Composition for treatment of multiple sclerosis

09896491 ยท 2018-02-20

Assignee

Inventors

Cpc classification

International classification

Abstract

Novel oligopeptides, combinations thereof and fusion proteins composed of the above-mentioned oligopeptides are disclosed. Oligopeptides are homologous in amino acid sequence to the selected parts of the amino acid sequence of human myelin basic protein (MBP) and are capable to ameliorate the progression of multiple sclerosis by means of binding to and inactivation of epitope-specific anti MBP catalytic auto antibodies (ESAMBPCAA) involved into binding and catalytic degradation of MBP in course of progression of Multiple Sclerosis.

Claims

1. A pharmaceutical composition comprising: (a) an oligopeptide that consists of the amino acid sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2); and (b) (i) an oligopeptide that consists of the amino acid sequence GFGYGGRASDYKSAHK (SEQ ID NO: 3), and/or (ii) an oligopeptide that consists of the amino acid sequence QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4).

2. The pharmaceutical composition of claim 1, comprising: (a) an oligopeptide that consists of the amino acid sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2); and (b) (i) an oligopeptide that consists of the amino acid sequence GFGYGGRASDYKSAHK (SEQ ID NO: 3), and (ii) an oligopeptide that consists of the amino acid sequence QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4).

3. The pharmaceutical composition of claim 1, wherein one or more oligopeptides are salts.

4. The pharmaceutical composition of claim 1, wherein one or more oligopeptides are acetic acid salts.

5. The pharmaceutical composition of claim 1, wherein the combination of oligopeptides is present in a therapeutically effective amount.

6. The pharmaceutical composition of claim 1, further comprising a pharmaceutically acceptable carrier and/or excipient and/or drug delivery system.

7. The pharmaceutical composition of claim 6, wherein the drug delivery system is liposomes.

8. A method of treating or reducing the incidence of multiple sclerosis in a subject in need of such treatment, wherein said method comprises administering to the subject a therapeutically effective amount of the pharmaceutical composition of claim 1.

9. A method of treating or reducing the incidence of multiple sclerosis in a subject in need of such treatment, wherein said method comprises administering to the subject a therapeutically effective amount of the pharmaceutical composition of claim 2.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows the amino acid sequence of intact human-MBP molecule. The block capitals represent amino acid residues on human MBP. Also the parts of MBP-amino acid sequence which correspond to amino acid sequence of inventive oligopeptide (SEQ ID NO: 2) as well as of oligopeptides having amino acid sequence SEQ ID NO: 3 and SEQ ID NO: 4, are presented correspondingly. These parts of MBP-amino acid sequence are outlined with black line.

(2) FIG. 2 shows degradation of MBP in presence of ESAMBPCAA and inhibition of degradation in presence of different MBP peptide fragments (the horizontal row of figures correspond to positions of first and last amino acid residues counted from the C-terminus of full MBP sequence).

(3) FIG. 3 illustrates the inhibition of ESAMBPCAA activity by different synthetic oligopeptides containing amino acid sequences of MBP fragment 43-68. Horizontal axisconcentration of oligopeptides used in inhibitory assay; Vertical axisrelative ESAMBPCAA activity (ESAMBPCAA activity in control assays (PBS) were deemed as 1). Codes of oligopeptides are indicated in Example 3.

(4) FIG. 4 illustrates suppression of MDS score of DA rats suffering from Experimental Allergic Encephalomyelitis and treated by inventive oligopeptides and the fusion protein. Suppression of MDS score in ongoing EAE in DA rats at day 24. Maximum clinical score in each group of rats, median and 95% confidential interval.

(5) FIG. 5 illustrates suppression of MDS score in ongoing experimental MS (Theiler's Virus Infection) with combinations of oligopeptides.

DETAILED DESCRIPTION OF THE INVENTION

Definitions

(6) As used herein, the term oligopeptide relates to any molecule that contains up to about 20 amino acid residues linked by peptide linkage(s), i.e. term oligopeptide means a polypeptide up to 20 amino acids in length. The term oligopeptide or oligopeptides encompasses oligopeptides as well as salts thereof. Suitable salts include sodium or potassium salts or acetic or phosphate salts.

(7) As used in this description, the term oligopeptide encompasses an oligopeptide having specified amino acid sequence and functional variants thereof. The functional variants include any fragment of the oligopeptide of specified sequence wherein the fragment has from 6 to 20 amino acids in length provided that is retains capability of binding ESAMBPCAA.

(8) As used in this description, the term an oligopeptide fragment of the present invention is comprised of at least about 6, preferably at least about 8, preferably at least about 12, more preferably at least about 14, and most preferably at least about 16 or more contiguous amino acid residues.

(9) Further contemplated are variants of the oligopeptides of present invention obtained by altering the amino acid sequence of parent oligopeptide. Such alterations can comprise one or more amino acid substitutions, deletions, insertions or additions provided that resulting variant comprised at least 6 contiguous amino acids of the parent sequence and is capable of binding ESAMBPCAA.

