THERMOSTABLE RUBISCO ACTIVASE COMPLEXES
20180037904 ยท 2018-02-08
Assignee
Inventors
Cpc classification
C12N15/8271
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to Rubisco activase (RCA) and functionally equivalent polypeptides that confer thermostability to a complex comprising Rubisco activase and Ribulose-1,5-bis-phosphate carboxylase/oxygenase (Rubisco).
Claims
1. A complex comprising a Rubisco activase (RCA) from Oryza australiensis and a Ribulose-1,5-bis-phosphate carboxylase/oxygenase (Rubisco) from a plant other than O. australiensis wherein the RCA confers thermostability to the complex.
2. The complex of claim 1, wherein the RCA comprises at least one of SEQ ID NOs: 2 to 37, 39 or 40.
3. The complex of claim 2 having at least 90%, at least 95%, at least 99% or 100% sequence identity to SEQ ID NOs: 39 or 40.
4. The complex according to claim 1 being formed in a modified or transgenic plant.
5. Isolated RCA from Oryza australiensis, or functional variants thereof, capable of forming a complex with a Rubisco from a plant other than O. australiensis and conferring thermostability to the complex.
6. The RCA of claim 5 comprising at least one of SEQ ID NOs: 2 to 37, 39 or 40.
7. The RCA of claim 5 having at least 90%, at least 95%, at least 99% or 100% sequence identity to SEQ ID NO: 39 or 40.
8. An isolated nucleic acid encoding the RCA of claim 5.
9. The isolated nucleic acid according to claim 8 comprising one or more of SEQ ID NOs: 41, 42, 50, 51 and 52.
10. (canceled)
11. The isolated nucleic acid according to claim 9 having at least 90%, at least 95%, at least 99% or 100% sequence identity to SEQ ID NOs: 41, 42, 50, 51 or 52.
12. A chimeric gene or vector comprising the nucleic acid of claim 8.
13. The chimeric gene or vector of claim 12 wherein the nucleic acid is operably linked to a promoter, preferably a plant expressible promoter.
14. The chimeric gene or vector of claim 13 wherein the promoter is a heat-inducible promoter, green-tissue promoter or a chemical-inducible promoter.
15. A host cell comprising the complex of claim 1, the RCA of claim 5, the nucleic acid of claim 8 or the chimeric gene or vector of claim 12.
16. The host cell of claim 15, wherein the host cell is a plant cell.
17. A plant or plant cell comprising the complex of claim 1 wherein the plant or plant cell is other than O. australiensis.
18. The plant according to claim 17 selected from the group consisting of barley, maize, tomato, potato, rice, soybean, cotton, sunflower, alfalfa, lettuce, canola (oilseed rape), sorghum, and wheat.
19. The plant according to claim 18 being rice or wheat.
20. (canceled)
21. A method of enhancing heat tolerance in a plant comprising expressing the RCA of any claim 5 in the plant.
22. The method of claim 21 further comprising providing the plant with a nucleic acid of claim 7 or the chimeric gene or vector of claim 12.
23. The method of claim 21 wherein the plant is capable of fixing carbon dioxide in heat stress conditions.
24. The method of claim 21 wherein the RCA is expressed in one or more plastids of the plant.
25. The method of claim 21 wherein expressing the RCA results in an increase in the rate of photosynthesis under heat stress conditions.
26. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
MODE(S) FOR CARRYING OUT THE INVENTION
[0064] The present invention relates to RCA (Rubisco activase) and functionally equivalent polypeptides that confer thermostability to a complex comprising RCA (or a functionally equivalent polypeptide) and Rubisco.
Rubisco Activase (RCA) Polypeptides and Nucleic Acids
[0065] In some embodiments, the complexes comprise O. australiensis RCA or an RCA comprising at least one of SEQ ID NOs: 2-37, 39, 40 and 50 to 52 in Table 1, Table 2 and Table 6.
TABLE-US-00001 TABLE1 Sequenceidentification changeinOa occursatthe following SEQ corresponding High High ID positionin heat heat NO Sequence Relativeposition* theOsseq stress.sup.a stress.sup.b 1 SeeTable3 NA 2 ELDEX.sub.1KQTD E.sup.50DEX.sub.1KQTD 54 + + 3 ELDEDKQTD E.sup.50LDEDKQTD 54 + + 4 TDQDKWKGL T.sup.57DQDKWKGL 61 + 5 EX.sub.1KQTDQDKW E.sup.53X.sub.1KQTDQDKW 54,61 + 6 EDKQTDQDKW E.sup.53DKQTDQDKW 54,61 + 7 RGKGX.sub.2VDSL R.sup.78GKGX.sub.2VDSL 82 + 8 RGKGLVDSL R.sup.78GKGLVDSL 82 + 9 FQAPX.sub.3GDGT F.sup.87QAPX.sub.3GDGT 91 + 10 FQAPMGDGT F.sup.87QAPMGDGT 91 + 11 GX.sub.2VDSLFQAPX.sub.3 G.sup.81X.sub.2VDSLFQAPX.sub.3 82,91 + 12 GLVDSLFQAPM G.sup.81LVDSLFQAPM 82,91 + 13 EYLSQGLK E.sup.104YLSQGLK 111 + 14 YLSQGLKX.sub.1 Y.sup.105LSQGLKX.sub.1 111,112 + 15 YLSQGLKM Y.sup.105LSQGLKM 111,112 + 16 LSQGLKX.sub.1X.sub.2 L.sup.106SQGLKX.sub.1X.sub.2 111-113 + 17 LSQGLKML L.sup.106SQGLKML 111-113 + 18 KX.sub.1X.sub.2DNTMGGFY K.sup.111X.sub.1X.sub.2DNTMGGFY 111-113 + 19 KMLDNTMGGFY K.sup.111MLDNTMGGFY 111-113 + 20 X.sub.1X.sub.2DNTMGGFYI X.sub.1.sup.112X.sub.2DNTMGGFYI 112-113 + + 21 MLDNTMGGFYI M.sup.112X.sub.2DNTMGGFYI 112-113 + + 22 X.sub.2DNTMGGFYIA X.sub.2.sup.113DNTMGGFYIA 113 + + 23 LDNTMGGFYIA L.sup.113DNTMGGFYIA 113 + + 24 SQGLKX.sub.1X.sub.2DNTM S.sup.107QGLKX.sub.1X.sub.2DNTM 111-113 + + 25 SQGLKMLDNTM S.sup.107QGLKMLDNTM 111-113 + + 26 KNFMX.sub.4LPNI K.sup.138NFMX.sub.4LPNI 142 + 27 KNFMALPNI K.sup.138NFMALPNI 142 + 28 ELVFSKMGI E.sup.167LVFSKMGI 171 + 29 NIGKKLVNS N.sup.359IGKKLVNS 363 + 30 KMTIDKLME K.sup.378MTIDKLME 382 + + 31 MEYGHMLY M.sup.385EYGHMLY 389 + 32 MLVREQEN M.sup.391VREQEN 393 + 33 DKLMEYGHMLVR D.sup.382KLMEYGHMLVR 382,389,393 + 34 NVKRVQLAD N.sup.397VKRVQLAD 405 + 35 KYLSEAALG K.sup.406YLSEAALG 406 + + 36 VQLADKYLSE V.sup.401QLADKYLSE 405,406 + + 37 GAQQGGNLP G.sup.439AQQGGNLP 434 + 38 SeeTable2 NA 39 SeeTable2 NA 40 SeeTable2 NA 41 SeeTable3 NA 42 SeeTable3 NA 43 SeeTable2 NA 44 SeeTable3 NA 45 SFYGAAPSS S.sup.425FYGAAPSS 429 46 SeeTable5 NA 47 SeeTable5 NA 48 SeeTable5 NA 49 SeeTable5 NA 50 SeeTable6 NA 51 SeeTable6 NA 52 SeeTable6 NA 53 SeeTable7 NA X.sub.1 = charged (K, R, N, M, Q, H, D, E) X.sub.2 = aliphatic (L, I, V) X.sub.3 = positive charged (K, R, N, M, Q, H) X.sub.4 = small (A, G) .sup.a = residue found in relevant position in O. australiensis Rubisco activase .sup.b = residue found in analogous position in Rubisco activase of warm-adapted species Gossypium hirsutum (cotton) and Larrea tridentate (creosote bush). * = Position relative to SEQ ID No: 38 (BAC78572.1)
