SEQ ID NO: 27) from Group 1, and the at least one ZFA specifically binds the DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ. ID. NO: 81).

[0150] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 1-1, ZF 1-2, ZF 1-3, ZF 1-4, ZF 1-5, ZF 1-6, ZF 1-7, or ZF 1-8 selected from Group 1 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ. ID. NO: 81).

[0151] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the Zf motif helices selected from helices disclosed in Group 1, and the at least one ZFA specifically binds the DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ. ID. NO: 81).

[0152] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 2-6: QKQALTR (SEQ ID NO: 37), DRGNLTR, (SEQ ID NO: 38) RSHDLTR (SEQ ID NO: 33), HKSSLTR (SEQ ID NO: 34), EKQNLAR (SEQ ID NO: 48), DPSNLRR (SEQ ID NO: 49) from Group 2, and the at least one ZFA specifically binds the DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ. ID. NO: 82).

[0153] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 2-1, ZF 2-2, ZF 2-3, ZF 2-4, ZF 2-5, ZF 2-6, ZF 2-7, or ZF 2-8 selected from Group 2 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ. ID. NO: 82).

[0154] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 2, and the at least one ZFA specifically binds the DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ. ID. NO: 82).

[0155] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 3-5: QRSSLVR (SEQ ID NO: 31), DKSVLAR (SEQ ID NO: 40), QRSSLVR (SEQ ID NO: 31), QTNNLGR (SEQ ID NO: 41), THAVLTR (SEQ ID NO: 42), DRGNLTR (SEQ ID NO: 38) from Group 3, and the at least one ZFA specifically binds the DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ. ID. NO: 83).

[0156] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 3-1, ZF 3-2, ZF 3-3, ZF 3-4, ZF 3-5, ZF 3-6, ZF 3-7, or ZF 3-8, selected from Group 3 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ. ID. NO: 83).

[0157] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices disclosed in Group 3, and the at least one ZFA specifically binds the DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ. ID. NO: 83).

[0158] In one embodiment of the synTF, or the ZF-containing fusion protein described herein or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 4-8: QQTNLTR (SEQ ID NO: 26), QSTSLQR (SEQ ID NO: 51), VRHNLTR (SEQ ID NO: 47), DHSNLSR (SEQ ID NO: 50), EKQNLAR (SEQ ID NO: 48), DPSNLRR (SEQ ID NO: 49) from Group 4, and the at least one ZFA specifically binds the DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ. ID. NO: 84).

[0159] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 4-1, ZF 4-2, ZF 4-3, ZF 4-4, ZF 4-5, ZF 4-6, ZF 4-7, or ZF 4-8, selected from Group 4 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ. ID. NO: 84).

[0160] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 4, and the at least one ZFA specifically binds the DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ. ID. NO: 84).

[0161] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 5-7: NMSNLTR (SEQ ID NO: 52), DRSVLRR (SEQ ID NO: 53), DPSNLAR (SEQ ID NO: 59), DRSSLRR (SEQ ID NO: 55), QSGTLHR (SEQ ID NO: 56), QSGTLHR (SEQ ID NO: 56) from Group 5, and the at least one ZFA specifically binds the DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ. ID. NO: 85).

[0162] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 5-1, ZF 5-2, ZF 5-3, ZF 5-4, ZF 5-5, ZF 5-6, ZF 5-7, or ZF 5-8, selected from Group 5 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ. ID. NO: 85).

[0163] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 5, and the at least one ZFA specifically binds the DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ. ID. NO: 85).

[0164] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 6-4: QQTNLTR (SEQ ID NO: 26), QKANLGV (SEQ ID NO: 62), DHSSLKR (SEQ ID NO: 30), RADMLRR (SEQ ID NO: 61), EKQNLAR (SEQ ID NO: 48), DPSNLRR (SEQ ID NO: 49) from Group 6, and the at least one ZFA specifically binds the DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ. ID. NO: 86).

[0165] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 6-1, ZF 6-2, ZF 6-3, ZF 6-4, ZF 6-5, ZF 6-6, ZF 6-7, or ZF 6-8, selected from Group 6 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ. ID. NO: 86).

[0166] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 6, and the at least one ZFA specifically binds the DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ. ID. NO: 86).

[0167] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 7-3: QRSSLVR (SEQ ID NO: 31), QRGNLNM (SEQ ID NO: 64), RRQELTR (SEQ ID NO: 69), DHSSLKR (SEQ ID NO: 30), RQDNLGR (SEQ ID NO: 66), DGGNLGR (SEQ ID NO: 67) from Group 7, and the at least one ZFA specifically binds the DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ. ID. NO: 87).

[0168] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 7-1, ZF 7-2, ZF 7-3,ZF 7-4, ZF 7-5, ZF 7-6, ZF 7-7, or ZF 7-8, selected from Group 7 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ. ID. NO: 87).

[0169] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected the helices disclosed in Group 7, and the at least one ZFA specifically binds the DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ. ID. NO: 87).

[0170] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 8-1: QASNLTR (SEQ ID NO: 70), DHSSLKR (SEQ ID NO: 30), RAHNLLL (SEQ ID NO: 71), QRSSLVR (SEQ ID NO: 31), QSTTLKR (SEQ ID NO: 72), DPSNLRR (SEQ ID NO: 49), from Group 8, and the at least one ZFA specifically binds the DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ. ID. NO: 88).

[0171] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 8-1, ZF 8-2, ZF 8-3, or ZF 8-4, selected from Group 8 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ. ID. NO: 88).

[0172] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 8, and the at least one ZFA specifically binds the DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ. ID. NO: 88).

[0173] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 9-2: EKQNLAR (SEQ ID NO: 48), DPSNLRR (SEQ ID NO: 49), RAHNLLL (SEQ ID NO: 71), QRSSLVR (SEQ ID NO: 31), QSTTLKR (SEQ ID NO: 72), DPSNLRR (SEQ ID NO: 49) from Group 9, and the at least one ZFA specifically binds the DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ. ID. NO: 89).

[0174] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 9-1, ZF 9-2, ZF 9-3, or ZF 9-4, selected from Group 9 ZFA helix combo, and the at least one ZFA specifically binds the DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ. ID. NO: 89).

[0175] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 9, and the at least one ZFA specifically binds the DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ. ID. NO: 89).

[0176] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 10-1: RRHGLDR (SEQ ID NO: 75), DHSSLKR (SEQ ID NO: 30), VRHNLTR (SEQ ID NO: 47), DHSNLSR (SEQ ID NO: 50), QRSSLVR (SEQ ID NO: 31), ESGHLKR (SEQ ID NO: 76) from Group 10, and the at least one ZFA specifically binds the DNA sequence Target 10: 5 C GGC GTA GCC GAT GTC GCG C 3 (SEQ. ID. NO: 90).

[0177] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 11-1: QLSNLTR (SEQ ID NO: 77), DRSSLKR (SEQ ID NO: 78), QRSSLVR (SEQ ID NO: 31), RLDMLAR (SEQ ID NO: 63), VRHSLTR (SEQ ID NO: 79), ESGALRR (SEQ ID NO: 80), from Group 11, and the at least one ZFA specifically binds the DNA sequence Target 11: 5 G GTC GTT GCG GTA GTC GAA G 3 (SEQ. ID. NO: 91).

[0178] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein comprises, consists of, or consist essentially of a sequence: N-PGERPFQCRICMRNFS-(Helix 1)-HTRTHTGEKPFQCRICMRNFS-(Helix 2)-HLRTHTGSQK PFQCRICMRNFS-(Helix 3)-HTRTHTGEK PFQCRICMRNFS-(Helix 4)-HLRTHTGSQKPFQCRICMRNFS-(Helix 5)-HTRTHTGEK PFQCRICMRNFS-(Helix 6)-HLRTHLR-C (SEQ ID NO: 21), wherein the (Helix) is a-six contiguous amino acid residue peptide that forms a short alpha helix. In one embodiment, the (Helix) is selected from those helices disclosed in groups 1-11.

[0179] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the at least one ZFA therein of the ZF protein domain is a six-finger ZFA, a seven-finger ZFA or an eight-finger ZFA. Where there are more than one ZFA making up the ZF protein domain, the ZF protein domain may comprise of a combination of a six-finger ZFA, a seven-finger ZFA and an eight-finger ZFA, or comprise of all six-finger ZFAs, or comprise of all seven-finger ZFAs, or comprise of all eight-finger ZFAs.