(10) As used in this description, the tam fusion peptide or fusion protein refers to an oligopeptide or a fragment thereof fused to another oligopeptide or a fragment thereof, each fused moiety being bound to the other directly by a peptide link (the amino group (NH.sub.2) of N terminus of one oligopeptide linked to the carboxylic acid group (COOH) of C-terminus of the other oligopeptide or a fragment thereof) or alternatively via a linker. The linker may be selected from peptide linker or non-peptide linker. A peptide linker may consist of a sequence containing from about 1 to about 20 amino acids, which are linearly linked to each other by peptide bond and which may optionally include a sequence for a protease cleavage site. The term non-peptide linker as used herein refers to any linking moiety having two or more reactive groups other than peptide linker. Preferred linker is a non-peptide polymer. The non-peptide polymer used a linker of the invention is a polymer carrying reactive groups at both ends, which are capable of independently binding to reactive groups of an oligopeptide, wherein examples of reactive group of the oligopeptide includes a terminal amino group or a terminal carboxyl group, a lysine residue, a histidine residue or a cysteine residue. Reactive groups of the polymer include an aldehyde group, a propionic aldehyde group, a butyl aldehyde group, a maleimide group, a ketone group, a vinyl sulfone group, a thiol group, a hydrazide group, a carbonyldimidazole (CDI) group, a nitrophenyl carbonate (NPC) group, a trysylate group, an isocyanate group, and succinimide derivatives. Examples of succinimide derivatives include succinimidyl propionate (SPA), succinimidyl butanoic acid (SBA), succinimidyl carboxymethylate (SCM), succinimidyl succinamide (SSA), succinimidyl succinate (SS), succinimidyl carbonate, and N-hydroxy succinimide (NHS). The reactive groups at the ends of a non-peptide polymer may be the same or different. For example, the polymer may have a maleimide group at one end and an aldehyde group at another end. Low molecular weight linkers include carbodiimide or glutaraldehyde.

(11) As used in this description, the term ESAMBPCAA refers to small fraction of autologous immunoglobulin molecules circulating in blood of MS patient which binds myelin basic protein and catalyze site-specific proteolytic cleavage of the MBP molecule.

(12) As used in this description the terms to treat, treating, and treatment refer to administering a therapy, an agent, a compound, or composition to a subject suffering from a disease in order to reduce, ameliorate or to eliminate at least one symptom of the condition being treated as assessed by attending physician or any skilled in the art by any conventional method. As used in this description, the term Neutralization, inactivation, inhibition means reduction of specific activity as measured with specified appropriate test system.

(13) As used in the description, effective amount is an amount of an oligopeptide, a fragment thereof, or a fusion protein as described above, which upon administration, is capable of reducing ameliorating or eliminating at least one symptom of multiple sclerosis. Further, effective amount means an amount capable of reducing or preventing multiple sclerosis condition.

(14) Based on our previous work (Belogurov at al., The Journal of Immunology, 2008, 180: 1258-1267) the novel class of auto antibodies involved into recognition and degradation of Myelin Basic Protein in MS patients was discovered. These catalytically active antibodies represent very minor fraction of anti MBP antibodies, however it was found that their catalytic activity correlates with progressive state of MS. Thus, quantification of anti MBP autoantibody mediated MBP proteolysis was suggested as novel biomarker of MS. Surprisingly, despite ESAMBPCAA represent only minor fraction of circulating anti MBP auto antibodies in MS, the authors of present invention has discovered that certain oligopeptide, having strong neutralizing activity on ESAMBPCAA, demonstrate unexpectedly high efficacy in treatment of MS both in humans and in well-established animal models of multiple sclerosis. According to the present invention there an oligopeptide having amino acid sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) is provided. This sequence corresponds to amino acid sequence 46-62 of human MBP and is referred hereinafter as MBP 46-62. Said oligopeptide is capable of inhibiting ESAMBPCAA.

(15) Fragments and functional variants of oligopeptide GGDRGAPKRGSGKDSHH SEQ ID NO: 2) constitute one of preferred embodiments of present invention. On the basis of the ESAMBPCAA inhibition assays using a series of truncated forms of oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) the smallest number of amino acids required for oligopeptide fragment to retain its biological activity were established. Thus, according to the present invention, the fragment or functional variant of an oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) must retain at least 6 contiguous amino acid residues of SEQ ID NO: 2. Based on given disclosure, it would be readily apparent to persons skilled in the art to determine, empirically, what variation can be made to the oligopeptide sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) without affecting the ESAMBPCAA inhibitory activity of the peptide.

(16) In another aspect, the present invention provides two oligopeptides having sequences GFGYGGRASDYKSAHK (SEQ ID NO: 3) and QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO 4), respectively. These peptides contains well known in the art MBP epitopes, recognized by immune T-cells and/or by conventional (non-proteolytic) anti MBP auto antibodies from MS patients. The inventors have unexpectedly found that these two oligopeptides (SEQ ID NO: 3 and SEQ ID NO: 4 synergistically enhance efficacy of the oligopeptide (SEQ ID NO: 2) of present invention in treatment of multiple sclerosis in humans and preventing (or reducing) development of established animal model of MS-experimental allergic encephalomyelitis (EAE). Despite having low inhibitory activity against ESAMBPCAA as compared to oligopeptide (SEQ ID NO: 2), these two oligopeptides potentiate therapeutic effect of GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) oligopeptide when co-administered to animals and humans. While not wishing to be bound by any theory, it may be assumed that this is due to fact that simultaneous modulation of several immune mechanismsimmune T cell function and auto antibody mediated MBP hydrolysis may provide multiplication of therapeutic effect. Accordingly, a pharmaceutical composition is provided which contains the oligopeptide of SEQ ID NO: 2, fragments or functional variants thereof and at least one of two oligopeptides of sequences SEQ ID NO: 3 or SEQ ID NO: 4.

(17) In a further embodiment of the present invention, the oligopeptides of SEQ ID NO: 2, fragments or functional variants thereof are linked to each other to form a fusion peptide. Such fusion peptide comprises multiple copies of ESAMBPCAA inactivating moiety.