TABLE-US-00002 TABLE2 RubiscoActivaseRCA(RCA)polypeptideSequences SEQIDNO: Sequence 38 MAAAFSSTVGAPASTPTNFLGKKLKKQVTSAVNYHGKSSNINRFKVMAK ELDEGKQTDQDRWKGLAYDISDDQQDITRGKGFVDSLFQAPTGDGTHEA VLSSYEYLSQGLRTYDFDNTMGGFYIAPAFMDKLVVHISKNFMTLPNIK VPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKL IRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATL MNIADNPTNVQLPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKF YWAPTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARV YDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEKLMEYGYMLV KEQENVKRVQLAEQYLSEAALGDANSDAMKTGSFYGSAPSS 39 MAAAFSSTVGAPASTPTNFLGKKLKKQVTSAVNYHGKSSNINRFKVMAK ELDEDKQTDQDKWKGLAYDISDDQQDITRGKGLVDSLFQAPMGDGTHEA VLSSYEYLSQGLKMLDNTMGGFYIAPAFMDKLVVHISKNFMALPNIKVP LILGIWGGKGQGKSFQCELVFSKMGINPIMMSAGELESGNAGEPAKLIR QRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMN IADNPTNVQLPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKFYW APTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYD DEVRKWVSDTGVENIGKKLVNSREGPPEFEQPKMTIDKLMEYGHMLVRE QENVKRVQLADKYLSEAALGDANSDAMKTGSFYGQGAQQGGNLPVPEGC TDPVAKNFDPTARSDDGSCLYTF 40 MAAAFSSTVGAPASTPTNFLGKKLKKQVTSAVNYHGKSSNINRFKVMAK ELDEDKQTDQDKWKGLAYDISDDQQDITRGKGLVDSLFQAPMGDGTHEA VLSSYEYLSQGLKMLDNTMGGFYIAPAFMDKLVVHISKNFMALPNIKVP LILGIWGGKGQGKSFQCELVFSKMGINPIMMSAGELESGNAGEPAKLIR QRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATLMN IADNPTNVQLPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKFYW APTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYD DEVRKWVSDTGVENIGKKLVNSREGPPEFEQPKMTIDKLMEYGHMLVRE QENVKRVQLADKYLSEAALGDANSDAMKTGSFYGAAPSS 43 MAAAFSSTVGAPASTPTNFLGKKLKKQVTSAVNYHGKSSNINRFKVMAK ELDEGKQTDQDRWKGLAYDISDDQQDITRGKGFVDSLFQAPTGDGTHEA VLSSYEYLSQGLRTYDFDNTMGGFYIAPAFMDKLVVHISKNFMTLPNIK VPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKL IRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNATL MNIADNPTNVQLPGMYNKEDNPRVPIIVTGNDFSTLYAPLIRDGRMEKF YWAPTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARV YDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEKLMEYGYMLV KEQENVKRVQLAEQYLSEAALGDANSDAMKTGSFYGQGAQQAGNLPVPE GCTDPVAKNFDPTARSDDGSCLYTF
TABLE-US-00003 TABLE3 RubiscoActivase(RCA)nucleotidesequences SEQIDNO: Sequence 1 ATGGCTGCTGCCTTCTCCTCCACCGTTGGAGCTCCGGCGTCCACTCCGA CCAACTTCCTGGGGAAGAAGCTGAAAAAGCAGGTGACATCGGCGGTGAA CTACCATGGCAAGAGCTCCAACATCAACAGGTTCAAGGTGATGGCCAAG GAGCTGGACGAGGGCAAGCAGACCGACCAGGACAGGTGGAAGGGTCTCG CCTACGACATCTCCGATGACCAGCAGGACATCACCAGGGGGAAGGGTTT CGTCGACTCCCTTTTCCAGGCTCCCACGGGTGATGGCACCCACGAGGCC GTCCTCAGCTCCTACGAGTACCTCAGCCAGGGTCTCAGAACGTACGACT TCGACAACACCATGGGAGGCTTCTACATCGCCCCTGCTTTCATGGACAA GCTCGTCGTCCACATCTCCAAGAACTTCATGACCCTCCCCAACATCAAG GTCCCACTCATCCTGGGTATCTGGGGAGGCAAGGGTCAGGGAAAATCCT TCCAGTGTGAGCTCGTCTTCGCCAAGATGGGGATCAACCCCATCATGAT GAGCGCCGGAGAGCTGGAGAGCGGCAACGCCGGAGAGCCGGCGAAGCTG ATCAGGCAGCGGTACCGTGAGGCGGCAGACATCATCAAGAAGGGGAAGA TGTGCTGCCTCTTCATCAACGATCTGGACGCGGGTGCAGGTCGCATGGG AGGCACCACCCAGTACACGGTGAACAACCAGATGGTGAACGCCACCCTG ATGAACATCGCCGACAACCCAACCAACGTGCAGCTCCCCGGGATGTACA ACAAGGAGGACAACCCCCGTGTCCCCATCATCGTCACCGGCAACGACTT CTCCACGCTGTACGCGCCGCTCATCCGTGACGGGCGTATGGAGAAGTTC TACTGGGCTCCCACCCGCGACGACCGTGTCGGCGTCTGCAAGGGTATCT TCCGCACCGACAACGTCCCCGACGAGGACATCGTCAAGATCGTCGACAG CTTCCCAGGCCAATCCATCGATTTCTTCGGCGCTCTTCGTGCCCGTGTT TACGACGACGAGGTGCGCAAGTGGGTGTCGGACACGGGTGTGGAGAACA TTGGCAAGAGGCTGGTGAACTCGAGGGAGGGCCCACCGGAGTTCGAGCA GCCCAAGATGACGATCGAAAAGCTCATGGAGTACGGATACATGCTTGTG AAGGAGCAGGAGAACGTCAAGCGTGTGCAGCTGGCTGAGCAGTACTTGA GCGAGGCTGCTCTTGGTGACGCTAACTCCGACGCCATGAAGACTGGTTC CTTCTACGGTTCTGCGCCATCCAGCTGA 41 ATGGCTGCTGCCTTCTCCTCCACCGTTGGAGCTCCGGCCTCCACTCCGA CCAACTTCCTGGGGAAGAAGCTGAAGAAGCAGGTGACATCGGCCGTGAA CTACCATGGCAAGAGCTCCAACATCAACAGGTTCAAAGTGATGGCCAAG GAGCTCGACGAGGACAAGCAGACCGACCAGGACAAGTGGAAGGGTCTCG CCTACGACATCTCCGATGACCAGCAGGACATCACCAGGGGGAAGGGTCT CGTCGACTCCCTCTTCCAGGCTCCCATGGGTGATGGCACCCACGAGGCC GTCCTCAGCTCCTACGAGTACCTCAGCCAGGGTCTCAAAATGTTGGACA ACACCATGGGAGGCTTCTACATCGCCCCGGCTTTCATGGACAAGCTCGT CGTCCACATCTCCAAGAACTTCATGGCCCTCCCCAACATCAAGGTCCCA CTCATCCTGGGTATCTGGGGAGGCAAGGGTCAGGGAAAATCCTTCCAGT GTGAGCTCGTCTTCTCCAAGATGGGGATCAACCCCATCATGATGAGTGC CGGAGAGCTGGAGAGCGGCAACGCCGGAGAGCCCGCGAAGCTCATCAGG CAGCGGTATCGTGAGGCGGCGGACATCATCAAGAAGGGGAAGATGTGCT GCCTCTTCATCAACGATCTCGACGCCGGAGCAGGTCGCATGGGCGGCAC CACCCAGTACACGGTGAACAACCAGATGGTGAACGCCACCCTGATGAAC ATCGCCGACAACCCAACCAACGTGCAGCTGCCGGGCATGTACAACAAGG AGGACAACCCCCGTGTCCCCATCATCGTCACCGGTAACGACTTCTCGAC GCTGTACGCGCCGCTCATCCGTGACGGGCGTATGGAGAAGTTCTACTGG GCTCCCACCCGCGATGACCGTGTCGGCGTCTGCAAGGGTATCTTCCGCA CCGACAACGTCCCCGACGAGGACATCGTCAAAATCGTGGACAGCTTCCC AGGCCAATCCATCGATTTCTTCGGTGCTCTGCGTGCCCGTGTTTACGAC GACGAGGTGCGCAAGTGGGTGTCGGACACCGGTGTGGAGAACATTGGCA AGAAGCTGGTGAACTCGAGGGAGGGCCCACCGGAGTTCGAGCAGCCCAA GATGACGATCGACAAGCTGATGGAGTACGGACACATGCTTGTGAGGGAG CAGGAGAACGTCAAGCGTGTGCAGCTGGCTGACAAGTACTTGAGCGAGG CTGCTCTTGGTGACGCTAACTCCGACGCCATGAAGACTGGTTCCTTCTA CGGTGCTGCGCCATCCAGCTGA 42 ATGGCTGCTGCCTTCTCCTCCACCGTTGGAGCTCCGGCCTCCACTCCGA