[0180] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain is located at the N-terminus of the synTF, ie., attached to the N-terminus of the ZF protein domain. In another embodiment, the effector domain is located at the C-terminus of the synTF, ie., attached to the C-terminus of the ZF protein domain.

[0181] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the ligand binding domain or the protein interaction domain/dimerization domain is located at the N-terminus of the ZF protein domain. In another embodiment, the ligand binding domain or the protein interaction domain/dimerization domain is located at the C-terminus of the ZF protein domain.

[0182] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain is a transcription activating domain or a transcription repressor domain or an epigenetic effector domain.

[0183] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain of the synTF is the VP64 activation domain comprising the sequence: GRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDML (SEQ. ID. NO: 95).

[0184] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain of the synTF is the p65 activation domain of NFB comprising the sequence:

TABLE-US-00003 (SEQ.ID.NO:96) DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPV PVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDP AVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRP PDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS.

[0185] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain of the synTF is the p300 HAT Core activation domain comprising the sequence: IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQE PWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLC CYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDP ELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRV NDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGV DLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTG HIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTS AKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKS SLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDG RDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQD (SEQ. ID. NO: 147). The nucleic acid sequence is known in the art and is SEQ. ID. NO: 131 of this present patent application.

[0186] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain of the synTF is the KRAB repressive domain comprising the sequence:

TABLE-US-00004 (SEQ.ID.NO:97) MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQILYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSV.

[0187] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain of the synTF is the HP1 alpha chromoshadow repressive domain comprising the sequence:

TABLE-US-00005 (SEQ.ID.NO:98) MKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVL AKEANVKCPQIVIAFYEERLTWHAYPEDAENKEK.

[0188] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the effector domain of the synTF is the DNMT3B repression domain comprising the sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYT QDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRN HVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQ GGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGM RWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSS PGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPENKTRRRTADDSATSDYCPAPKRLKTNC YNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELF YMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLP QRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKEL GIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNP ARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMID AIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKDLWLSCALHRRVQHGPW CPPEAAGKVLERACHPTPLRPSEGLLCM (SEQ. ID. NO: 148). The nucleic acid sequence is known in the art and is SEQ. ID. NO: 132 of this present patent application.

[0189] FIGS. 6A-6D show the general modular design of an engineered synTFs having a ZFA (having a six ZF motif) covalently linked to an effector domain such as a VP64 activation (FIG. 6A), a KRAB repressive domain (FIG. 6B), a HP1 repressive domain (FIG. 6C), and a p65 activation domain ((FIG. 6D).

[0190] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, where there are more than one ZFA, the ZFAs are connected covalently in tandem, N-terminus to C-terminus, into a ZFA array forming the ZF protein domain, and the ZF protein domain is covalently linked to the N-terminus or C-terminus of the effector domain.

[0191] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, where there is only one ZFA, the ZFA is covalently linked to the N-terminus or the C-terminus of the effector domain.

[0192] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the ZFA(s) and the effector domain are covalently linked by peptide linkers or by chemical crosslinkers.

[0193] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the peptide linkers are flexible or rigid peptide linkers.

[0194] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, the ZF motifs within a ZFA are covalently connected with peptide linkers. In one embodiment, the peptide linkers are flexible or rigid linkers. In one embodiment, a combination of flexible peptide and rigid peptide linkers are used in covalently connected the ZF motifs within a ZFA. In one embodiment, alternating flexible peptide and rigid peptide linkers are used to covalently connect the ZF motifs within a ZFA, as shown in FIGS. 5A, 5B, 6A-6D.

[0195] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, where there are more than one ZFA in the ZF protein domain, the peptide linkers connecting the ZFAs are rigid peptide linkers. In one embodiment, these rigid peptides are about 4-6 amino acid residues long. In one embodiment, these rigid peptides are selected from the group consisting of TGEKP (SEQ ID NO: 2), TGGKP (SEQ ID NO: 94), TGSKP (SEQ ID NO: 92), TGQKP (SEQ ID NO: 93), SGEKP (SEQ ID NO: 99), SGSKP (SEQ ID NO: 100), SGQKP (SEQ ID NO: 101), and SGGKP (SEQ ID NO: 102).

[0196] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, where there are more than one ZFA in the ZF protein domain, the peptide linkers connecting the ZFAs are flexible linkers. In one embodiment, the flexible linkers are peptide linkers. In one embodiment, the flexible peptide linkers at 1-20 amino acid residues long.

[0197] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, where there are more than one ZFA in the ZF protein domain, the peptide linkers connecting the ZFAs are flexible peptide linkers. In one embodiment, these flexible peptides are about 1-20 amino acid residues long. In one embodiment, the flexible peptide is about 1-20 amino acid residues long. In other embodiments, the flexible peptide is about 6, about 10, about 12, about 15, about 18, and about 20 amino acid residues long.

[0198] In one embodiment of the synTF, or the ZF-containing fusion protein described herein, or compositions described, where there are more than one ZFAs and the synTF in the ZF protein domain, the peptide linker connecting the ZF protein domain to the effector domain is a flexible peptide linker. In one embodiment, the flexible peptide is about 1-20 amino acid residues long. In other embodiments, the flexible peptide is about 6, about 10, about 12, about 15, about 18, and about 20 amino acid residues long.

[0199] Additionally, provided herein, in some aspects, are nucleic acid molecules or nucleic acid sequences encoding any one or more of the engineered, ZF-containing synthetic transcription factors (synTFs) described herein or the ZF-containing fusion protein described herein.

[0200] Additionally, provided herein, in some aspects, is a vector comprising nucleic acid sequence(s) encoding any one or more of the engineered, ZF-containing synTFs described herein or the ZF containing fusion protein described herein. For example, the vector facilitate the replication of the described nucleic acid sequence(s) in a cell and also enable the expression of the described synTF from the nucleic acid sequence(s) in a cell.

[0201] Additionally, provided herein, in some aspects, is a cell carrying a vector comprising nucleic acid sequence(s) encoding any one or more of the engineered, ZF-containing synthetic transcription factors (synTFs) described herein or the ZF-containing fusion protein described herein. For example, the cell facilitate the replication of the described vector comprising the nucleic acid sequence(s) in a cell and also enable the expression of the described synTF or the ZF containing fusion protein described herein from the nucleic acid sequence(s) in a cell. In one embodiment, the vector is a lentiviral vector or an adenoviral vector or a retroviral vector.

[0202] Engineered Responsive Promoters Having the Orthogonal Target DNA

[0203] Provided herein, in some aspects, are methods and assays to identify DNA sequences for zinc finger arrays that have reduced binding potential in a host genome.

[0204] In some aspects, provided herein are methods and assays for designing and constructing 6-finger ZFA, or 7-finger ZFA, or 8-finger ZFA capable of targeting the identified DNA sequences.

[0205] In some aspects, provided herein are methods and assays for designing and constructing synthetic transcription factors (synTFs): zinc finger arrays coupled to transcriptional effector domains (including VP64, p65, KRAB and HP1).

[0206] In some aspects, provided herein are methods and assays for designing and constructing partner synthetic promoters that pairs with the previously described synTFs to form an expression system. The partner synthetic promoters comprise zinc finger binding sites of different number placed upstream of minimal core promoters (e.g., minimal CMV promoter (minCMV), minimal thymidine kinase promoter (minTK)) or constitutive promoters (e.g. CMV promoter, Ubiquitin promoter).

[0207] Provided herein is a nucleic acid sequence comprising a DNA sequence element selected from the group consisting of: Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91). These DNA sequence elements are specially designed to be orthogonal to a eukaryotic genome. The orthogonal DNA sequence elements are also referred to as target DNA, target, target DNA sequence or target DNA sequence elements in the context of the synthetic transcription factor, and are used interchangeably. Moreover, these DNA sequence elements are specially designed to be recognized and bound specially by engineered synthetic transcription factors. When used together in vivo, these DNA sequence elements and their specially engineered synthetic transcription factors form the basic components of a regulatable, programmable gene expression system that allows the modulation of gene expression in vivo.