(18) In a further embodiment of the present invention oligopeptide (SEQ ID NO: 2) or fragments or functional analogs thereof and oligopeptide (SEQ ID NO: 3) or fragments thereof and oligopeptide (SEQ ID NO: 4) or fragments thereof are linked to linked to each other in any order to form the fusion peptide, Thus, a fusion peptide of present invention may contain multiple repetitive copies of ESAMBPCAA inactivating moieties of oligopeptide (SEQ ID NO: 2) and epitopes of oligopeptides (SEQ ID NO: 3) and (SEQ ID NO: 4).

(19) The invention further provides a pharmaceutical composition comprising therapeutically effective amount of an oligopeptide of present invention (SEQ ID NO: 2) or fragment or functional variant thereof or fusion protein and a pharmaceutically acceptable carrier or a diluent and/or drug delivery system. Examples of pharmaceutical acceptable carriers are well known in the art, and include for example normal saline. The examples of drug delivery systems are also well known in the art and include for example liposomes or synthetic polymeric nanoparticles. The oligopeptides of the present invention can be prepared according to existing methods of synthesizing oligopeptides having formula according disclosure provided. Fusion proteins may be produced by recombinant DNA technology. Knowing the sequence of the selected fusion proteins, as disclosed in the present invention, the appropriate DNA sequence can be produced by conventional, known methods of synthesizing DNA sequences. The DNA sequences so produced can then be cloned into appropriate cloning vehicles and used to transform an appropriate host cell to produce the recombinant peptide. All of the methodology referred to above is conventional and well-known to persons skilled in the art.

(20) The invention further provides a method for treating multiple sclerosis, the method comprising administering an effective dose of oligopeptide, or a fragment, or fusion peptide, or a pharmaceutical composition containing same to a subject in need thereof. The therapeutic dose of oligopeptides or fusion protein for the treatment of MS may be from about 0.01 mg per kilogram of body weight to about 10.0 mg per kilogram of body weight; the composition can be administered intravenously, subcutaneously, intrathecally. In one example of the present invention, the composition is administered orally, to target so called mucosal delivery route. The composition can be administered as a single or sequential dose, as may be required.

(21) While this invention is described in detail with particular reference to preferred embodiments thereof, the following examples are offered to illustrate but not limit the invention.

EXAMPLES

Example I. Detection of ESAMBPCAA-Autologous Immunoglobulin Molecules which Binds Myelin Basic Protein and Catalyze Site-Specific Proteolytic Cleavage of the MBP Molecule in Blood of Multiple Sclerosis Patients

(22) Anti MBP autoantibody purification and characterization were done using the serum of 24 MS patients (17-54-year-old, mean age 32 years) who had not been treated with steroids or non-steroidal anti-inflammatory drugs. The MS diagnosis was verified and confirmed, and EDSS (Expanded Disability Status Scale) values were calculated according to Poser's classification of disease progression, using clinical, immunological and MRI data (Poser et al., Clin Neurol Neurosurg 2001; 103:1-11). Immunoglobulins (IgG) were isolated from serum by thrice-repeated 50% ammonium sulfate precipitation followed by affinity chromatography on protein G-Sepharose (Amersham Biosciences). IgG-containing fractions were then dialyzed against PBS or TBS with 0.05% NaN.sub.3 at 4 C. The IgG amount was quantified and standardized by ELISA. IgG purity was assessed by electrophoresis followed by silver staining, immunoblotting under nonreducing conditions and by surface-enhanced laser desorption/ionization (SELDI) mass spectrometry. IgGs were further separated by the antigen affinity chromatography on a column with MBP immobilized on NHS-Sepharose (Amersham) and their purity was assessed by electrophoresis followed by silver staining technique.

(23) MBP was prepared from bovine brain according to Miller (Miller et al., 1996. Experimental autoimmune encephalomyelitis in the mouse. In: Current Protocols in Immunology; J. E. Coligan, ed. Wiley, New York, p. S19.) The resulting protein was purified by reverse phase HPLC on column C4 10/250 (Mashery-Nagel, Germany).

(24) MBP hydrolysis by anti MBP auto antibodies was assayed as follows: Purified antibodies (0.1-1 g) were incubated at 37 C. for 14 h in the final volume of 12.5 l PBS, 0.02% NaN.sub.3 containing 1-2 g of MBP. The samples were mixed with Laemmli's buffer. The extent of MBP degradation was visualized by SDS-PAGE in Tris-glycine and Tricine buffer systems. For quantitative MBP degradation assay, MBP (10 M) was incubated at 37 C. with antibodies (60 nM) in 0.1 ml of PBS, 0.02% NaN.sub.3 for 12 h. The reaction was stopped by adding 10% TFA up to pH 2.5. The samples were further chromatographed on column C4 4.0/150 (Waters). The amount of non-cleaved MBP was calculated by absorbance monitoring at 280 nm.

(25) The results are presented in Table 1.

(26) TABLE-US-00001 TABLE 1 Clinical statuses of 24 multiple sclerosis patients and corresponding rates of MBP hydrolysis by ESAMBPCAA. Type of ESAMBPCAA activity EDSS Patient N disease (pmol/min/nmol) score MS1 SP 77.6 7.1 5.0 MS2 SP 84.3 6.9 4.5 MS3 SP 63.0 5.8 6.0 MS4 RR 45.6 6.0 2.0 MS5 RR 5.9 4.8 1.0 MS6 RR 2.1 4.5 1.0 MS7 RR 5.3 5.0 2.0 MS8 RR 3.0 3.9 1.5 MS9 SP 71.2 5.5 3.0 MS10 SP 4.5 4.1 2.5 MS11 RR 1.5 6.0 0 MS12 SP 79.0 8.9 4.0 MS13 RR 2.0 4.0 0 MS14 PP 44.9 5.0 3.0 MS15 PP 22.3 4.5 3.0 MS16 RR 29.3 5.3 2.5 MS17 RR 15.1 4.1 3.0 MS18 RR 4.3 3.9 1.5 MS19 RR 6.5 4.0 2.0 MS20 SP 15.0 5.9 3.0 MS21 SP 1.3 3.7 2.0 MS22 RR 39.2 7.2 3.0 MS23 SP 29.1 6.2 3.0 MS24 RR 4.3 3.5 1.5 SPsecondary progressive; PPprimary progressive; RRrelapsing-remitting.