CCAACTTCCTGGGGAAGAAGCTGAAGAAGCAGGTGACATCGGCCGTGAA CTACCATGGCAAGAGCTCCAACATCAACAGGTTCAAAGTGATGGCCAAG GAGCTCGACGAGGACAAGCAGACCGACCAGGACAAGTGGAAGGGTCTCG CCTACGACATCTCCGATGACCAGCAGGACATCACCAGGGGGAAGGGTCT CGTCGACTCCCTCTTCCAGGCTCCCATGGGTGATGGCACCCACGAGGCC GTCCTCAGCTCCTACGAGTACCTCAGCCAGGGTCTCAAAATGTTGGACA ACACCATGGGAGGCTTCTACATCGCCCCGGCTTTCATGGACAAGCTCGT CGTCCACATCTCCAAGAACTTCATGGCCCTCCCCAACATCAAGGTCCCA CTCATCCTGGGTATCTGGGGAGGCAAGGGTCAGGGAAAATCCTTCCAGT GTGAGCTCGTCTTCTCCAAGATGGGGATCAACCCCATCATGATGAGTGC CGGAGAGCTGGAGAGCGGCAACGCCGGAGAGCCCGCGAAGCTCATCAGG CAGCGGTATCGTGAGGCGGCGGACATCATCAAGAAGGGGAAGATGTGCT GCCTCTTCATCAACGATCTCGACGCCGGAGCAGGTCGCATGGGCGGCAC CACCCAGTACACGGTGAACAACCAGATGGTGAACGCCACCCTGATGAAC ATCGCCGACAACCCAACCAACGTGCAGCTGCCGGGCATGTACAACAAGG AGGACAACCCCCGTGTCCCCATCATCGTCACCGGTAACGACTTCTCGAC GCTGTACGCGCCGCTCATCCGTGACGGGCGTATGGAGAAGTTCTACTGG GCTCCCACCCGCGATGACCGTGTCGGCGTCTGCAAGGGTATCTTCCGCA CCGACAACGTCCCCGACGAGGACATCGTCAAAATCGTGGACAGCTTCCC AGGCCAATCCATCGATTTCTTCGGTGCTCTGCGTGCCCGTGTTTACGAC GACGAGGTGCGCAAGTGGGTGTCGGACACCGGTGTGGAGAACATTGGCA AGAAGCTGGTGAACTCGAGGGAGGGCCCACCGGAGTTCGAGCAGCCCAA GATGACGATCGACAAGCTGATGGAGTACGGACACATGCTTGTGAGGGAG CAGGAGAACGTCAAGCGTGTGCAGCTGGCTGACAAGTACTTGAGCGAGG CTGCTCTTGGTGACGCTAACTCCGACGCCATGAAGACTGGTTCCTTCTA CGGGCAAGGAGCACAGCAAGGAGGTAACCTGCCTGTGCCGGAAGGTTGC ACCGACCCTGTTGCCAAGAACTTCGACCCAACGGCGAGGAGCGACGACG GCAGCTGCCTTTACACCTTTTAA 44 ATGGCTGCTGCCTTCTCCTCCACCGTTGGAGCTCCGGCGTCCACTCCGA CCAACTTCCTGGGGAAGAAGCTGAAGAAGCAGGTGACATCGGCGGTGAA CTACCATGGCAAGAGCTCCAACATCAACAGGTTCAAGGTGATGGCCAAG GAGCTGGACGAGGGCAAGCAGACCGACCAGGACAGGTGGAAGGGTCTCG CCTACGACATCTCCGATGACCAGCAGGACATCACCAGGGGGAAGGGTTT CGTCGACTCCCTTTTCCAGGCTCCCACGGGTGATGGCACCCACGAGGCC GTCCTCAGCTCCTACGAGTACCTCAGCCAGGGTCTCAGAACGTACGACT TCGACAACACCATGGGAGGCTTCTACATCGCCCCTGCTTTCATGGACAA GCTCGTCGTCCACATCTCCAAGAACTTCATGACCCTCCCCAACATCAAG GTCCCACTCATCCTGGGTATCTGGGGAGGCAAGGGTCAGGGAAAATCCT TCCAGTGTGAGCTCGTCTTCGCCAAGATGGGGATCAACCCCATCATGAT GAGCGCCGGAGAGCTGGAGAGCGGCAACGCCGGAGAGCCGGCGAAGCTG ATCAGGCAGCGGTACCGTGAGGCGGCAGACATCATCAAGAAGGGGAAGA TGTGCTGCCTCTTCATCAACGATCTGGACGCGGGTGCAGGTCGCATGGG AGGCACCACCCAGTACACGGTGAACAACCAGATGGTGAACGCCACCCTG ATGAACATCGCCGACAACCCAACCAACGTGCAGCTCCCCGGGATGTACA ACAAGGAGGACAACCCCCGTGTCCCCATCATCGTCACCGGCAACGACTT CTCCACGCTGTACGCGCCGCTCATCCGTGACGGGCGTATGGAGAAGTTC TACTGGGCTCCCACCCGCGACGACCGTGTCGGCGTCTGCAAGGGTATCT TCCGCACCGACAACGTCCCCGACGAGGACATCGTCAAGATCGTCGACAG CTTCCCAGGCCAATCCATCGATTTCTTCGGCGCTCTTCGTGCCCGTGTT TACGACGACGAGGTGCGCAAGTGGGTGTCGGACACGGGTGTGGAGAACA TTGGCAAGAGGCTGGTGAACTCGAGGGAGGGCCCACCGGAGTTCGAGCA GCCCAAGATGACGATCGAAAAGCTCATGGAGTACGGATACATGCTTGTG AAGGAGCAGGAGAACGTCAAGCGTGTGCAGCTGGCTGAGCAGTACTTGA GCGAGGCTGCTCTTGGTGACGCTAACTCCGACGCCATGAAGACTGGTTC CTTCTACGGGCAAGGAGCACAGCAAGCAGGTAACCTGCCTGTGCCGGAA GGTTGCACCGACCCTGTTGCCAAGAACTTCGACCCAACGGCGAGGAGCG ACGACGGCAGCTGCCTTTACACCTTTTAA
TABLE-US-00004 TABLE 4 Sequence information SEQ ID NO: Information 1 Nucleotide sequence of short form of Rubisco activase from O. sativa ssp. japonica cv. Nipponbare 38 Amino acid sequence Rubisco activase from O. sativa ssp. japonica cv. Nipponbare (>gi |8918361| dbj | BAA97584.1| ribulose-bisphosphate carboxylase activase small isoform precursor protein [Oryza sativa japonica subspecies]) 39 Amino acid sequence of long form of Rubisco activase from O. australiensis 40 Amino acid sequence of short form of Rubisco activase from O. australiensis 41 Nucleotide sequence of short form of Rubisco activase nucleic acid from O. australiensis 42 Nucleotide sequence of long form of Rubisco activase nucleic acid from O. australiensis 43 Amino acid sequence of Rubisco activase from O. sativa ssp. japonica cv. Nipponbare (>gi |32352158| dbj | BAC78572.1) Rubisco activase long isoform precursor protein [Oryza sativa japonica subspecies]) 44 Nucleotide sequence of long form of Rubisco activase from O. sativa ssp. japonica cv. Nipponbare 50 Nucleotide sequence of long form of Rubisco activase nucleic acid from O. australiensis (adapted to rice codon usage), used for vector pTNVS299 51 Nucleotide sequence of short form of Rubisco activase nucleic acid from O. australiensis (adapted to rice codon usage) with a 5AA truncation at the end of the gene, used for vector pTKAW39 52 Nucleotide sequence of short form of Rubisco activase nucleic acid from O. australiensis (adapted to rice codon usage), used for vector pTKAW40 53 Nucleotide sequence of the promoter of Rubisco activase from O. meridionalis, used for vectors pTNVS299, pTKAW39, pTKAW40 54 Nucleotide sequence of Rubisco activase from O. meridionalis 55 Amino acid sequence of O. meridionalis alpha protein 56 Amino acid sequence of O. meridionalis beta protein 57 Amino acid sequence of Descampsia antarctica protein 58 Amino acid sequence of Gossypium hirsutum protein 59 Amino acid sequence of Larrea tridentata protein 60 Amino acid sequence of Spinacia oleracea protein