[0208] In one embodiment, this orthogonal nucleic acid sequence is part of an engineered responsive protomer or transcriptional unit, where the sequence is located upstream of the promoter sequence. Upstream as is conventionally used in the art means 5 of the promoter sequence.

[0209] In one embodiment, this orthogonal nucleic acid sequence is operably linked to the the promoter sequence to influence the transcription initiation when the orthogonal nucleic acid sequence is occupied by the described synTF having an effector domain.

[0210] Also provided herein is a vector comprising a nucleic acid sequence comprising a DNA sequence element selected from the group consisting of: Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91). The vector can comprise more than one of these DNA sequence elements. When there are more than one, the DNA sequence elements may be the same (ie, repeated) or different.

[0211] Additionally, provided herein is a cell comprising a vector comprising a nucleic acid sequence comprising a DNA sequence element selected from the group consisting of: Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91). The vector can comprise more than one of these DNA sequence elements. When there are more than one, the DNA sequence elements may be the same (ie, repeated) or different.

[0212] Described herein is the identification of orthogonal DNA target sequences and methods and assays for designing an array of ZFA, forming the ZF protein domain, which would be used in engineering the DNA binding and ZF-containing synTF described. A ZF protein domain comprises of one or a plurality of ZFA joined by a non-rigid linker (e.g., TGGGEKP (SEQ ID NO: 1). A ZFA is comprised of one or a plurality of ZF mofits joined by a rigid linker (e.g. TGEKP (SEQ ID NO: 2)) that have been pre-defined (e.g., via selection) to recognize DNA sequence elements and joined by a rigid linker.

[0213] Adjacent ZF motifs joined by rigid linkers (e.g. TGEKP (SEQ ID NO: 2)) have been demonstrated to have the capacity to bind their targets synergistically. In comparison, finger set's joined by flexible linkers (e.g. TGSQKP (SEQ ID NO: 3)) exhibit a lesser cooperativity. However, their flexibility permits greater context independence between ZFAs. Based upon this, it is inferred, without wishing to be bound or limited by theory, that the binding specificity of a ZF protein domain to be dominated by the recognition of the ZFAs for their individual ZFA specific target sites within the context permitted by the linkers joining ZFAs.

[0214] To identify orthogonal target DNA sequence element (DNA target) for the binding ZFA and ZF protein domain wherein the ZFA are designed to have reduced binding potential in a host genome, the following concepts and goals were considered: (step 1) Use ZF motifs that target DNA sequences that are known to under-represented DNA sequences in the eukaryotic host genome. Table 1 show some examples of 6 bp (6 mers) in human genome and their respective occurrences in the human genome calculated from GRCh37. This strategy aims at decreasing the number of individual ZF locations expected to dominate high affinity interactions. It also has the benefit of generally reducing the number of regions with a high degree of overall identity. (step 2) Pick DNA target sequences that are highly distinct from genomic sequence. These would preferentially have no identical in the host genome and few sites that share a high degree of identity. (step 3) Use DNA target sequences of ZF motifs where there are more than one ZF target sequences that are positioned such that the available amino acid in the ZFA linkers specifically enforce the distances between ZF targets. This minimizes the number of binding modalities that are tolerated and intrinsically increases the overall specificity profile. For example, the inventors looked for DNA target sequences of two 2-finger ZF motifs where the respective 2-finger ZF target sequences sites are immediately adjacent to each other. Then when these two 2-finger ZF motifs are covalently conjugated with a flexible linker such as TGSQKP, (SEQ ID NO: 3) the flexible linker would allow the two 2-finger ZF motifs to bind their respective ZF DNA target sequence that are immediately adjacent to each other. Alternatively, the inventors looked for DNA target sequences of two 2-finger ZF motifs where the respective 2-finger ZF target sequences sites are separated by a single base. Here, when these two 2-finger ZF motifs are covalently conjugated with an amino acid linker TGGGGSQKP, (SEQ ID NO: 103) this linker would allow the two 2-finger ZF motifs to bind their respective ZF DNA target sequence that are either adjacent or separated by a single base pair.

[0215] The inventors have a library of 2-finger ZF motifs, which have been pre-selected to bind 6 bp DNA sequences, these are the target DNA sequences, target with reference to the ZF motifs binding. These are a priori known. Then, the inventors screen and identify which of these known target sequences for these 2-finger units are the most underrepresented in the host genome. The inventors then combined three of the identified and selected 6 bp target sites that are the most underrepresented in the genome to arrive at a most orthogonal 18-bp DNA sequences. The combination of these underrepresented 2-finger unit sites would be predicted to (a) not occur in the host genome and (b) have the least possibility of having sub-sites lead to functional binding (i.e. most distant). The inventors then verified that these artificially created 18-20 bp target sites do not occur in the genome by scanning them against the genome sequences.

[0216] In some embodiments of the aspects described herein to identify DNA sequences for zinc finger arrays designed to have reduced binding potential in a host genome, the following method was employed: Target sequence are defined as 18 bp. Targets are represented by three 2-finger units (each 2-finger unit recognizes 6 bp), meaning targets are made up of three 6 bp (6 mers) DNA sequences. The three 6 bp for the three 2-finger units are immediately adjacent to each other, forming the 18 bp. Human genome is screened to determine the number of times each of the 6 bp DNA sequences for the respective 2-finger units occurs. The ones with rare or no occurrences are selected and used for combining together to form the 18 bp DNA target sequences for a corresponding three 2-finger units that make up a ZFA that would bind the 18 bp. All potential 18 bp sequences that can be made from these 6 bp sequence were generated.

[0217] In some embodiments, to pare down this large list while simultaneously enriching for sequences highly amenable to zinc finger binding/design, the list was filtered to meet one or more of the following conditions:

[0218] a) No single nucleotide could account for more than 35% of the sequence.

[0219] b) Sequence start with a G

[0220] c) Sequence does not end with two pyrimidines

[0221] d) The sequence must have no homo-polymers of 4 or more nucleotides

[0222] e) Not stretch of TTT

[0223] f) Sequence comprise at least 5 GNNs individual zinc finger targets

[0224] g) Sequence comprises at least 10 purines.

[0225] Human genome is screened to determine the number of times each 6 bp site occurs.

[0226] All 18 bp DNA sequences from step 2 were scored according to the product of the propensity of the three 6 bp ZF motif target sites to occur in the human genome.

[0227] An initial set of sequences with low probability scores of occurring naturally were selected also considering complexity and distinctness from each other. This was done by ranking the sites according to their score and the manually screening the list starting with sequences with the lowest score.

[0228] For the 18 bp sequences selected in the previous step, a comprehensive analysis was done for each site against the human genome to identify all sites with an identity of 14-18 with the targets.

[0229] Sequences were expertly selected such that they had no exact matches or off by is and greatly fewer off by 2, 3 and 4 than other sites in the list.

[0230] Zinc fingers were designed according to established guidelines. For example, to optimize activity variants can be designed where the residues shown to make non-specific contacts with the DNA phosphate backbone could be altered to eliminate these non-specific interactions.

[0231] The orthogonal DNA target sequences were used as the starting set of eleven 20-bp target sites (6 triplets recognized by ZF helices+2 bp flanking) that were subsequently used to create responsive promoters. Accordingly, provided herein, in some aspects, are engineered responsive promoter elements comprising at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTT ACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91).

[0232] Engineered responsive promoter elements are regulatory sequence within or directly upstream of a promoter that is recognized by a transcriptional regulator (in this case our synTF).

[0233] Also provided herein, in some aspects, are engineered promoter comprising (a) at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and (b) a promoter.

[0234] In one embodiment of the engineered responsive promoter element or engineered promoter described, there is more than one target DNA sequence element. For example, there can be two, three, four, five, six, seven, eight, nine and up to ten target DNA sequence elements. The multiple target DNA sequence elements can be the same or different in the engineered responsive promoter element or engineered promoter.

[0235] In one embodiment of the engineered responsive promoter element or engineered promoter, where there are more than one target DNA sequence elements, the target DNA sequence elements are separated by nucleic acid spacers. In some embodiments, the nucleic acid spacers are about 4-10 bps long. In one embodiment, the nucleic acid spacers are no more than 6 bps long.