(27) Importantly, the level of the ESAMBPCAA mediated MBP cleavage correlated with expanded disability status scale (EDSS) range of the patients (r2=0.85, P<0.001 by Spearman rank correlation). The highest levels of the antibody mediated catalysis occurred in cases with high EDSS (from 3.0 to 6.0), mostly at the progression stage or the exacerbation at the relapsing-remitting (RR) course of the disease.

Example 2. Screening for ESAMBPCAA Inhibitory Sequences

(28) Twelve DNA fragments encoding human MBP peptides representing different parts of MBP molecule (1-27, 17-41, 25-54, 43-68, 53-81, 81-103, 91-114, 107-132, 123-140, 130-156, and 146-170, were prepared by PCR with four overlapping corresponding to the linker (SGGGG)3S (SEQ ID NO: 9). The final PCR products were cloned in-frame into pET32CH plasmid by using NcoI and BamHI restriction sites. The expression products of these plasmids that contained Trx fused to MBP peptides were used for cleavage analysis. The plasmid encoding Trx (Thioredoxin) with linker (SGGGG) 3S (SEQ ID NO: 9) was designed for control. The soluble recombinant His-tagged proteins were obtained by Escherichia coli expression and isolated by sorption on Talon SuperFlow (BD Biosciences) column, followed by cation exchange chromatography on Mono S column (Amersham Pharmacia) at pH 5.0 and subsequent size exclusion chromatography on Superdex 75 GL 10_300 column (Amersham Pharmacia) in 150 mM NH.sub.4HCO.sub.3 buffer.

(29) Pattern of MBP hydrolysis by ESAMBPCAA purified from plasma of SJL mice suffering from EAE, induced by injection of MBP in complete Freund adjuvant, was assessed by SDS-PAGE as specified in Example 1 in presence of 0.5 mkM of different MBP peptides. The results are presented in FIG. 2. The MBP fragment 43-68, which contains sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2), demonstrates potent inhibitory activity on anti MBP auto antibody mediated MBP hydrolysis.

Example 3. Suppression of MBP-Specific Auto Antibody Mediated Hydrolysis by Synthetic Oligopeptides Containing Amino Acid Sequences of MBP Fragment 43-68

(30) In order to identify the amino acid sequence required for efficient inhibition of ESAMBPCAA activity the following series of peptides were synthesized:

(31) TABLE-US-00002 TABLE2 Numberof SEQ amino Position ID acid inMBP NO: Aminoacidsequence residues sequence A1 10 RFFGGDRGAPKRGSGKDSHHPARTAH 26 43-68 A2 11 FGGDRGAPKRGSGKDSHHPAR 21 45-65 A3 2 GGDRGAPKRGSGKDSHH 17 46-62 A4 12 GAPKRGSGKDSHH 13 50-62 A5 13 GGDRGAPKRGS 11 46-56 A6 14 PKRGSGKDSHH 11 52-62 A7 15 GGDRGAPKR 9 46-54 A8 16 RGSGKDSHH 9 54-62 A9 17 GGDRGAP 7 46-52 A10 18 SGKDSHH 7 56-62 A11 19 GGDRG 5 46-50 A12 20 KDSHH 5 58-62

(32) The oligopeptides were assayed for their potency to inhibit ESAMBPCAA mediated MBP hydrolysis using ESAMBPCAA collected from progressive MS Patient as specified in Example 1. Different concentrations of test peptides were mixed with both antibodies (30 nM) and MBP (4 mkM) in TBS with_0.1% NaN3_and 10 mM CaCl2. The samples were incubated for 16 h at 37 C. and analyzed on 15% SDS_PAGE. The gels were stained by Coomassie and analyzed by densitometry with TOTALLAB 2.01 software (Nonlinear Dynamics, Ltd., Newcastle upon Tyne, U.K.). The data presented in FIG. 3 shows that from tested oligopeptides the oligopeptide A3, comprising amino acid sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) demonstrates most potent inhibitory activity, having less amino acid residues than oligopeptides A1 and A2. Shortening of oligopeptide lengths to less than 6 amino acids lead to complete lack of ESAMBPCAA inhibitory activity.

Example 4. Suppression of MBP-Specific Auto Antibody Mediated Hydrolysis by Synthetic Oligopeptides Containing Amino Acid Sequence GGDRGAPKRGSGKDSHH (SEQ ID NO: 2), Fragments Thereof and Fusion Proteins.

(33) Serum samples collected from 5 patients suffering from progressive MS were quantified for ESAMBPCAA mediated MBP hydrolysis as specified in Example 1 in presence of following substances:

(34) A1negative control: phosphate buffered saline (PBS);

(35) A2glatiramer acetate (Copaxone, Teva Pharmaceuticals), 100 nM;

(36) A3oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) 100 nM;

(37) A4oligopeptide APKRGSGKDSH (SEQ ID NO: 23) (a fragment of oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2)100 nM;

(38) A5oligopeptide SGKDS (SEQ ID NO: 26) (a fragment of oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2))100 nM;

(39) A6fusion protein RGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRG SGK (SEQ ID NO: 21) (containing repetitive sequence RGAPKRGSGK (SEQ ID NO: 22), which sequence represents the fragment of GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) oligopeptide100 nM);

(40) The products A3, A4 and A5 have been synthesized by the laboratory of solid phase organic synthesis (Shemyakin Ovchinnikov Institute of Bioorganic Chemistry RAS. The product A6 has been synthesized using ABNOVA custom cell-free translation system. (www.abnova.tw).