TABLE-US-00005 TABLE5 RCAgenesadaptedtoE.coliusage SEQIDNO: Sequence 46 ATGGCTAAAGAACTGGACGAAGGCAAACAGACTGATCAGGACCGCTGGA AAGGTCTGGCCTACGATATTTCCGATGACCAGCAGGATATCACCCGCGG TAAAGGCTTCGTAGATTCTCTGTTCCAGGCGCCAACTGGTGATGGTACT CATGAAGCGGTTCTGAGCTCCTACGAATATCTGAGCCAGGGTCTGCGTA CCTATGACTTCGACAACACTATGGGCGGTTTTTACATCGCTCCGGCTTT CATGGACAAACTGGTCGTCCACATCTCCAAAAACTTCATGACCCTGCCG AACATCAAAGTGCCACTGATTCTCGGCATCTGGGGTGGCAAAGGTCAGG GCAAATCCTTCCAGTGTGAACTGGTCTTCGCGAAAATGGGCATTAACCC GATCATGATGAGCGCAGGTGAACTGGAATCTGGTAACGCCGGTGAACCG GCGAAACTGATTCGTCAGCGTTACCGTGAAGCGGCCGACATCATCAAAA AAGGCAAAATGTGCTGCCTGTTCATCAACGATCTGGATGCTGGTGCAGG TCGTATGGGTGGCACTACCCAGTATACCGTGAACAACCAGATGGTTAAC GCCACCCTGATGAACATTGCCGATAACCCGACTAACGTACAGCTGCCGG GCATGTATAACAAAGAAGACAACCCGCGCGTTCCGATCATTGTTACCGG CAACGACTTCTCTACGCTGTATGCTCCGCTGATTCGTGATGGCCGTATG GAGAAATTCTACTGGGCACCAACCCGTGACGACCGTGTTGGTGTATGCA AAGGTATCTTCCGCACCGATAACGTTCCGGACGAAGACATCGTCAAAAT CGTGGACAGCTTTCCGGGCCAGTCTATCGATTTCTTTGGCGCTCTGCGT GCTCGTGTTTACGACGACGAAGTTCGCAAATGGGTGTCTGATACGGGTG TGGAAAACATCGGCAAACGTCTGGTTAACTCTCGTGAAGGTCCACCGGA GTTCGAACAGCCGAAAATGACGATCGAGAAACTGATGGAGTACGGCTAC ATGCTGGTGAAAGAGCAGGAGAACGTGAAACGTGTACAGCTGGCAGAAC AGTACCTGAGCGAAGCTGCACTGGGTGATGCGAACTCTGACGCGATGAA AACTGGCTCCTTTTATGGTCAGGGTGCACAGCAGGCAGGTAACCTCCCA GTACCAGAAGGTTGTACCGACCCAGTTGCGAAAAACTTTGACCCAACCG CTCGCTCTGATGACGGTTCTTGCCTGTACACCTTCTAA 47 ATGGCCAAAGAACTGGACGAAGACAAACAGACCGACCAGGACAAATGGA AAGGTCTGGCGTACGACATCTCTGATGACCAGCAGGATATCACCCGTGG CAAAGGCCTGGTAGATTCTCTGTTCCAGGCTCCGATGGGTGATGGTACT CATGAGGCGGTTCTGTCTTCCTATGAGTACCTGAGCCAGGGCCTGAAAA TGCTGGATAACACTATGGGTGGCTTCTACATTGCACCGGCCTTTATGGA CAAACTGGTCGTCCACATCTCCAAAAACTTCATGGCCCTGCCGAACATC AAAGTCCCGCTGATTCTGGGTATTTGGGGTGGCAAAGGTCAGGGCAAAT CCTTCCAGTGCGAACTGGTCTTCAGCAAAATGGGCATCAACCCGATCAT GATGAGCGCTGGTGAACTGGAATCTGGTAACGCTGGCGAACCGGCTAAA CTGATTCGTCAGCGTTACCGCGAAGCGGCCGACATCATCAAAAAAGGCA AAATGTGCTGCCTGTTCATCAACGATCTGGATGCAGGTGCAGGTCGTAT GGGTGGCACTACCCAGTATACCGTGAACAACCAGATGGTGAACGCGACC CTGATGAACATCGCGGATAACCCAACCAACGTTCAGCTGCCGGGCATGT ACAACAAAGAAGACAACCCGCGTGTCCCGATTATCGTTACCGGCAACGA CTTCTCCACTCTCTATGCTCCGCTGATCCGTGACGGCCGTATGGAAAAA TTCTACTGGGCACCGACTCGCGACGATCGTGTAGGCGTGTGTAAAGGTA TCTTCCGTACCGACAACGTCCCAGACGAGGACATTGTGAAAATCGTGGA CAGCTTTCCGGGCCAGTCTATTGATTTCTTTGGCGCTCTGCGTGCACGT GTATACGACGATGAAGTCCGCAAATGGGTTAGCGACACGGGTGTTGAGA ACATCGGCAAAAAACTGGTGAACTCCCGTGAAGGTCCACCGGAATTTGA GCAGCCGAAAATGACGATCGACAAACTGATGGAGTACGGTCACATGCTG GTACGCGAACAGGAAAACGTGAAACGTGTGCAGCTGGCGGATAAATACC TGAGCGAAGCAGCTCTGGGTGATGCTAACTCCGATGCGATGAAAACCGG CTCTTTCTATGGTCAGGGTGCACAGCAGGGCGGTAACCTGCCAGTACCG GAAGGTTGTACTGATCCGGTTGCGAAAAACTTCGATCCAACGGCTCGCT CTGATGACGGTTCTTGCCTCTATACCTTTGCGGGTCGCTAA 48 ATGGCTAAAGAACTGGACGAAGGCAAACAGACTGATCAGGACCGCTGGA AAGGTCTGGCCTACGATATTTCCGATGACCAGCAGGATATCACCCGCGG TAAAGGCTTCGTAGATTCTCTGTTCCAGGCGCCAACTGGTGATGGTACT CATGAAGCGGTTCTGAGCTCCTACGAATATCTGAGCCAGGGTCTGCGTA CCTATGACTTCGACAACACTATGGGCGGTTTTTACATCGCTCCGGCTTT CATGGACAAACTGGTCGTCCACATCTCCAAAAACTTCATGACCCTGCCG AACATCAAAGTGCCACTGATTCTCGGCATCTGGGGTGGCAAAGGTCAGG GCAAATCCTTCCAGTGTGAACTGGTCTTCGCGAAAATGGGCATTAACCC GATCATGATGAGCGCAGGTGAACTGGAATCTGGTAACGCCGGTGAACCG GCGAAACTGATTCGTCAGCGTTACCGTGAAGCGGCCGACATCATCAAAA AAGGCAAAATGTGCTGCCTGTTCATCAACGATCTGGATGCTGGTGCAGG TCGTATGGGTGGCACTACCCAGTATACCGTGAACAACCAGATGGTTAAC GCCACCCTGATGAACATTGCCGATAACCCGACTAACGTACAGCTGCCGG GCATGTATAACAAAGAAGACAACCCGCGCGTTCCGATCATTGTTACCGG CAACGACTTCTCTACGCTGTATGCTCCGCTGATTCGTGATGGCCGTATG GAGAAATTCTACTGGGCACCAACCCGTGACGACCGTGTTGGTGTATGCA AAGGTATCTTCCGCACCGATAACGTTCCGGACGAAGACATCGTCAAAAT CGTGGACAGCTTTCCGGGCCAGTCTATCGATTTCTTTGGCGCTCTGCGT GCTCGTGTTTACGACGACGAAGTTCGCAAATGGGTGTCTGATACGGGTG TGGAAAACATCGGCAAACGTCTGGTTAACTCTCGTGAAGGTCCACCGGA GTTCGAACAGCCGAAAATGACGATCGAGAAACTGATGGAGTACGGCTAC ATGCTGGTGAAAGAGCAGGAGAACGTGAAACGTGTACAGCTGGCAGAAC AGTACCTGAGCGAAGCTGCACTGGGTGATGCGAACTCTGACGCGATGAA AACTGGCTCCTTTTATGGTTCCGCGCCGTCTTCCTAA 49 ATGGCCAAAGAACTGGACGAAGACAAACAGACCGACCAGGACAAATGGA AAGGTCTGGCGTACGACATCTCTGATGACCAGCAGGATATCACCCGTGG CAAAGGCCTGGTAGATTCTCTGTTCCAGGCTCCGATGGGTGATGGTACT CATGAGGCGGTTCTGTCTTCCTATGAGTACCTGAGCCAGGGCCTGAAAA TGCTGGATAACACTATGGGTGGCTTCTACATTGCACCGGCCTTTATGGA CAAACTGGTCGTCCACATCTCCAAAAACTTCATGGCCCTGCCGAACATC AAAGTCCCGCTGATTCTGGGTATTTGGGGTGGCAAAGGTCAGGGCAAAT CCTTCCAGTGCGAACTGGTCTTCAGCAAAATGGGCATCAACCCGATCAT GATGAGCGCTGGTGAACTGGAATCTGGTAACGCTGGCGAACCGGCTAAA CTGATTCGTCAGCGTTACCGCGAAGCGGCCGACATCATCAAAAAAGGCA AAATGTGCTGCCTGTTCATCAACGATCTGGATGCAGGTGCAGGTCGTAT GGGTGGCACTACCCAGTATACCGTGAACAACCAGATGGTGAACGCGACC CTGATGAACATCGCGGATAACCCAACCAACGTTCAGCTGCCGGGCATGT ACAACAAAGAAGACAACCCGCGTGTCCCGATTATCGTTACCGGCAACGA CTTCTCCACTCTCTATGCTCCGCTGATCCGTGACGGCCGTATGGAAAAA TTCTACTGGGCACCGACTCGCGACGATCGTGTAGGCGTGTGTAAAGGTA TCTTCCGTACCGACAACGTCCCAGACGAGGACATTGTGAAAATCGTGGA CAGCTTTCCGGGCCAGTCTATTGATTTCTTTGGCGCTCTGCGTGCACGT GTATACGACGATGAAGTCCGCAAATGGGTTAGCGACACGGGTGTTGAGA ACATCGGCAAAAAACTGGTGAACTCCCGTGAAGGTCCACCGGAATTTGA GCAGCCGAAAATGACGATCGACAAACTGATGGAGTACGGTCACATGCTG GTACGCGAACAGGAAAACGTGAAACGTGTGCAGCTGGCGGATAAATACC TGAGCGAAGCAGCTCTGGGTGATGCTAACTCCGATGCGATGAAAACCGG CTCTTTCTATGGTGCAGCGCCGTCTTCCTAA
TABLE-US-00006 TABLE6 RCAgenesadaptedtoricecodonusage SEQIDNO: Sequence 50 ATGGCTGCTGCCTTCTCCTCGACAGTTGGAGCACCTGCCTCTACACCGA CAAACTTCCTGGGCAAGAAGCTGAAGAAGCAAGTGACATCCGCCGTGAA CTACCACGGCAAGAGCTCCAACATAAACCGCTTCAAAGTCATGGCGAAG GAGCTCGATGAGGACAAGCAGACCGATCAGGACAAGTGGAAGGGACTTG CCTACGACATCTCCGATGACCAGCAGGACATTACGAGGGGCAAAGGTTT GGTCGACTCCCTTTTCCAAGCACCAATGGGAGATGGCACGCACGAAGCA GTCCTTAGCTCCTACGAGTACCTCTCCCAGGGCTTGAAGATGTTGGACA ACACTATGGGGGGCTTCTACATCGCACCTGCTTTCATGGACAAGCTCGT CGTCCACATCTCGAAGAACTTCATGGCGCTCCCGAACATAAAGGTGCCA CTGATTCTCGGGATCTGGGGAGGCAAGGGTCAGGGGAAATCCTTCCAGT GTGAGCTCGTCTTCTCCAAGATGGGGATCAACCCCATCATGATGAGCGC CGGAGAACTGGAAAGCGGAAATGCCGGAGAACCAGCGAAACTGATCCGA CAGAGATACCGAGAGGCGGCTGACATCATCAAGAAGGGGAAGATGTGCT GCCTCTTCATCAACGATCTGGATGCGGGAGCTGGCCGAATGGGAGGGAC TACTCAATACACCGTCAACAACCAGATGGTGAACGCGACCCTGATGAAC ATCGCGGATAATCCCACCAACGTGCAACTCCCTGGGATGTACAACAAGG AGGACAATCCGCGAGTCCCCATCATCGTCACGGGCAATGATTTCTCGAC ACTCTACGCCCCGCTTATCCGAGATGGGAGGATGGAGAAGTTCTACTGG GCACCTACCAGAGACGATCGCGTAGGTGTCTGCAAAGGCATCTTTCGCA CTGACAACGTCCCGGATGAGGACATCGTCAAGATCGTCGACAGCTTCCC TGGCCAATCTATCGACTTTTTCGGCGCTCTACGAGCCCGTGTTTACGAT GACGAAGTGCGGAAATGGGTTTCGGATACGGGCGTGGAGAACATTGGCA AGAAACTGGTGAACTCTAGGGAAGGGCCACCTGAGTTCGAACAGCCGAA GATGACGATCGACAAGCTCATGGAGTACGGCCATATGCTCGTGAGGGAG CAGGAGAACGTTAAGCGTGTTCAACTGGCCGACAAGTACCTAAGCGAGG CAGCTTTGGGTGACGCTAACTCCGACGCCATGAAAACTGGTTCCTTCTA CGGGCAAGGAGCACAGCAAGGCGGAAACTTACCTGTGCCGGAAGGTTGC