[0236] In one embodiment of the engineered responsive promoter described, the target DNA sequence element(s) is/are located and attached at the 5 end of promoter.

[0237] In one embodiment of the engineered responsive promoter described, the target DNA sequence element(s) and the minimum promoter are are separated by nucleic acid spacers. In some embodiments, the nucleic acid spacers are about 4-10 bps long. In one embodiment, the nucleic acid spacers are no more than 6 bps long.

[0238] FIG. 4A shows two embodiments of engineered responsive promoter elements comprising target DNA sequence elements (ie. 1 promoter), the top engineered responsive promoter element has one target DNA sequence element, and bottom engineered responsive promoter element has four target DNA sequence element (ie. 4 promoter). The described eleven 20-bp target DNA sequence element can be incorporated into responsive promoter architectures, and different DNA sequence elements can be used incorporated multiple times when there are more than one DNA sequence element in the engineered responsive promoter elements.

[0239] FIG. 4B shows an engineered responsive promoter comprising eight target DNA sequence elements and a full-length promoter. Such a promoter is useful for gene repression.

[0240] FIG. 4C shows an engineered responsive promoter comprising five target DNA sequence elements and a minimal promoter.

[0241] Also provided herein, in some aspects, are synthetic transcription unit comprising (a) at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91), (b) a promoter, and (c) at least a gene of interest (GOI), the least one target DNA sequence element is operably linked upstream of the promoter which is itself operably linked upstream of the (GOI).

[0242] In some embodiments of engineered responsive promoter described, the promoter described herein can be a full-length functional promoter or a minimal promoter having very limited or no transcription initiation therefrom absent the assistance of added transcription factors. Non-limiting examples of full-length functional promoters include CMV, UBCbc, EF1 alpha, SV40, PGK, CAG, beta actin, U6 and H1. Non-limiting examples of minimal promoters include minimal CMV, and minimal TK and any synthetically designed promoters composed of core minimal promoter elements and regulating enhancer elements (e.g. HSE, TRE, NFAT/AP-1 binding elements).

[0243] Also provided herein is a vector comprising an engineered responsive promoter elements comprising at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91).

[0244] Additionally, provided herein is a cell comprising a vector comprising an engineered responsive promoter elements comprising at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91).

[0245] Also provided herein is a vector comprising an engineered promoter comprising (a) at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and (b) a promoter, wherein the at least one target DNA sequence element is operably linked to the promoter.

[0246] Additionally, provided herein is a cell comprising a vector comprising an engineered promoter comprising (a) at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and (b) a promoter, wherein the at least one target DNA sequence element is operably linked to the promoter.

[0247] Also provided herein is a vector comprising a synthetic transcription unit comprising (a) at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91), (b) a promoter, and (c) at least a gene of interest (GOI), the least one target DNA sequence element is operably linked upstream to the promoter, and wherein the promoter is operably linked upstream to the GOI.

[0248] Additionally, provided herein is a cell comprising a vector comprising a synthetic transcription unit comprising (a) at least one target DNA sequence element selected from the group consisting of Target 1: 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91), (b) a promoter, and (c) at least a gene of interest (GOI), the least one target DNA sequence element is operably linked upstream to the promoter, and wherein the promoter is operably linked upstream to the GOI.

[0249] Engineered Regulatable Gene Expression Systems and Uses

[0250] Provided herein, in some aspects, is an engineered gene expression system for in vivo or in vitro regulation of the expression of an exogenous gene, comprising: a synthetic transcription factor (synTF) described herein and an engineered promoter described herein. The synTF comprises one or more Zinc-finger domain and an effector domain, wherein the Zn-finger domain is located N- or C-terminus of the effector domain. The engineered promoter comprises one or more orthogonal DNA target sequences and a promoter sequence described herein. The one or more orthogonal DNA target sequences are operably linked to the promoter. The orthogonal DNA target sequences enable the promoter to be responsive to the synTF. When the engineered promoter is operably linked linked upstream of a sequence coding a protein, (e.g. a gene), a synthetic transcription unit is thus formed. The Zn-finger domain of synTF are designed to binds the one or more orthogonal DNA target sequences of the synthetic transcription unit to modulate gene transcription and thus gene expression, namely, initiate gene transcription or repress gene transcription. The Zn-finger domain in the synTF consists a plurality of ZFA and the engineered promoter can contain a plurality of orthogonal DNA target sequences. A ZFA within the ZF protein domain of the synTF and a orthologus DNA target sequence form a specific interaction pairs such that the ZFA only binds a specific orthogonal DNA target sequence and not other orthologus DNA target sequences. In the system, in one embodiment, the number of ZFAs in the ZF protein domain on a synTF matches the number of orthologus DNA target sequences on the engineered promoter. In the system, in one embodiment, when there are a plurality of ZFA in the ZF protein domain in a synTF and a corresponding plurality number of orthologus DNA target sequences on the engineered promoter in the transcription unit, each ZFA in the synTF is arranged so that the ZFA domain binds corresponding orthologus DNA target sequence of its specific interaction pair. See FIGS. 4A, 9 and 10.

[0251] Provided herein, in some aspects, is a kit for regulating gene activation or repression comprising a vector comprising a synthetic transcription factor (synTF) described herein and a vector comprising an engineered promoter described herein.

[0252] Provided herein, in some aspects, is a method of regulating gene activation or repression comprising contacting a cell with an engineered gene expression system comprising a synthetic transcription factor (synTF) described herein and an engineered promoter described herein. In another aspect, provided herein is a method of regulating gene activation or repression comprising contacting a cell with a composition comprising one or more engineered synthetic transcription factors (synTFs) described herein and one or more corresponding engineered transcription units comprising the gene of interest.

[0253] In some aspects, provided herein are methods and assays to identify DNA sequences for zinc finger arrays that have reduced binding potential in a host genome.

[0254] In some aspects, provided herein are methods and assays for designing and constructing 6-finger ZFA or 7-finger ZFA or 8-finger ZFA containing ZF protein domains capable of targeting the identified DNA sequences.

[0255] In some aspects, provided herein are methods and assays for designing and constructing synthetic transcription factors (synTFs): zinc finger arrays coupled to transcriptional effector domains (including VP64, p65, KRAB and HP1). See FIGS. 6A-6D.

[0256] In some aspects, provided herein are methods and assays for designing and constructing partner synthetic responsive promoters: zinc finger binding sites of different number placed upstream of minimal crippled promoters (e.g., minCMV).