(41) The results of the assay are presented in Table 3 below.

(42) TABLE-US-00003 TABLE 3 Influence of different tested preparations on MBP-specific auto antibody mediated hydrolysis (pmol/min/nmol) Patient 1 Patient 2 Patient 3 Patient 4 Patient 5 A1 (PBS) 77.6 7.1 84.3 6.9 63.0 5.8 45.6 6.0 79.0 8.9 A2 62.5 1.2 72.6 7.7 51.2 3.5 47.7 7.9 65.7 5.4 A3 11.2 3.5 17.3 4.1 14.4 2.2 14.5 4.4 16.9 7.3 A4 12.1 3.6 15.6 2.9 14.3 4.4 15.8 4.9 13.3 5.9 A5 .sup.57 4.1 59.7 5.7 44.2 6.6 45.5 3.8 55.7 6.1 A6 7.7 3.3 22.3 4.2 20.1 3.9 21.5 6.6 5.0 1.8

(43) Thus, oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2), oligopeptide APKRGSGKDSH (SEQ ID NO: 23) (a fragment of oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) with 11 amino acids length and the fusion protein containing repetitive sequence RGAPKRGSGK (SEQ ID NO: 22), which sequence represents the fragment of GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) oligopeptide all has potent suppressive effect on MBP-specific auto antibody mediated hydrolysis

Example 5

(44) Treatment of EAE by the Inventive Oligopeptide and the Fusion Protein

(45) Experimental Allergic Encephalomyelitis (EAE) in DA rats is well established animal model of MS. The animal work was performed in the Pushchino branch of the Shemyakin and Ovchinnikov Institute of Bioorganic Chemistry, Russian Academy of Sciences. Female DA rats 10-14 weeks of age were anesthetized and injected intradermally at the base of the tail with 100 ml of inoculums containing 50 mg of rat MOG in saline emulsified (1:1) with CFA (Sigma Chemical Co., St. Louis, Mo.) containing 200 mg of Mycobacterium tuberculosis (strain H 37 RA; Difco Laboratories, Detroit, Mich.). At day 8 after a second immunization, rats were divided into 6 groups (6 rats per group) and treated during 5 days (days 8-12) according following schedule:

(46) Group 1oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) at 120 g daily by intranasal administration

(47) Group 1oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) at 50 g daily by intranasal administration

(48) Group 3fusion protein RGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRG SGK (SEQ ID NO: 21) at 120 g daily by intranasal administration

(49) Group 4oligopeptide APKRGSGKDSH (SEQ ID NO: 23) at 120 g daily by intranasal administration

(50) Group 5Glatiramer acetate (Copaxone, Teva) 120 g daily by intranasal application

(51) Group 6Control (PBS)

(52) Clinical symptoms (MDS score) of disease were assessed daily on the following grading scale: grade 0, no clinical signs; grade 1, mild waddling gait or flaccid tail; grade 2, severe waddling gait; grade 3, moderate hind limb paresis; and grade 4, severe hind limb paralysis. Serum samples collected from animals were quantified for ESAMBPCAA mediated MBP hydrolysis as specified in Example 1

(53) The results are presented at FIG. 4 and Table 4 below.

(54) TABLE-US-00004 TABLE 4 Influence of treatment on rates of MBP-specific auto antibody mediated hydrolysis (Median for 6 animals; pmol/min/nmol) Experimental Group Day 8 Day 16 Day 24 Group 1 42.8 5.5 17.3 5.4 15.1 3.9 Group 2 43.1 6.4 35.6 4.9 46.3 2.9 Group 3 45.7 6.5 48.1 7.4 39.4 4.6 Group 4 49.3 4.9 45.9 7.1 45.1 6.3 Group 5 51.4 8.2 55.4 5.7 62.2 5.7 Group 6 47.6 6.1 61.3 7.35 75.2 8.3

(55) Thus, both the MBP-specific auto antibody mediated hydrolysis and MDS score are most efficiently suppressed by oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) in the dose-dependent manner. Fusion protein RGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRG SGK (SEQ ID NO: 21) and oligopeptide APKRGSGKDSH (SEQ ID NO: 23) are also active in suppression of MBP-specific auto antibody mediated hydrolysis and MDS score.

Example 6

(56) Treatment of Experimental MS (Theiler's Virus Infection) with Inventive Oligopeptides and Combinations of Oligopeptides

(57) The BeAn strain of TMEV used in this study was generated and propagated in BHK-21 cells grown in Dulbecco's modified Eagle's medium supplemented with 7.5% donor calf serum. For i.c. infection, 30 l of virus solution (0.210.sup.6 to 610.sup.6 PFU) was injected into the right cerebral hemisphere of 6- to 8-week-old SJL mice (8 animals per group) anesthetized with isoflurane. Clinical symptoms (MDS score) of disease were assessed weekly on the following grading scale: grade 0, no clinical signs; grade 1, mild waddling gait or flaccid tail; grade 2, severe waddling gait; grade 3, moderate hind limb paresis; and grade 4, severe hind limb paralysis. Serum samples collected from animals were quantified for ESAMBPCAA mediated MBP hydrolysis as specified in Example 1

(58) Oligopeptides GFGYGGRASDYKSAHK (SEQ ID NO: 3) and QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) are known in the art as capable to modulate immune T cell activity in MS, leading to some efficacy in treatment of MS.