ACTGACCCCGTTGCGAAGAACTTTGACCCAACGGCGAGATCTGACGATG GGAGCTGCCTTTATACCTTTTAA 51 ATGGCTGCTGCCTTCTCCTCGACAGTTGGAGCACCTGCCTCTACACCGA CAAACTTCCTGGGCAAGAAGCTGAAGAAGCAAGTGACATCCGCCGTGAA CTACCACGGCAAGAGCTCCAACATAAACCGCTTCAAAGTCATGGCGAAG GAGCTCGATGAGGACAAGCAGACCGATCAGGACAAGTGGAAGGGACTTG CCTACGACATCTCCGATGACCAGCAGGACATTACGAGGGGCAAAGGTTT GGTCGACTCCCTTTTCCAAGCACCAATGGGAGATGGCACGCACGAAGCA GTCCTTAGCTCCTACGAGTACCTCTCCCAGGGCTTGAAGATGTTGGACA ACACTATGGGGGGCTTCTACATCGCACCTGCTTTCATGGACAAGCTCGT CGTCCACATCTCGAAGAACTTCATGGCGCTCCCGAACATAAAGGTGCCA CTGATTCTCGGGATCTGGGGAGGCAAGGGTCAGGGGAAATCCTTCCAGT GTGAGCTCGTCTTCTCCAAGATGGGGATCAACCCCATCATGATGAGCGC CGGAGAACTGGAAAGCGGAAATGCCGGAGAACCAGCGAAACTGATCCGA CAGAGATACCGAGAGGCGGCTGACATCATCAAGAAGGGGAAGATGTGCT GCCTCTTCATCAACGATCTGGATGCGGGAGCTGGCCGAATGGGAGGGAC TACTCAATACACCGTCAACAACCAGATGGTGAACGCGACCCTGATGAAC ATCGCGGATAATCCCACCAACGTGCAACTCCCTGGGATGTACAACAAGG AGGACAATCCGCGAGTCCCCATCATCGTCACGGGCAATGATTTCTCGAC ACTCTACGCCCCGCTTATCCGAGATGGGAGGATGGAGAAGTTCTACTGG GCACCTACCAGAGACGATCGCGTAGGTGTCTGCAAAGGCATCTTTCGCA CTGACAACGTCCCGGATGAGGACATCGTCAAGATCGTCGACAGCTTCCC TGGCCAATCTATCGACTTTTTCGGCGCTCTACGAGCCCGTGTTTACGAT GACGAAGTGCGGAAATGGGTTTCGGATACGGGCGTGGAGAACATTGGCA AGAAACTGGTGAACTCTAGGGAAGGGCCACCTGAGTTCGAACAGCCGAA GATGACGATCGACAAGCTCATGGAGTACGGCCATATGCTCGTGAGGGAG CAGGAGAACGTTAAGCGTGTTCAACTGGCCGACAAGTACCTAAGCGAGG CAGCTTTGGGTGACGCTAACTCCGACGCCATGAAAACTGGTTCCTTCTA CGGGTAA 52 ATGGCTGCTGCCTTCTCCTCGACAGTTGGAGCACCTGCCTCTACACCGA CAAACTTCCTGGGCAAGAAGCTGAAGAAGCAAGTGACATCCGCCGTGAA CTACCACGGCAAGAGCTCCAACATAAACCGCTTCAAAGTCATGGCGAAG GAGCTCGATGAGGACAAGCAGACCGATCAGGACAAGTGGAAGGGACTTG CCTACGACATCTCCGATGACCAGCAGGACATTACGAGGGGCAAAGGTTT GGTCGACTCCCTTTTCCAAGCACCAATGGGAGATGGCACGCACGAAGCA GTCCTTAGCTCCTACGAGTACCTCTCCCAGGGCTTGAAGATGTTGGACA ACACTATGGGGGGCTTCTACATCGCACCTGCTTTCATGGACAAGCTCGT CGTCCACATCTCGAAGAACTTCATGGCGCTCCCGAACATAAAGGTGCCA CTGATTCTCGGGATCTGGGGAGGCAAGGGTCAGGGGAAATCCTTCCAGT GTGAGCTCGTCTTCTCCAAGATGGGGATCAACCCCATCATGATGAGCGC CGGAGAACTGGAAAGCGGAAATGCCGGAGAACCAGCGAAACTGATCCGA CAGAGATACCGAGAGGCGGCTGACATCATCAAGAAGGGGAAGATGTGCT GCCTCTTCATCAACGATCTGGATGCGGGAGCTGGCCGAATGGGAGGGAC TACTCAATACACCGTCAACAACCAGATGGTGAACGCGACCCTGATGAAC ATCGCGGATAATCCCACCAACGTGCAACTCCCTGGGATGTACAACAAGG AGGACAATCCGCGAGTCCCCATCATCGTCACGGGCAATGATTTCTCGAC ACTCTACGCCCCGCTTATCCGAGATGGGAGGATGGAGAAGTTCTACTGG GCACCTACCAGAGACGATCGCGTAGGTGTCTGCAAAGGCATCTTTCGCA CTGACAACGTCCCGGATGAGGACATCGTCAAGATCGTCGACAGCTTCCC TGGCCAATCTATCGACTTTTTCGGCGCTCTACGAGCCCGTGTTTACGAT GACGAAGTGCGGAAATGGGTTTCGGATACGGGCGTGGAGAACATTGGCA AGAAACTGGTGAACTCTAGGGAAGGGCCACCTGAGTTCGAACAGCCGAA GATGACGATCGACAAGCTCATGGAGTACGGCCATATGCTCGTGAGGGAG CAGGAGAACGTTAAGCGTGTTCAACTGGCCGACAAGTACCTAAGCGAGG CAGCTTTGGGTGACGCTAACTCCGACGCCATGAAAACTGGTTCCTTCTA CGGGGCCGCGCCGAGCTCCTGA
TABLE-US-00007 TABLE7 PromotorSequenceofRubiscoactivasefromO.meridionalis SEQIDNO: Sequence 53 GCCTCCGATTGATGCTTCACCAAAAAACAATATCAACAGCAGTGCAAAA TTAGAATTTTTGTATTTTTGTGGTAACGCAAACCGGCCATCAAAGGGGA AAAACGTACAATGCTTATGTTGTATGTTAAGAGAAGTTTGTGTGGTGCC AAATGACAGTCCTAGCCTGACGGTTATCGAGAAAGCAGAATATGTGCAG GTGGCAGAGCAAAATATTTGTGGTAGTCCAACTAGAATACAATTTGCAT GCCATGCCTCATCCAAGAAGCCGGGCAACGAGAGGCAGCAAAAGGCTTT TCTGTGGTGATGCAAAATGAAGAGGTTATGTAGTAGCTGAGCTGATGAA GCAACTGGTCGCTAGCTGCCGGCCGGGAGACGAATGTGAGGCAAGGAAA GAAAAGAAAAAACAGAGAGAAAGAGTTGATCAGAAATGGGTGAATTCTG TGGTGAGGAAAGGTCAAGGAACTGAAGCCAAGAGATCCTTCCTACCTAC ACTAATACAATACTCCTAACTCGCTCACAGACTCCGATCCAGGTCCAAG TCATGCTATGCTGTGGATCGGCCGGCCGAGATTGCGCCACGTGTGCAGA ACCCAATCTTCAGCGTGTGGCCTGTGGGGGATCTGGAAGCTGATCCACA GGGAGGGAGGAGTGTGTGCCTCTCACAGCTTCCAACTTCCATGGCGACG TCCAATGCTATTGTATTATTTAAGGCCTACCGCAGCTCGGCCTCTACAC TTTGAGCAGCAGCGGCTGGCCATCATCAGTGATCCTCTACAATCATCGA CTTTCAGCAAATTAAG
[0066] It will be understood that the invention also encompasses complexes comprising Rubisco and RCA, e.g. as represented by SEQ ID NOs: 39 and 40, modified RCA or RCA-derived polypeptides which confer thermostability to the complex. The RCA, modified RCA or RCA-derived polypeptides include variants thereof, including substantially similar sequences, fragments, analogs, homologs, or mutants. The modified RCAs retain at least one function of RCA. These functions include, for example biological activities, such as activation of Rubisco or the ability to form a complex comprising Rubisco. In one embodiment, the polypeptides of the invention are at least 85%, 90%, 95%, 97%, 98% or 99% identical to the polypeptide sequence of any of SEQ ID NOs: 39 and 40. In some embodiments, the polypeptides of the invention are altered at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, positions corresponding to residues 54, 61, 82, 91, 111, 112, 113, 114, 115, 142, 171, 363, 382, 389, 393, 405, 406, 429 of SEQ ID NO: 38 O. sativa RCA. (i.e. the short RCA form) or corresponding to residues 54, 61, 82, 91, 111, 112, 113, 114, 115, 142, 171, 363, 382, 389, 393, 405, 406, 434 of the long form O. sativa RCA (SEQ ID NO: 43).
[0067] It will be understood that the invention also encompasses nucleic acids encoding polypeptides that can form complexes comprising Rubisco and RCA, e.g. as encoded by SEQ ID NOs: 50 to 52, or encoding modified RCA or RCA-derived polypeptides which confer thermostability to the complex. In one embodiment, the nucleic acids encoding polypeptides of the invention are at least 85%, 90%, 95%, 97%, 98% or 99% identical to the nucleic acid sequence of any of SEQ ID NOs: 50 to 52.
[0068] In another embodiment, polypeptides of the invention include fragments of RCA optionally having one or more of the above alterations. These fragments retain at least one function of RCA and are at least 25, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400 or 425 contiguous amino acids in length.