[0257] The present invention can be defined in any of the following numbered paragraphs: [0258] [1]. An engineered gene expression system for the in vivo or in vitro regulatable expression of an exogenous gene, the system comprising: [0259] a) an engineered zinc-finger-containing synthetic transcription factor (synTF) protein comprising two main domains: (i) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (ii) a second domain through which the synTF exerts its effect (effector domain), wherein the synTF having the formula I: [ZF protein domain]-[effector domain] or the formula IV: [effector domain]-[ZF protein domain], wherein the ZF protein domain is modular in design and is composed zinc finger arrays (ZFA), wherein there is one or more and up to ten ZFAs, wherein the ZFA comprising a sequence: N-[(formula II)-L.sub.2].sub.6-8-C, wherein formula II is that of a ZF motif and is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H], where the subscript 6-8 indicates the number of ZF motifs in a ZFA, the ZF motifs that are linked together by the linker L.sub.2, the L.sub.2 is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence, and [0260] b) an engineered responsive promoter comprising [0261] i). at least one orthogonal target DNA sequence element selected from the group consisting of 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-A GACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCG GTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and, [0262] ii). a promoter sequence, wherein the at least one target DNA sequence element is operably linked to the 5 end of the promoter sequence in order to influence transcription initiation of a nearby coding sequence, wherein the influence is to upregulate or downregulate transcription initiation, and wherein the gene is operably linked to the promoter in the engineered responsive promoter, wherein the ZFA of the synTF binds the at least one orthogonal target DNA sequence element in the engineered responsive promoter. [0263] [2]. The system of paragraph 1, wherein formula II is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20). [0264] [3]. The system of paragraph 1 or 2, wherein the sequences of all the helices of each ZFA are selected from within a group selected from the Groups 1-11. [0265] [4]. The system of any one of the preceeding paragraphs, wherein at least four of the helices in a ZFA are selected from the Groups 1-11. [0266] [5]. The system of any one of the preceeding paragraphs, wherein at least four of the helices in a ZF are selected from the same group, the group is selected from the Groups 1-11. [0267] [6]. The system of any one of the preceeding paragraphs, wherein all the helices within a ZFA of the synTF are linked by peptide linkers (L.sub.2) having four to six amino acid residues. [0268] [7]. The system of any one of the preceeding paragraphs, where there are a plurality of ZFAs, the ZFAs of the synTF are linked by peptides having 1-20 amino acid residues. [0269] [8]. The system of any one of the preceeding paragraph s, wherein the effector domain of the synTF is a transcription activating domain or a transcription repressor domain. [0270] [9]. The system of any one of the preceeding paragraph s, wherein the effector domain of the synTF is an epigenetic effector domain. [0271] [10]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from helices disclosed in Group 1, and the ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81). [0272] [11]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo: ZF 1-1, ZF 1-2, ZF 1-3, ZF 1-4, ZF 1-5, ZF 1-6, ZF 1-7, or ZF 1-8 selected from Group 1 ZFA helix combo, and the one ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81). [0273] [12]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 2, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82). [0274] [13]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 2-1, ZF 2-2, ZF 2-3, ZF 2-4, ZF 2-5, ZF 2-6, ZF 2-7, or ZF 2-8 selected from Group 2 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82). [0275] [14]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices disclosed in Group 3, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83). [0276] [15]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 3-1, ZF 3-2, ZF 3-3, ZF 3-4, ZF 3-5, ZF 3-6, ZF 3-7, or ZF 3-8, selected from Group 3 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83). [0277] [16]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 4, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84). [0278] [17]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 4-1, ZF 4-2, ZF 4-3, ZF 4-4, ZF 4-5, ZF 4-6, ZF 4-7, or ZF 4-8, selected from Group 4 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84). [0279] [18]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 5-1, ZF 5-2, ZF 5-3, ZF 5-4, ZF 5-5, ZF 5-6, ZF 5-7, or ZF 5-8, selected from Group 5 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85). [0280] [19]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 5, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85). [0281] [20]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 6-1, ZF 6-2, ZF 6-3, ZF 6-4, ZF 6-5, ZF 6-6, ZF 6-7, or ZF 6-8, selected from Group 6 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86). [0282] [21]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 6, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86). [0283] [22]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 7-1, ZF 7-2, ZF 7-3, ZF 7-4, ZF 7-5, ZF 7-6, ZF 7-7, or ZF 7-8, selected from Group 7 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87). [0284] [23]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected the helices disclosed in Group 7, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87). [0285] [24]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 8-1, ZF 8-2, ZF 8-3, or ZF 8-4, selected from Group 8 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88). [0286] [25]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 8, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88). [0287] [26]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 9-1, ZF 9-2, ZF 9-3, or ZF 9-4, selected from Group 9 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89). [0288] [27]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 9, and the ZFA specifically binds the orthogonal DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89). [0289] [28]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 10, from Group 10, and the at least one ZFA specifically binds the orthogonal DNA sequence Target 10: 5 C GGC GTA GCC GAT GTC GCG C 3 (SEQ ID NO: 90). [0290] [29]. The system of any one of the preceeding paragraphs, wherein the ZFA of the synTF comprises, consists of, or consist essentially of the ZFA helix combo, ZF 11-1, from Group 11, and the at least one ZFA specifically binds the orthogonal DNA sequence Target 11: 5 G GTC GTT GCG GTA GTC GAA G 3 (SEQ ID NO: 91). [0291] [30]. A method of regulating gene activation or repression comprising contacting a cell with an engineered gene expression system of any one of the preceeding claims. [0292] [31]. A kit for regulating gene activation or repression comprising an engineered expression system of any one of the preceeding claims. [0293] [32]. An engineered zinc-finger-containing synthetic transcription factor (synTF) protein comprising two main domains: (a) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (b) a second domain through which the synTF exerts its effect (effector domain), wherein the synTF having the formula I: [ZF protein domain]-[effector domain] or the formula IV: [effector domain]-[ZF protein domain], wherein the ZF protein domain is modular in design and is composed zinc finger arrays (ZFA), wherein there is one or more and up to ten ZFAs, wherein the ZFA comprising a sequence: N-[(formula II)-L.sub.2].sub.6-8-C, wherein formula II is that of a ZF motif and is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19), where the subscript 6-8 indicates the number of ZF motifs in a ZFA, the ZF motifs that are linked together by the linker L.sub.2, the L.sub.2 is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence. The protein optionally further comprises a ligand binding domain or a protein interaction/dimerization domain. [0294] [33]. The protein of paragraph 32, wherein formula II is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20). [0295] [34]. The protein of paragraph 32 or 33, wherein the sequences of all the helices of each ZFA are selected from within a group selected from the Groups 1-11. [0296] [35]. The protein of paragraph 32, 33 or 34, wherein at least four of the helices in a ZFA are selected from the Groups 1-11. [0297] [36]. The protein of any one of paragraphs 32-35, wherein at least four of the helices in a ZF are selected from the same group, selected from the Groups 1-11. [0298] [37]. The protein of any one of paragraphs 32-36, wherein the ZFA binds an orthogonal target DNA sequence selected from the group selected from:

TABLE-US-00006 a)Target1: (SEQIDNO:81) 5 CGTCGAAGTCGAAGTCGACC3, b)Target2: (SEQIDNO:82) 5 GGACGACGTTACGGACGTAC3, c)Target3: (SEQIDNO:83) 5 AGACGTCGAAGTAGCCGTAG3, d)Target4: (SEQIDNO:84) 5 GGACGACGCCGATGTAGAAG3, e)Target5: (SEQIDNO:85) 5 TGAAGCAGTCGACGCCGAAG3, f)Target6: (SEQIDNO:86) 5 GGACGACGCGGTCTAAGAAG3, g)Target7: (SEQIDNO:87) 5 CGACGAGGTCGCATAAGTAG3, h)Target8: (SEQIDNO:88) 5 AGACGCAGTATAGGTCGAAC3, i)Target9: (SEQIDNO:89) 5 AGACGCAGTATAGGACGACG3, j)Target10: (SEQIDNO:90) 5 CGGCGTAGCCGATGTCGCGC3 and, k)Target11: (SEQIDNO:91) 5 GGTCGTTGCGGTAGTCGAAG3. [0299] [38]. The protein of of any one of paragraphs 32-37, wherein all the helices within a ZFA are linked by peptide linkers (L.sub.2) having four to six amino acid residues. [0300] [39]. The protein of of any one of paragraphs 32-38, where there is a plurality of ZFAs, the ZFAs are linked by peptides having 1-20 amino acid residues. [0301] [40]. The protein of of any one of paragraphs 32-39, wherein the effector domain is a transcription activating domain or a transcription repressor domain. [0302] [41]. The protein of of any one of paragraphs 32-40, wherein the effector domain is an epigenetic effector domain. [0303] [42]. The protein of of any one of paragraphs 32-41, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from helices disclosed in Group 1, and the ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81). [0304] [43]. The protein of any one of paragraphs 32-42, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo: ZF 1-1, ZF 1-2, ZF 1-3, ZF 1-4, ZF 1-5, ZF 1-6, ZF 1-7, or ZF 1-8 selected from Group 1 ZFA helix combo, and the one ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81). [0305] [44]. The protein of any one of paragraphs 32-42, wherein the ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 2, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82). [0306] [45]. The protein of any one of paragraphs 32-44, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 2-1, ZF 2-2, ZF 2-3, ZF 2-4, ZF 2-5, ZF 2-6, ZF 2-7, or ZF 2-8 selected from Group 2 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82). [0307] [46]. The protein of any one of paragraphs 32-45, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices disclosed in Group 3, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83). [0308] [47]. The protein of any one of paragraphs 32-46, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 3-1, ZF 3-2, ZF 3-3, ZF 3-4, ZF 3-5, ZF 3-6, ZF 3-7, or ZF 3-8, selected from Group 3 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83). [0309] [48]. The protein of any one of paragraphs 32-47, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 4, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84). [0310] [49]. The protein of any one of paragraphs 32-48, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 4-1, ZF 4-2, ZF 4-3, ZF 4-4, ZF 4-5, ZF 4-6, ZF 4-7, or ZF 4-8, selected from Group 4 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84). [0311] [50]. The protein of any one of paragraphs 32-49, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 5-1, ZF 5-2, ZF 5-3, ZF 5-4, ZF 5-5, ZF 5-6, ZF 5-7, or ZF 5-8, selected from Group 5 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85). [0312] [51]. The protein of any one of paragraphs 32-50, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 5, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85). [0313] [52]. The protein of any one of paragraphs 32-51, wherein the ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 6-1, ZF 6-2, ZF 6-3, ZF 6-4, ZF 6-5, ZF 6-6, ZF 6-7, or ZF 6-8, selected from Group 6 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86). [0314] [53]. The protein of any one of paragraphs 32-52, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 6, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86). [0315] [54]. The protein of any one of paragraphs 32-53, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 7-1, ZF 7-2, ZF 7-3, ZF 7-4, ZF 7-5, ZF 7-6, ZF 7-7, or ZF 7-8, selected from Group 7 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87). [0316] [55]. The protein of any one of paragraphs 32-54, wherein the ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected the helices disclosed in Group 7, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87). [0317] [56]. The protein of any one of paragraphs 32-55, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 8-1, ZF 8-2, ZF 8-3, or ZF 8-4, selected from Group 8 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88). [0318] [57]. The protein of any one of paragraphs 32-56, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 8, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88). [0319] [58]. The protein of any one of paragraphs 32-57, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 9-1, ZF 9-2, ZF 9-3, or ZF 9-4, selected from Group 9 ZFA helix combo, and the ZFA specifically binds the DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89). [0320] [59]. The protein of any one of paragraphs 32-58, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 9, and the ZFA specifically binds the orthogonal DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89). [0321] [60]. The protein of any one of paragraphs 32-59, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 10, from Group 10, and the at least one ZFA specifically binds the DNA sequence Target 10: 5 C GGC GTA GCC GAT GTC GCG C 3 (SEQ ID NO: 90). [0322] [61]. The protein of any one of paragraphs 32-60, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 11-1, from Group 11, and the at least one ZFA specifically binds the orthogonal DNA sequence Target 11: 5 G GTC GTT GCG GTA GTC GAA G 3 (SEQ ID NO: 91). [0323] [62]. An engineered responsive promoter comprising (a) at least one target DNA sequence element selected from the group consisting of 5-CGTCGAAGTCGAAGTCGACC-3 (SEQ ID NO: 81), 5-GGACGACGTTACGGACGTAC-3 (SEQ ID NO: 82), 5-AGACGTCGAAGTAGCCGTAG-3 (SEQ ID NO: 83), 5-GGACGACGCCGATGTAGAAG-3 (SEQ ID NO: 84), 5-TGAAGCAGTCGACGCCGAAG-3 (SEQ ID NO: 85), 5-GGACGACGCGGTCTAAGAAG-3 (SEQ ID NO: 86), 5-CGACGAGGTCGCATAAGTAG-3 (SEQ ID NO: 87), 5-AGACGCAGTATAGGTCGAAC-3 (SEQ ID NO: 88), 5-AGACGCAGTATAGGACGACG-3 (SEQ ID NO: 89), 5-CGGCGTAGCCGATGTCGCGC-3 (SEQ ID NO: 90), and 5-GGTCGTTGCGGTAGTCGAAG-3 (SEQ ID NO: 91) and (b) a promoter sequence, wherein the at least one target DNA sequence element is operably linked 5 end of the promoter sequence in order to influence transcription initiation of a nearby coding sequence. [0324] [63]. The engineered promoter of paragraph 62 comprising at least one and up to ten target DNA sequence elements. [0325] [64]. The engineered promoter of paragraph 62 or 63, wherein the promoter is a full-length functional promoter or a minimal promoter. [0326] [65]. A kit for regulating gene activation or repression comprising a vector comprising nucleic acid for the expression of (a) a synthetic transcription factor (synTF) of paragraph 32-60 or ZF-containing fusion protein of paragraph 66-95, and (b) a vector comprising an engineered promoter of paragraph 61-64. [0327] [66]. An engineered zinc-finger-containing fusion protein comprising two main domains: (a) a first main domain which is a DNA-binding zinc finger protein domain (ZF protein domain), and (b) a second domain comprising a ligand binding domain or a protein interaction/dimerization domain, wherein the synTF having the configuration: [ZF protein domain]-[ligand binding domain or a protein interaction/dimerization domain] or the the configuration: [ligand binding domain or a protein interaction/dimerization domain]-[ZF protein domain], wherein the ZF protein domain is modular in design and is composed zinc finger arrays (ZFA), wherein there is one or more and up to ten ZFAs, wherein the ZFA comprising a sequence: N-[(formula II)-L2].sub.6-8-C, wherein formula II is that of a ZF motif and is [X.sub.0-3CX.sub.1-5CX.sub.2-7-(helix)-HX.sub.3-6H] (SEQ ID NO: 19), where the subscript 6-8 indicates the number of ZF motifs in a ZFA, the ZF motifs that are linked together by the linker L.sub.2, the L.sub.2 is a linker peptide having 4-6 amino acid residues, and the N- and C- indicates the N-terminus and C-terminus respectively of the peptide sequence. [0328] [67]. The protein of paragraph 66, wherein formula II is [X.sub.3CX.sub.2CX.sub.5-(helix)-HX.sub.3H] (SEQ ID NO: 20). [0329] [68]. The protein of paragraph 66 or 67, wherein the sequences of all the helices of each ZFA are selected from within a group selected from the Groups 1-11. [0330] [69]. The protein of paragraph 66, 67 or 68, wherein at least four of the helices in a ZFA are selected from the Groups 1-11. [0331] [70]. The protein of any one of paragraphs 66-69, wherein at least four of the helices in a ZF are selected from the same group, selected from the Groups 1-11. [0332] [71]. The protein of any one of paragraphs 66-70, wherein the ZFA binds an orthogonal target DNA sequence selected from the group selected from:

TABLE-US-00007 a)Target1: (SEQIDNO:81) 5 CGTCGAAGTCGAAGTCGACC3, b)Target2: (SEQIDNO:82) 5 GGACGACGTTACGGACGTAC3, c)Target3: (SEQIDNO:83) 5 AGACGTCGAAGTAGCCGTAG3, d)Target4: (SEQIDNO:84) 5 GGACGACGCCGATGTAGAAG3, e)Target5: (SEQIDNO:85) 5 TGAAGCAGTCGACGCCGAAG3, f)Target6: (SEQIDNO:86) 5 GGACGACGCGGTCTAAGAAG3, g)Target7: (SEQIDNO:87) 5 CGACGAGGTCGCATAAGTAG3, h)Target8: (SEQIDNO:88) 5 AGACGCAGTATAGGTCGAAC3, i)Target9: (SEQIDNO:89) 5 AGACGCAGTATAGGACGACG3, j)Target10: (SEQIDNO:90) 5 CGGCGTAGCCGATGTCGCGC3 and, k)Target11: (SEQIDNO:91) 5 GGTCGTTGCGGTAGTCGAAG3. [0333] [72]. The protein of of any one of paragraphs 66-72, wherein all the helices within a ZFA are linked by peptide linkers (L.sub.2) having four to six amino acid residues. [0334] [73]. The protein of of any one of paragraphs 66-72, where there is a plurality of ZFAs, the ZFAs are linked by peptides having 1-20 amino acid residues. [0335] [74]. The protein of of any one of paragraphs 66-73, wherein the ligand binding domain is a receptor ligand binding domain. [0336] [75]. The protein of of any one of paragraphs 74, wherein the ligand binding domain is an estrogen receptor ligand binding domain. [0337] [76]. The protein of of any one of paragraphs 66-75, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from helices disclosed in Group 1, and the ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81). [0338] [77]. The protein of any one of paragraphs 66-76, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo: ZF 1-1, ZF 1-2, ZF 1-3, ZF 1-4, ZF 1-5, ZF 1-6, ZF 1-7, or ZF 1-8 selected from Group 1 ZFA helix combo, and the one ZFA specifically binds the orthogonal DNA sequence Target 1: 5 C GTC GAA GTC GAA GTC GAC C 3 (SEQ ID NO: 81). [0339] [78]. The protein of any one of paragraphs 66-77, wherein the ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 2, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82). [0340] [79]. The protein of any one of paragraphs 66-78, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 2-1, ZF 2-2, ZF 2-3, ZF 2-4, ZF 2-5, ZF 2-6, ZF 2-7, or ZF 2-8 selected from Group 2 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 2: 5 G GAC GAC GTT ACG GAC GTA C 3 (SEQ ID NO: 82). [0341] [80]. The protein of any one of paragraphs 66-79, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices disclosed in Group 3, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83). [0342] [81]. The protein of any one of paragraphs 66-80, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 3-1, ZF 3-2, ZF 3-3, ZF 3-4, ZF 3-5, ZF 3-6, ZF 3-7, or ZF 3-8, selected from Group 3 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 3: 5 A GAC GTC GAA GTA GCC GTA G 3 (SEQ ID NO: 83). [0343] [82]. The protein of any one of paragraphs 66-81, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 4, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84). [0344] [83]. The protein of any one of paragraphs 66-82, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 4-1, ZF 4-2, ZF 4-3, ZF 4-4, ZF 4-5, ZF 4-6, ZF 4-7, or ZF 4-8, selected from Group 4 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 4: 5 G GAC GAC GCC GAT GTA GAA G 3 (SEQ ID NO: 84). [0345] [84]. The protein of any one of paragraphs 66-83, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 5-1, ZF 5-2, ZF 5-3, ZF 5-4, ZF 5-5, ZF 5-6, ZF 5-7, or ZF 5-8, selected from Group 5 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85). [0346] [85]. The protein of any one of paragraphs 66-84, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 5, and the ZFA specifically binds the orthogonal DNA sequence Target 5: 5 T GAA GCA GTC GAC GCC GAA G 3 (SEQ ID NO: 85). [0347] [86]. The protein of any one of paragraphs 66-85, wherein the ZFA therein comprises, consists of, or consist essentially of the ZFA helix combo, ZF 6-1, ZF 6-2, ZF 6-3, ZF 6-4, ZF 6-5, ZF 6-6, ZF 6-7, or ZF 6-8, selected from Group 6 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86). [0348] [87]. The protein of any one of paragraphs 66-86, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 6, and the ZFA specifically binds the orthogonal DNA sequence Target 6: 5 G GAC GAC GCG GTC TAA GAA G 3 (SEQ ID NO: 86). [0349] [88]. The protein of any one of paragraphs 66-87, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 7-1, ZF 7-2, ZF 7-3, ZF 7-4, ZF 7-5, ZF 7-6, ZF 7-7, or ZF 7-8, selected from Group 7 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87). [0350] [89]. The protein of any one of paragraphs 66-88, wherein the ZFA therein comprises, consists of, or consist essentially of the ZF motif helices selected the helices disclosed in Group 7, and the ZFA specifically binds the orthogonal DNA sequence Target 7: 5 C GAC GAG GTC GCA TAA GTA G 3 (SEQ ID NO: 87). [0351] [90]. The protein of any one of paragraphs 66-89, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 8-1, ZF 8-2, ZF 8-3, or ZF 8-4, selected from Group 8 ZFA helix combo, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88). [0352] [91]. The protein of any one of paragraphs 66-90, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 8, and the ZFA specifically binds the orthogonal DNA sequence Target 8: 5 A GAC GCA GTA TAG GTC GAA C 3 (SEQ ID NO: 88). [0353] [92]. The protein of any one of paragraphs 66-91, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 9-1, ZF 9-2, ZF 9-3, or ZF 9-4, selected from Group 9 ZFA helix combo, and the ZFA specifically binds the DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89). [0354] [93]. The protein of any one of paragraphs 66-92, wherein the ZFA comprises, consists of, or consist essentially of the ZF motif helices selected from the helices disclosed in Group 9, and the ZFA specifically binds the orthogonal DNA sequence Target 9: 5 A GAC GCA GTA TAG GAC GAC G 3 (SEQ ID NO: 89). [0355] [94]. The protein of any one of paragraphs 66-93, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 10, from Group 10, and the at least one ZFA specifically binds the DNA sequence Target 10: 5 C GGC GTA GCC GAT GTC GCG C 3 (SEQ ID NO: 90). [0356] [95]. The protein of any one of paragraphs 66-94, wherein the ZFA comprises, consists of, or consist essentially of the ZFA helix combo, ZF 11-1, from Group 11, and the at least one ZFA specifically binds the orthogonal DNA sequence Target 11: 5 G GTC GTT GCG GTA GTC GAA G 3 (SEQ ID NO: 91).

[0357] This invention is further illustrated by the following example which should not be construed as limiting. The contents of all references cited throughout this application, as well as the figures and table are incorporated herein by reference.

[0358] Those skilled in the art will recognize, or be able to ascertain using not more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

Example

[0359] In some aspects, provided herein are methods and assays for characterization of synTF activity using, for example, reporter assays in mammalian cell lines, including HEK293 cells and TE671/RD human rhabdomyosarcoma cells. The characterization can include, for example, assaying cross-activity of synTFs with different (non-cognate) promoter pairs.

[0360] Exemplary assays for characterization of 6-finger ZFA containing synTFs and responsive promoter elements are described herein. RNA-seq experiments can also be performed to measure the entire transcriptome of host cells in the context of synTFs. These experiments are aimed at characterizing the extent to which the synTFs are functionally orthogonal to host genomes.

[0361] Cell Culture Conditions

[0362] HEK293FT (American Type Culture Collection, ATCC) cells were cultured in DMEM supplemented with 10% FBS, 1% Glutamax, 1% Non-essential amino acids solution and 1% penicillin-streptomycin. Cells were incubated at 37 C. and 5% CO.sub.2.

[0363] Transient Transfection Experimental Conditions

[0364] Seeded 40,000 HEK293FT cells/well in 1DMEM in 48-well plates. Incubated at 37 C.+5% CO.sub.2 for 24 hours. Transfected 300 ng total DNA per well (1:1:1 ratio of TF:Reporter:Alexa Fluor Transfection Marker) using 3 uL DNA, 3.6 uL PEI, and 18.4 uL NaCl. Incubated at 37 C.+5% CO.sub.2 for 48 hours. Trypsinized cells and ran on a BD LSR FORTESSA flow cytometer using FSC: 260, SSC: 225, and PMTVs: FITC: 260, TxRed: 350, Alexa Fluor: 350. Gated populations via FSC and SSC, and obtained geometric means of fluorescence.

[0365] Plasmids encoding synthetic reporters and synTFs were transfected into HEK293FT cells by PEI. 40K HEK293FT cells were seeded into 48-well plates and transfected the following day with total of 300 ng of DNA (with equal ratio of testing constructs including IR fluorescent protein (iRFP) as a transfection marker). Flow cytometry analysis after 48 hours, using a BD LSR Fortessa flow cytometer, showed 80-90% of transfected cells were iRFP+ under these conditions. Populations were gated via forward-scatter (FSC) and side-scatter (SSC) and geometric means of fluorescence were obtained.

[0366] Integration Experimental Conditions

[0367] To singly integrate reporters into the human genome, plasmids encoding synthetic reporters (cloned within AAVS1 homology arm sequences) were transfected into HEK293FT cells by PEI, along with plasmids encoding Cas9-HF1 and AAVS1-targeting gRNA. 40K HEK293FT cells were seeded into 48-well plates and transfected the following day with total of 300 ng of DNA. Cells were selected under 2 ug/mL Puromycin for 12-14 days to generate polyclonal integrated lines. Transient transfection of plasmids encoding synTFs into the stable reporter lines was subsequently conducted using the above transient transfection protocol.

[0368] SynTF VP64 Activator Screen

[0369] Each synTF (as fusions to VP64) was tested with its corresponding 1 responsive reporter (green fluorescent protein, GFP) using transient transfection to determine the most potent activator.

[0370] Each synTF was also tested with its corresponding 4- or 5-responsive reporter using transient transfection to determine the most potent activator. Data not shown.

[0371] Exemplary results from these assays are provided herein in FIGS. 7-8.