(59) At day 14 following infection mice were divided into 6 groups (30 mice per group) and treated during 10 days (days 14-24) according following schedule:

(60) Group 1ControlPBS daily by subcutaneous injection

(61) Group 2Copaxone daily 30 g daily by subcutaneous injection

(62) Group 3Oligopeptide GGDRGAPKRGSGKDSHH SEQ ID NO: 2) at 20 g daily by subcutaneous injection

(63) Group 4Oligopeptide GFGYGGRASDYKSAHK (SEQ ID NO: 3) at 20 g daily by subcutaneous injection

(64) Group 5Oligopeptide QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) at 20 g daily by subcutaneous injection

(65) Group 6Oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) at 20 g and oligopeptide GFGYGGRASDYKSAHK (SEQ ID NO: 3) at 20 g daily by subcutaneous injection

(66) Group 7Oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) at 20 g and oligopeptide GFGYGGRASDYKSAHK (SEQ ID NO: 3) at 20 g and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) at 20 g daily by subcutaneous injection

(67) Group 8Oligopeptide GFGYGGRASDYKSAHK (SEQ ID NO: 3) at 20 g and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) at 20 g daily by subcutaneous injection

(68) The results are presented at FIG. 5 and Table 5 below.

(69) TABLE-US-00005 TABLE 5 Influence of performed treatment on disease manifestation and rates of auto antibody mediated MBP hydrolysis. % Animals affected with ESAMBPCAA activity at Group disease at day 100 day 100 (pmol/min/nmol) Group 1 27(30) 45.7 6.7 Group 2 25(30) 39.8 4.1 Group 3 19(30) 11.4 3.5 Group 4 25(30) .sup.40 3.1 Group 5 27(30) 35.3 5.1 Group 6 15(30) 16.5 3.2 Group 7 17(30) 14.1 2.9 Group 8 25(30) 37.7 4.9

(70) Thus, MBP-specific auto antibody mediated hydrolysis and MDS score are most efficiently suppressed by oligopeptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) alone or in combination with oligopeptide GFGYGGRASDYKSAHK (SEQ ID NO: 3) and/or oligopeptide QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4).

(71) Oligopeptides GFGYGGRASDYKSAHK (SEQ ID NO: 3) and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) alone or in combination has moderate therapeutic effect and do not affect MBP-specific auto antibody mediated hydrolysis. Combination of GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) with GFGYGGRASDYKSAHK (SEQ ID NO: 3) and QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) has most beneficial therapeutic effect. Importantly, peptide GGDRGAPKRGSGKDSHH (SEQ ID NO: 2) and its combinations with oligopeptide GFGYGGRASDYKSAHK (SEQ ID NO: 3) and/or oligopeptide QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) have also disease-preventive (prophylactic) activity.

Example 7

(72) Suppression of MBP-Specific Auto Antibody Mediated Hydrolysis and Treatment of MS by Means of Exposing the Blood of Patient to the Fusion Proteins According the Invention:

(73) Three fusion proteins of the following formulas were synthesized using ABNOVA custom cell-free translation system (www.abnova.tw):

(74) TABLE-US-00006 1) (SEQIDNO:21) RGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKRGAPKRGSGKR GAPKRGSGK 2) (SEQIDNO:24) GAPKRGSGKYGGRASDYKSGTLSKIFKLGGRDSRRGAPKRGSGKYGGRASD YKSGTLSKIFKLGGRDSR 3) (SEQIDNO:25) GGDRGAPKRGSGKDSHHGFGYGGRASDYKSAHKQGTLSKIFKLGGRDSRSG SPMARR

(75) Thus, these fusion proteins contain SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4 linked in a different order.

(76) All three oligopeptides were coupled to CNBr-activated Sepharose beads (Pharmacia) at 0.1 mg of each oligopeptide per 1 ml beads under aseptic conditions. After coupling, the oligopeptide-Sepharose was washed extensively with 0.01M Tris-buffered 1.14 M NaCl, pH 8.0 containing 10 mM EDTA to remove noncovalently associated material and packed into 400 ml columns.

(77) The case of ESAMBPCAA apheresis was performed in St. Petersburg Medical Academy, Department of Neurology. We performed the ESAMBPCAA apheresis in 18-year old patient with rapidly progressing severe secondary progressive MS, deemed being resistant to conventional therapy (corticosteroids and immunosuppressants). The patient underwent 5 apheresis cycles, one cycle per week. Patient plasma was separated by a continuous-flow plasma separator, the Cobe Spectra, USA. The blood flow varied from 50 to 70 ml/min. Heparin was also added with an initial bolus of 5000 U, then, in the first phase, 50 U/min by the pump. Plasma was than washed through the Sepharose column, and the rest of blood was returned to the patient. The flow of plasma through the Sepharose column was controlled by a computerized adsorption-desorption device ADAMedicap. Following passage through the column the plasma returned to the patient. In each cycle 3000 ml of plasma was treated. The EDSS score dropped from 6 before the first apheresis to 5.5 two weeks after the last cycle. The control MRI performed one month after the last cycle showed stabilization of the previous lesions with the reduction of two lesions. No new lesions were detected. The rate of MBP-specific auto antibody mediated hydrolysis was assayed as specified in Example 1 before and two weeks after the last apheresis cycle. The data is presented in the Table 6 below.

(78) TABLE-US-00007 TABLE 6 Suppression of MBP-specific auto antibody mediated hydrolysis under the treatment performed. Parameter Before therapy 2 weeks following last cycle ESAMBPCAA 87 pmol/min/nmol 15 pmol/min/nmol IgG 410 mg/dL 395 mg/dL IgA 53 mg/dL 57 mg/dL IgM 24 mg/dL 22 mg/dL EDSS score 6 5.5

(79) Thus, exposing the blood of MS patient to fusion proteins according the invention suppresses ESAMBPCAA activity and provides effective treatment for MS.