[0069] In another embodiment the RCA polypeptide of the invention comprises SEQ ID NO: 39 or 40.
[0070] In one embodiment, RCA polypeptide of the invention is a fragment that corresponds to a functional domain of RCA including, but not limited to, the ATP binding domain and the domain(s) that interacts with Rubisco. In some embodiments, polypeptides of the invention include domains of RCA such as the central ATPase domain (the AAA+ module), or at least one of the N-terminal P-loop NTPase alpha-beta-alpha subdomain or the C-terminal all-alpha subdomain. In some embodiments polypeptides of the invention include the C-terminal domain and/or the N-terminal domain of RCA. In the O. australiensis alpha RCA sequence, the delineations of the domains are as follows: N-terminal=1-55 residues; AAA+ motif=56-344; ATPase core=181-281; C-terminal=345-464. These delineations are based on the 3D structure of tobacco RCA (Stotz, M. et al. (2011) Nat. Struct. Mol. Biol. 18, 1366-1370) and the amino acid sequence alignment between Oa alpha RCA and tobacco RCA.
[0071] One or more residue substitutions, additions and/or deletions may be introduced into a wild-type RCA. For example 1, 2, 3, or between 4-10 or between 10-20 substitutions can be introduced and/or for example 1, 2, 3, or between 4-10 or between 10-20 additions can be introduced and/or for example 1, 2, 3, or between 4-10 or between 10-20 deletions can be introduced. For example, RCA polypeptides are generated to enhance a desirable characteristic (e.g. thermostability or the ability to form a complex with Rubisco). Alternatively RCA polypeptides may be generated to reduce an undesirable characteristic (e.g. a tendency to aggregate). In one embodiment, RCA polypeptides have improved thermostability over wild-type RCA. In another embodiment, RCA polypeptides of the invention have enzymatic activity under heat stress conditions (up to 40 C.) that is similar to or higher than the enzyme activity of same RCA under normal conditions (e.g. 30 C.).
[0072] Sequence alterations can be introduced by standard techniques such as directed molecular evolution techniques (e.g. DNA shuffling methods), oligonucleotide-directed mutagenesis, chemical mutagenesis, cassette mutagenesis, saturation mutagenesis and gene editing. In some embodiments sequence alterations may lead to one or more conservative or non-conservative amino acid substitutions at targeted sites. In other embodiments random mutagenesis is used to generate RCA nucleic acid molecules.
[0073] A non-conservative amino acid substitution is a substitution in which the amino acid residue is substituted for an amino acid residue with a dissimilar side chain. Amino acid residues with similar side chains are known in the art. For example there are amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid, asparagine, glutamine), uncharged polar side chains (e.g., glycine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0074] Alternatively or in addition to non-conservative amino acid residue substitutions, sequence alterations may lead to conservative amino acid substitutions. A conservative amino acid substitution is one in which the amino acid residue is substituted for an amino acid residue having a similar side chain. Following mutagenesis, the encoded protein can be expressed and the activity of the protein can be determined as described below.
[0075] In one embodiment, the nucleic acid molecules are at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to any of the nucleic acid molecules of SEQ ID NOs: 41, 42, 50, 51 or 52.
[0076] In one embodiment, the nucleic acid molecules are the nucleic acid molecules of SEQ ID NOs: 41, 42, 50, 51 or 52.
[0077] In one embodiment the nucleic acid molecule comprises SEQ ID NO: 51.
[0078] In another embodiment, the nucleic acid molecules encode a polypeptide that has at least one function of RCA (e.g., Rubisco activation) and are at least 100, 250, 500, 750, 1000 or 1250 contiguous nucleotides in length.
[0079] In one embodiment, a nucleic acid molecule of the invention corresponds to a nucleic acid molecule that encodes a functional domain of RCA for example the ATP binding domain and the Rubisco binding domain.
[0080] The invention also provides nucleic acid molecules, chimeric genes and vectors comprising nucleic acid molecules of the invention.
[0081] The invention further provides cells, preferably plant cells, comprising a nucleic acid of the present invention.
Thermostable Complexes Comprising RCA
[0082] The present invention provides thermostable complexes comprising RCA and Rubisco. As used herein, the term improved thermostability refers to the increased ability of a complex comprising RCA of the invention and Rubisco to function under heat stress conditions as compared to a complex comprising O. sativa RCA and Rubisco. In one embodiment complexes comprising RCA polypeptides of the invention have enzymatic activity under heat stress conditions (e.g. 35 C. or higher) that is greater than the enzymatic activity of complexes comprising O. sativa under the same conditions. In another embodiment, complexes comprising RCA polypeptides of the invention have enzymatic activity under heat stress conditions (about 28 C. to about 30 C., or about 30 C. to about 32 C., or about 32 C. to about 34 C., or about 34 C. or about 36 C., or about 34 C. to about 36 C., or about 36 C. to about 38 C., or to about 38 C. to about 40 C., or about 40 C. or higher) that is substantially similar to or higher than the activity of complexes comprising O. sativa RCA under the same conditions.