[0372] FIG. 7 shows the effectiveness of different ZF helix combinations in a six-finger ZFA synTF having the VY64 activation domain, activating gene expression in a 1 target promoter operable linked to a green fluorescent protein as the GOI. SynTFs having the ZF helix combo: ZF1-3, 2-6, 3-5, 4-8, 5-7, 6-4, 7-3, 8-1, and 9-2 are shown to be very effective.

[0373] SynTFs having the ZF helix combo: ZF1-3, 2-6, 3-5, 4-8, 5-7, 6-4, 7-3, 8-1, and 9-2, and fusioned to VP64 activation domain were further were tested against all respective 1 target responsive reporters using transient transfection to assay for cross-activity. FIG. 8 shows more than 10 fold GFP activation with the respective target responsive reporters and non-detectable GFP activation with non-specific target responsive reporters, supporting the orthologonal design of the ZFA and target sequence.

[0374] SynTF KRAB Repressor Activity

[0375] SynTF transcriptional repressors using the KRAB repression domain can silence the (strong) full length CMV promoter in HEK293 cells. Experiment was done using transient transfection. Data shown in FIG. 12. All synTFs having the ZF helix combo: ZF1-3, 2-6, 3-5, 4-8, 5-7, 6-4, 7-3, 8-1, and 9-2, and fusioned to KRAB repression domain effectively repressed the GPF expression from a 1 target promoter operable linked to a green fluorescent protein as the GOI.

[0376] SynTF HP1 Repressor Activity

[0377] SynTF transcriptional repressors using the HP1 repression domain can silence the (strong) full length CMV promoter in HEK293 cells. Experiment was done using transient transfection. Data shown FIG. 13. Similar to the synTFs having the KRAB repression domain, All synTFs having the ZF helix combo: ZF1-3, 2-6, 3-5, 4-8, 5-7, 6-4, 7-3, 8-1, and 9-2, and fusioned to HP1 repression domain effectively repressed the GPF expression from a 1 target promoter operable linked to a green fluorescent protein as the GOI.

[0378] SynTF p65 Activation Activity

[0379] Genome-wide transcriptome (RNA-seq) experiment with the ZF-p65 fusions, ZF fused to the activation domain of NFB shows minimal genome-wide off-target gene expression events. Data not shown.

[0380] SynTF Activation for Plasmid (Transient) Vs. Integrated Synthetic Reporters

[0381] synTF transcriptional activators are capable of activating stably and singly integrated synthetic reporters in HEK293 cells. Data shown is shown in FIG. 14. Experiment on the left was done using transient transfection of synTFs and reporters. Experiment on the right was done using transient transfection of synTFs into stable integration reporter lines. The synTF transcriptional activators of this disclosure are able to activate gene expressions in both plasmids and integrated synthetic reporters.

[0382] SynTF Activation Vs. Constitutive Full Length CMV Promoter

[0383] SynTF transcriptional activators can achieve activation levels greater than that of the (strong) full length CMV promoter in HEK293 cells. Experiment was done using transient transfection. Data are shown in FIG. 9.

[0384] SynTF Repression Vs. Constitutive Full Length CMV Promoter

[0385] SynTF transcriptional repressors can silence the (strong) full length CMV promoter in HEK293 cells. Experiment was done using transient transfection. Data is shown in FIG. 10.

[0386] SynTF Functionality Across Mammalian Cell Lines and Eukaryotic Systems

[0387] SynTFs are broadly functional across eukaryotic systems. Experiment was done using transient transfection. Data is shown in FIG. 11 with HEK293 cells and TE671/RD cells as representative eukaryotic cells.

[0388] Additionally, the inventors performed a more comprehensive and cleaner orthogonality screen. See FIG. 15 for the complied data. It differs from FIG. 8 in a few ways: (1) it includes ZF10-1 and ZF11-1 (the existing one does not have these ZF-TFs), (2) it includes Gal4 as a control, (3) each synTF is a p65 fusion, (4) 4 reporters for each line were AAVS1-integrated and the synTFs tested were transiently transfected into these lines.

[0389] The inventors also conducted genome-wide transcriptome (RNA-seq) experiments using the ZF-p65 fusions, testing for the activation of transcription. The data showed minimal genome-wide off-target gene expression events with the synTFs activators.

REFERENCES

[0390] Khalil et al., A Synthetic Biology Framework for Programming Eukaryotic Transcription Functions, Cell 150 (2012). [0391] Sander et al., In silico abstraction of zinc finger nuclease cleavage profiles reveals an expanded landscape of off target sites. Nucleic Acids Res. 2013 Oct. 1; 41(19):e181. [0392] Pattanayak V, Ramrirez C L, Joung J K, Liu D R. Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection. Nat Methods. 2011 Aug. 7; 8(9):765-70. [0393] Sander J D, Dahlborg E J, Goodwin M J, Cade L, Zhang F, Cifuentes D, Curtin S J, Blackburn J S, Thibodeau-Beganny S, Qi Y, Pierick C J, Hoffman E, Macder M L, Khayter C, Reyon D, Dobbs D, Langenau D M, Stupar R M, Giraldez A J, Voytas D F, Peterson R T, Yeh J R, Joung J K. Selection-free zinc-finger-nuclease engineering by context-dependent assembly (CoDA). Nat Methods. 2010 Dec. 12; doi: 10.1038/nmeth.1542. [0394] Sander J D, Maeder M L, Reyon L, Voytas D F, Joung J K, Dobbs D. ZiFiT (Zinc Finger Targeter): an updated zinc finger engineering tool. Nucleic Acids Res. 2010 Jul. 11; 38 Suppl:W462-8. [0395] Maeder M L, Thibodeau-Beganny S, Sander J D, Voytas D F, Joung J K. Oligomerized Pool ENgineering (OPEN): An Open-Source Protocol for Making Customized Zinc Finger Arrays, Nat Protocols, 2009, 4: 1471-1501. [0396] Maeder M L, Thibodeau-Beganny S, Osiak A, Wright D A, Anthony R M, Eichtinger M, Jiang T, Foley J E, Winfrey R J, Townsend J A, Unger-Wallace E, Sander J D, Muller-Lerch F, Fu F, Pearlberg J, Gobel C, Dassie J, Pruett-Miller S M, Porteus M H, Sgroi D C, Iafrate A J, Dobbs D, McCray P B, Cathomen T, Voytas D F, Joung J K. Rapid open-source engineering of customized zinc-finger nucleases for highly efficient gene modification, Mol Cell, 2008, 31: 294-301. [0397] Garg et al., Engineering synthetic TAL effectors with orthogonal target sites. Nucleic Acids Res. 2012 [0398] Beerli, R. R., and Barbas, C. F., III. (2002). Engineering polydactyl zinc-finger transcription factors. Nat. Biotechnol. 20, 135-141.

TABLE-US-00008 TABLE1 # occurances # occurances inHuman inHuman 6mer GenomeBuild37 6mer GenomeBuild37 GCGACG 44969 GCTGTC 1040969 GACGAC 107501 TAAGGT 1084864 GACGAT 143718 GTTGGC 1106181 TGCGTA 158568 GACTTG 1154843 TGCGTC 169501 GCCTGC 1393464 TCGGAA 179274 GAGGGG 1487400 TCGGTG 199414 TAAGTG 1529627 GTCACG 201114 GAGTCT 1587854 GACACG 242310 TGGGGT 1766352 GGCGAC 260231 TGGGTT 1805533 GCTGCG 279949 GATGAA 1971926 GGCGCG 293359 GGAGGG 2067820 GGTGCG 319174 TCTGGG 2122422 GCCGCC 347210 GGTGGG 2243231 TCGGCT 468698 GTGGTG 2406362 GCGTGG 526164 GGCTGA 2483117 TGGGCG 604619 GAAGGA 2504910 GAGACG 639756 TGGGAA 2570736 GGTTAG 694780 TGGGAT 2642429 GTAGGG 760348 GAGGCA 2671646 GTAGGT 866278 GAATTT 2827108 GCCTAG 909272 GCTGAG 2982694 GGGTAA 925700 GTGTGT 3565452 TAAGGG 947952 GCTGGG 3664942 GATGAC 989073 TGTGTG 4258659