(80) Also, certain other fusion proteins containing SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4 linked in other order (via peptide and non-peptide linkers) were produced and successfully tested for ESAMBPCAA suppressing activity and ability to ameliorate MS symptoms and to decrease MS biomarker.

Example 8

(81) Pharmaceutical Composition Containing Fragments of Oligopeptide

(82) The three oligopeptides of following formulas: GGDRGAPKRGSGKDSHH (SEQ ID NO: 2), GFGYGGRASDYKSAHK (SEQ ID NO: 3) and QGTLSKIFKLGGRDSRSGSPMARR (SEQ ID NO: 4) have been synthesized by the laboratory of solid phase organic synthesis (Shemyakin Ovchinnikov Institute of Bioorganic Chemistry RAS); phospholipids were purchased from SigmaAldrich and Avanti Polar Lipids. 50 g of mixture of egg phosphatidylcholine (PC), Dioleoyl phosphatidylcholine (DOPE) and 1, 2-dioleoyl-3-trimethylammonium-propane (DOTAP) (at 4:2:1 molar ratio) was dissolved in chloroform and then chloroform was removed by evaporation. Oligopeptides 1, 2 and 3 were dissolved in phosphate buffered saline (PBS), PH7, 4 at 5 g/L concentration of each individual oligopeptide (15 g/L total protein). The lipid film in the evaporation vessel was rehydrated by mixing with 10 liters of PBS-peptides solution and 30 min shaking at 40 C. The resulting lipid/protein emulsion was transferred to 10 ml vials and lyophilized. The dry powder was solubilised ex-tempore with 5 ml of water for injection (WFI) to form large multi-lamellar liposomes (LMV) containing the oligopeptides.

Example 9

(83) Treatment of Patients with Relapsing Remitting MS with Oral Liposomal Formulation of Oligopeptides

(84) The trial was performed between April 2003 and June 2005 in St. Petersburg Medical Academy, Department of Neurology. Under the approval of local Ethics Committee totally 15 patients (5 male and 10 female with median age of 32 years) with relapsing-remitting MS (diagnosed according Poster and MacDonald criteria) with at least two documented relapses within two last years and having EDSS (Kurtzke Expanded Disability Status Scale) score from 0 up to 5.5 were recruited to the trial.

(85) Patients were treated by daily oral dosing of liposomes (LMV), manufactured as described in Example 8 at 0.5 mg of protein per kg of body weight. The treatment was performed as monotherapy continuously daily for the period of 2 years.

(86) EDSS scoring were checked once every two month. Brain MRT check for active demyelinization locuses (ADL) was performed once every two month. Analysis of frequency and duration of relapses was performed at the end of 2-year observation period. Blood cell counts, ESAMBPCAA activity, blood biochemistry and immunological parameters were checked at the beginning and the end of the trial.

(87) All 15 patients have stable EDSS score within first 6 month of treatment. The average frequency of relapses decreased from 2.7 per year at inclusion to 1.5 per year at the end of treatment period. During 2 year follow-up period 11 patients were relapse-free. 6 patients (40%) have less ADL at the end of treatment period. 7 patients (47%) have process stabilizationthe same number of ADL. In 2 patients (13%) the ADL count has increased. No adverse events linked to investigational preparation were noted. The immunological parameters, blood biochemistry and blood cell counts were not significantly changed at the end of treatment period. The data is presented in Table 7.

(88) TABLE-US-00008 TABLE 7 Immunological, blood and blood biochemistry parameters at the beginning and at the end of treatment (data average for 15 patients) Parameter Before treatment After treatment CD3 48.75 9.68 52.37 7.37 CD4 29.75 6.43 30.25 4.06 CD8 22.87 5.34 25.5 6.2 CD4/CD8 1.37 0.29 1.29 0.35 IgA 2.88 1.53 2.77 1.46 IgM 1.59 0.71 1.68 0.41 IgG 19.67 6.45 16.00 5.10 HLADR 23.13 5.38 21.25 5.88 ESAMBPCAA 45.1 6.2 12.5 4.5 HB 128.86 14.73 126.57 20.08 WBC 5.69 1.38 5.04 0.98 Lymphocytes % 28.29 8.94 25.36 5.12 ALT 0.29 0.20 0.21 0.07 AST 0.25 0.12 0.19 0.06 Bilirubin 12.36 4.17 10.39 2.67 Urea 3.62 1.67 4.11 1.16 Creatinine 0.07 0.02 0.08 0.01

(89) Lower rate of MBP-specific auto antibody mediated hydrolysis was noted and that was in coincidence with significant curative effect achieved. Thus, the oral intake of oligopeptides according to present invention has favorable therapeutic performance associated with decrease of ESAMBPCAA activity. Under comparison with retrospective data available, results of treatment according the present invention shows better results than those of Beta-Interferon, which is existing standard of MS therapy. The comparison table 8 is presented below.