[0083] In one embodiment the invention provides a thermostable complex comprising an isolated RCA from a first plant species and an isolated Rubisco from a second plant species. For example the complex may comprise an isolated RCA from O. australiensis and an isolated Rubisco from O. sativa. For example the complex may comprise an isolated RCA from one Oryza sp. and an isolated Rubisco from another Oryza sp. It is envisaged that the RCA polypeptides of the invention can be used to form complexes with Rubisco from any plant species, such as other monocot species. In some embodiments the Rubisco in the complex is from barley, maize, tomato, potato, rice, soybean, cotton, sunflower, alfalfa, lettuce, oilseed rape, sorghum, or wheat plants. In particular embodiments the Rubisco in the complex is from barley, sorghum, rice or wheat.
[0084] The complexes may be formed in vitro or in vivo. For example the complexes may be formed in vitro by contacting recombinant O. australiensis RCA with Rubisco from O. sativa present in a leaf extract or Rubisco that has been purified from O. sativa. Alternatively, the complexes may be formed in vivo by expression of an RCA polypeptide of the invention in a plant such that it forms a complex with the endogenous Rubisco of the plant.
[0085] Any method known in the art can be used to assay the activity of complexes comprising RCA polypeptides (including, but not limited to, Rubisco activation and ATP hydrolysis).
[0086] In some embodiments, complexes comprising RCA polypeptides are assayed in vitro. In one embodiment, the complexes, either assembled from isolated components (e.g. those generated by recombinant expression) or complexes purified or extracted from for example, leaf tissue, can be assayed for activation of Rubisco when incubated in a solution comprising deactivated Rubisco, RuBP, ATP, and a source of labeled carbon (e.g., [.sup.14C]NaHCO.sub.3). In this embodiment incorporation of .sup.14C into 3-phosphoglyceric acid can be monitored to assess Rubisco activation. In another embodiment, RCA polypeptides can be assayed for ATP hydrolysis when incubated in a solution comprising ATP. The assays are typically conducted at various temperatures ranging from normal conditions to heat stress conditions.
[0087] In other embodiments, complexes comprising RCA polypeptides are assayed in vivo. Plants which express one or more RCA polypeptides of the invention can be assayed for photosynthesis rate, rate of biomass increase, growth rates, and seed yield under heat stress conditions and compared with plants that express a wild type RCA. The plants may be grown entirely under heat stress conditions or for periods of time under heat stress conditions. In some embodiment heat stress conditions are determined at the leaf surface. Assays for photosynthesis rate, rate of biomass increase, growth rates, and seed yield are known in the art. For example, photosynthesis rates can be measured by analyzing CO.sub.2 fixation. Growth rates may be assessed by measuring the increase in leaf area over time. Seed yield may be assessed by determining seed number and/or seed weight.
Methods of Enhancing Heat Tolerance in Plants
[0088] RCA activates Rubisco in plants and is the rate limiting step especially in heat stress conditions of the photosynthetic process (Salvucci, M. E. & Crafts-Brandner, S. J. (2004) Physiol. Plant. 120, 179-186). In the absence of RCA activity, Rubisco remains inactive and photosynthesis slows or stops. The present inventors have shown that complexes comprising RCA and Rubisco lose activity at high temperatures thereby suggesting that increased temperatures destabilize and/or denature complexes comprising RCA and Rubisco thereby rendering RCA less able or unable to activate Rubisco. Thus the heat tolerance of plants can be increased by the use of complexes comprising RCA polypeptides of the present invention. In particular RCA polypeptides of the invention can be expressed in plants.
[0089] Any method known in the art can be used to express at least one RCA polypeptide in a plant. For example, transgenic plants can be made to express one or more RCA polypeptides in all tissues or in a subset of tissues, preferably those tissues or organelles involved in photosynthesis. An RCA polypeptide may be expressed constitutively or be under the control of an inducible promoter, such as a heat inducible or chemical inducible promoter. In some embodiments, the expression and/or activity of the endogenous RCA of the plant may be reduced or eliminated.
Recombinant Expression
[0090] Nucleic acid molecules and polypeptides of the invention can be expressed recombinantly using standard recombinant DNA and molecular cloning techniques that are well known in the art (e.g., Sambrook, Fritsch, and Maniatis, Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory Press: Cold Spring Harbor, (1989)). Additionally, recombinant DNA techniques known in the art may be used to create nucleic acid constructs suitable for use in making transgenic plants.
[0091] The invention also provides chimeric genes or nucleic acids expressing chimeric proteins or polypeptides, comprising a nucleic acid molecule of the invention, or a variant thereof. The term chimeric gene refers to a nucleic acid molecule formed through the combination of portions of one or more nucleic acids of different origin. A chimeric gene is an artificial gene constructed by operably linking fragments of unrelated genes or other nucleic acid sequences. In other words chimeric gene denotes a gene which is not normally found in a plant species, i.e. it is heterologous with respect to the plant in which it is introduced, or refers to any gene in which the promoter or one or more other regulatory regions of the gene are not associated in nature with a part or all of the transcribed nucleic acid, i.e. are heterologous with respect to the transcribed nucleic acid. More particularly, a chimeric gene is an artificial, i.e. non-naturally occurring, gene produced by an operable linkage of a nucleic acid sequence to be transcribed.
[0092] The invention also provides vectors, preferably expression vectors, comprising a nucleic acid molecule of the invention, or a variant thereof. The term vector refers to a polynucleotide capable of being used to maintain another nucleic acid to which it has been linked. For example a typical vector is a plasmid or a virus.
[0093] The invention provides recombinant expression vectors and chimeric genes or nucleic acid molecules that comprise a nucleic acid molecule encoding an RCA polypeptide of the invention in a form suitable for expression in a host cell. It will be understood by a skilled person that the choice of components of the chimeric gene and expression vector will depend on such factors as the host cell to be transformed, the level of expression of polypeptide desired, the tissue within the organism in which expression is desired, etc. Typically, recombinant expression vectors or chimeric genes can be introduced into host cells to produce proteins or peptides, including fusion proteins or peptides.
[0094] The recombinant expression vectors or chimeric genes or nucleic acid molecules can be for expression of an RCA polypeptide in prokaryotic (e.g. bacteria or yeast) or eukaryotic cells (e.g. insect, mammalian or plant cells). Alternatively, the recombinant expression vectors can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
[0095] In some embodiments, a nucleic acid molecule of the invention can be expressed in plant cells using a recombinant expression vector or chimeric gene or nucleic acid molecule designed for use in plants, for example, tobacco mosaic virus and potato virus expression vectors or any other plant expression vector known in the art.
[0096] A number of promoters known in the art can be used to express the nucleic acids of the invention for example the promoters may be constitutive, tissue-specific or inducible.
[0097] A tissue-specific promoter may direct expression of nucleic acids of the present invention in a specific tissue, organ or cell type. A tissue-specific promoter may also be an inducible promoter. Alternatively a constitutive promoter is defined as a promoter which will direct expression of a gene in all tissues and are active under most environmental conditions and states of development or cell differentiation.
[0098] The term inducible promoter refers to a promoter that is under precise environmental or developmental control. In particular embodiments the inducible promoter may be a chemically-inducible promoter or a heat-inducible promoter or a light-inducible promoter. Examples of chemically-inducible promoters in plants include promoters which are inducible upon exposure to chemical reagents which can be applied to the plant, such as herbicides or antibiotics. For example, the maize In2-2 promoter, activated by benzenesulfonamide herbicide safeners, can be used (De Veylder (1997) Plant Cell Physiol. 38:568-577); application of different herbicide safeners induces distinct gene expression patterns, including expression in the root, hydathodes, and the shoot apical meristem. Coding sequence can be under the control of, e.g., a tetracycline-inducible promoter, e.g., as described with transgenic tobacco plants containing the Avena sativa L. (oat) arginine decarboxylase gene (Masgrau (1997) Plant J. 11:465-473); or, a salicylic acid-responsive element (Stange (1997) Plant J. 11:1315-1324). Using chemically (e.g. hormone or pesticide)-induced promoters, i.e., promoters responsive to a chemical which can be applied to the transgenic plant in the field, expression of a polypeptide of the invention can be induced at a particular stage of development of the plant. Use may also be made of the estrogen-inducible expression system as described in U.S. Pat. No. 6,784,340 and Zuo et al. (2000, Plant J. 24: 265-273) to drive the expression of the nucleic acids used to practice the invention.
[0099] Examples of heat-inducible promoters in plants include the heat shock promoters for example the promoter of Hsp90p or other heat-inducible promoters such as those for genes OsHsfB2cp and PM19p.