(90) TABLE-US-00009 TABLE 8 Comparative data on clinical efficacy of currently available standard treatment regimes of MS and results of treatment according Example 8. MRI Data: decrease Adverse Treatment Clinical Observations of active lesions Reactions Reference Copolymer 1 Decrease of relapse No statistical Low Johnson K P, Brooks B R, Cohen J A, Ford C C, frequency29%; significant Goldstein J, Lisak P P et al. Copolymer-1 reduces relapse Slowing EDSS decrease rate and improves disability in relapsing-remitting multiple score progression sclerosis: Results of a phase III multicentre, double-blind, placebo controlled trial. The copolymer-1 multiple sclerosis study group. Neurology 1995; 45: 1268. Beta- Decrease of relapse 83% decrease High Paty D W, Li D K B, the UBC MS/MRI Study Group and the Interferon frequency83%; Interferon Beta Multiple Sclerosis Study Group. No slowing EDSS Interferon beta-1b is effective in relapsing-remitting multiple score progression sclerosis. II. MRI results of a multi-centred, double-blind, placebo-controlled trial. Neurology 1993; 43: 662-7 Oligopeptides Decrease of relapse 75% decrease No Example 8 according the frequency87%; invention Slowing EDSS score progression

Example 10

(91) Female Dark Agouti (DA) Rats, 8-9 weeks of age, about 110-145 g of weight were used as test animals.

(92) For induction of Experimental Allergic Encephalomyelitis (EAE), rats were injected intradermally at the base of the tail with a total volume of 200 l of inoculum containing 50 g of MBP 63-81 (ANASPEC), in saline mixed (1:1) with Complete Freund Adjuvant, (IFA, Sigma), and 1 mg killed M. tuberculosis strain (strain H37 RA; Difco Laboratories, Detroit, Mich.). Beginning 24 hours after EAE induction the rats were followed up daily. On day 9 after the after EAE induction more than 50% of the rats developed signs of paralysis. The animals with multiple sclerosis signs were separated into 10 groups for beginning of treatment. Prior to treatment, blood was collected from 2 rats from each group. At day 9 and 11 after EAE induction, 90% of rats developed signs of EAE.

(93) 9-11 days after EAE induction the animals were divided into 9 groups (5-6 rats in each). Each group of rats was treated subcutaneously once daily with different claimed oligopeptide or theirs combinations (equimolar mix) (150 g) or doses of positive control item (Glatiramer acetate, Copaxone, Teva) or negative control item (0.9% Sodium chloride solution), during 6 days as follows:

(94) Group 1Negative control (0.9% Sodium chloride solution);

(95) Group 2Positive control(Copaxone)

(96) Group 3Oligopeptide GGDRGAPKRGSGKDSHH

(97) Group 4Oligopeptide GFGYGGRASDYKSAHK

(98) Group 5Oligopeptide QGTLSKIFKLGGRDSRSGSPMARR

(99) Group 6Equimolar mix (1:1; mol/mol) of oligopeptide GGDRGAPKRGSGKDSHH and oligopeptide GFGYGGRASDYKSAHK, correspondingly

(100) Group 7Equimolar 1 mix (1:1; mol/mol) of oligopeptide GGDRGAPKRGSGKDSHH and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR

(101) Group 8Equimolar mix (1:1:1; mol/mol/mol) of oligopeptide GGDRGAPKRGSGKDSHH and oligopeptide GFGYGGRASDYKSAHK and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR

(102) Group 9Equimolar mix (1:1; mol/mol) of oligopeptide GFGYGGRASDYKSAHK and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR

(103) Copaxone, claimed oligopeptide and combinations thereof (Mechanical mix) were diluted with 0.9% Sodium chloride to a concentration of 450 g/ml. Volume of 0.33 ml (150 g/rat/day) was injected SC during 6 days.

(104) After 6 days of the injections cycle the animals were maintained and followed up till day 28.sup.th post EAE induction. Clinical signs score was performed daily during study periods. Animals were observed individually during all study periods. In cases of extended observation period clinical signs were recorded once daily. Observations included changes in the fur, eyes, respiratory rate, vocalization, paralysis, activity and behavior pattern. Score of paralysis signs related to MS of each animal was done daily (during all study periods).

(105) Score gradation was as follows: 0Normal; 1Tail weakness; 2Hind leg weakness or paralysis; 3Hind leg paralysis, dragging hind limbs; 4Complete paralysis, unable to move; 5Death.

(106) At 28.sup.th day after EAE induction the animals were sacrificed, blood was collected from rats' hearts. The animals were perfused with 4% PFA, brain and spinal cord were collected and fixed in 4% formaldehyde.

(107) The results are presented at Table 9 below.

(108) TABLE-US-00010 TABLE 9 Influence of performed treatment on clinical signs score Clinical signs score on Group day 23 after induction (mean) Group 1 1.7 Group 2 1.1 Group 3 0.5 Group 4 0.9 Group 5 0.8 Group 6 0.3 Group 7 0.3 Group 8 0.1 Group 9 0.9

(109) Thus, EAE clinical signs are most efficiently suppressed by oligopeptide GGDRGAPKRGSGKDSHH alone or in combination with oligopeptide GFGYGGRASDYKSAHK and/or oligopeptide QGTLSKIFKLGGRDSRSGSPMARR.

(110) Oligopeptides GFGYGGRASDYKSAHK and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR alone or in combination has moderate therapeutic effect. Combination of oligopeptide GGDRGAPKRGSGKDSHH with oligopeptide GFGYGGRASDYKSAHK and oligopeptide QGTLSKIFKLGGRDSRSGSPMARR has most beneficial therapeutic effect; i.e. oligopeptide QGTLSKIFKLGGRDSRSGSPMARR and/or oligopeptide GFGYGGRASDYKSAHK unexpectedly multiply the positive clinical effect of oligopeptide GGDRGAPKRGSGKDSHH.

(111) The foregoing description of the present invention provides illustration and description, but is not intended to be exhaustive or to limit the invention to the precise one disclosed. Modifications and variations are possible consistent with the above teachings or may be acquired from practice of the invention. Thus, it is noted that the scope of the invention is defined by the claims and their equivalents.