[0100] Examples of light-inducible promoters include e.g. green-tissue promoters like the pea rbcS-3A promoter (Kuhlemeier et al. (1989) Plant Cell 1: 471-478), and the maize rbcS promoter (Schaffher and Sheen (1991) Plant Cell 3: 997-1012).
[0101] One aspect of the invention pertains to host cells into which a nucleic acid encoding an RCA polypeptide of the invention has been introduced. Introduction of the nucleic acid into the cell can be by any means known in the art, for example using microinjection; Agrobacterium-mediated transformation; direct gene transfer; ballistic particle acceleration; virus-mediated transformation; chloroplast transformation or electroporation. The term host cell refers to the particular subject cell and to the progeny or potential progeny of such a cell. Modifications may occur in subsequent generations of a host cell for example due to either mutation or environmental influences, and thus the subsequent generations may not, in fact, be identical to the original host cell, but are still included within the scope of the term as used herein.
[0102] In other embodiments a nucleic acid of the invention may be introduced into a plant or plant cell by crossing a plant containing the nucleic acid with another plant that doesn't contain the nucleic acid so that at least some of the progeny of the crossing contain the nucleic acid.
[0103] Accordingly, the invention provides plants and plant cells comprising a nucleic acid of the invention.
Production of Plants
[0104] The RCA polypeptides and nucleic acids of the invention may be useful for producing transgenic plants. Any method known in the art can be used for transforming a plant or plant cell with a nucleic acid molecule of the present invention. Nucleic acid molecules can be incorporated into plant DNA (e.g., genomic DNA or chloroplast DNA) or be maintained without insertion into the plant DNA (e.g., through the use of artificial chromosomes). Suitable methods of introducing nucleic acid molecules into plant cells include microinjection; Agrobacterium-mediated transformation; direct gene transfer; ballistic particle acceleration; virus-mediated transformation; chloroplast transformation; and electroporation. The choice of transformation method used will vary depending on the type of plant or plant cell (e.g. monocot or dicot) to be transformed.
[0105] Transformed plant cells which are derived by any of the above transformation techniques can be cultured to regenerate a whole plant which possesses the transformed genotype and thus the desired phenotype. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically relying on a biocide and/or herbicide marker that has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in the art. Regeneration can also be achieved from plant callus, explants, organs, or parts thereof. Regeneration techniques are also known in the art.
[0106] In some embodiments the plant cells of the invention are non-propagating plant cells.
[0107] Plants comprising RCA polypeptides and nucleic acids of the invention may be produced by crossing a plant containing the nucleic acid with another plant that doesn't contain the nucleic acid so that at least some of the progeny of the crossing contain the nucleic acid.
[0108] As used herein the term plant refers to whole plants, shoot vegetative organs/structures (e.g. leaves and stems), roots, flowers and floral organs/structures (e.g. bracts, sepals, petals, stamens, carpels, anthers and ovules), seed (including embryo, endosperm, and seed coat) and fruit (the mature ovary), plant tissue (e.g. vascular tissue, ground tissue, and the like) and cells (e.g. guard cells). The term plant also refers to higher and lower plants amenable to transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, and multicellular algae. Plants of a variety of ploidy levels, including aneuploid, polyploid, diploid, haploid and hemizygous plants are also included.
[0109] The nucleic acid molecules of the invention can be used to express an RCA polypeptides of the invention in any plant, including species from the genera Agrotis, Allium, Ananas, Anacardium, Apium, Arachis, Asparagus, Athamantha, Atropa, Avena, Bambusa, Beta, Brassica, Bromus, Browaalia, Camellia, Cannabis, Carica, Ceratonia. Cicer, Chenopodium, Chicorium, Citrus, Citrullus, Capsicum, Carthamus, Cocos, Coffea, Coix, Cucumis, Cucurbita, Cynodon, Dactylis, Datura, Daucus, Dianthus, Digitalis, Dioscorea, Elaeis, Eliusine, Euphorbia, Festuca, Ficus, Fragaria, Geranium, Glycine, Graminae, Gossypium, Helianthus, Heterocallis, Hevea, Hibiscus, Hordeum, Hyoscyamus, Ipomoea, Lactuca, Lathyrus, Lens, Lilium, Linum, Lolium, Lotus, Lupinus, Lycopersicon, Macadamia, Macrophylla, Malus, Mangifera, Manihot, Majorana, Medicago, Musa, Narcissus, Nemesia, Nicotiana, Onobrychis, Olea, Olyreae, Oryza, Panicum, Panicum, Panieum, Pannisetum, Pennisetum, Petunia, Pelargonium, Persea, Pharoideae, Phaseolus, Phleum, Picea, Poa, Pinus, Pistachia, Pisum, Populus, Pseudotsuga, Pyrus, Prunus, Pseutotsuga, Psidium, Quercus, Ranunculus, Raphanus, Ribes, Ricinus, Rhododendron, Rosa, Saccharum, Salpiglossis, Secale, Senecio, Setaria, Sequoia, Sinapis, Solanum, Sorghum, Stenotaphrum, Theobromus, Trigonella, Trifolium, Trigonella, Triticum, Tsuga, Tulipa, Vicia, Vitis, Vigna, and Zea.
[0110] In some embodiments the transgenic plants are barley, maize, tomato, potato, rice, soybean, cotton, sunflower, alfalfa, lettuce, oilseed rape, sorghum, or wheat plants. In particular embodiments the transgenic plants are monocots plants or cereal plants such as barley, sorghum, rice, corn or wheat. A skilled person will recognize that after production of a transgenic plant, the nucleic acid molecule of the invention in that transgenic plant can be introduced into other plants by sexual crossing. Any standard breeding technique known in the art can be used to achieve this.
Determination of Expression in Plants
[0111] Any method known in the art can be used for determining the presence or level of expression in a plant of a nucleic acid molecule of the invention or an RCA polypeptide of the invention. For example, the expression level in a plant of a RCA polypeptide can be assessed using molecular techniques including, for example, immunoassay, immunoprecipitation, gel electrophoresis, and mass spectrometry.
[0112] Additionally, the expression of an RCA polypeptide in a plant can be assessed by a change in the plant phenotype (for example photosynthesis rate, growth rate or seed yield) under heat stress conditions compared with plants expressing wild type RCA.
[0113] Furthermore, extracts or polypeptides isolated from transgenic plants, their tissues cells or seeds can be used in in vitro assays.
[0114] It will be appreciated by persons skilled in the art that numerous variations and/or modifications may be made to the invention as shown in the specific embodiments without departing from the spirit or scope of the invention as broadly described. The present embodiments are, therefore, to be considered in all respects as illustrative and not restrictive.
EXAMPLES
Example 1: DNA Sequencing and Sequence Alignment
[0115] Initially total RNA was extracted from 100 mg of leaf tissue using an RNeasy Plant Mini Kit (Qiagen). RNA was converted to cDNA using a SuperScript VILO cDNA Synthesis Kit (Invitrogen) using 2.1 g of RNA as a template. PCR was performed on 2 l of the cDNA product using GoTaq Green Master Mix (Promega). Refer to Supplementary Methods in Scafaro, A. P., Haynes, P. A. & Atwell, B. J. (2010) J. Exp. Bot. 61, 191-202 for the PCR cycle program and the primers used. The product was run on a 1.5% agarose gel stained with Gel Red (Biotium). The bands where cut from the gel using a scalpel and the DNA purified using a DNA Gel Extraction Kit (Qiagen). The PCR products were sequenced in both directions using the same primers as PCR amplification. Sequence preparation was performed using Big Dye Terminator V3.1 sequencing reaction mix as per manufacturer's instructions and samples run on a 31301 Genetic Analyzer (Applied Biosystems, Foster City, Calif., USA). Multiple DNA and protein sequences were aligned using the MUSCLE algorithm [Edgar RC (2004) MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Research 32: 1792-1797] and the open-source software program Unipro UGENE v1.9.0.
Results: RCA and its Expression
[0116] The RCA genes of Oryza sativa L. ssp. japonica cv. Amaroo, the two O. meridionalis accessions and O. australiensis were sequenced and differences were found between the species. There was no difference in sequence between the two O. meridionalis accessions. There were 50 base changes between O. australiensis and O. sativa including 44 base substitutions and six deletions in the O. australiensis gene. Three of the O. australiensis base substitutions not found in O. sativa were also found in O. meridionalis. Another four base changes were unique to O. meridionalis. When the DNA sequences were translated to amino acid sequence the DNA sequence differences between O. sativa and O. meridionalis did not translate into a difference in protein. There were however 18 residue changes/deletions unique to both RCA isoforms of O. australiensis (see Table 1.sup.a). The protein sequence of O. australiensis was then compared with two warm-adapted species, Gossypium hirsutum (cotton) and Larrea tridentata (creosote bush), and the cold adapted species Spinacia oleracea (spinach) and Deschampsia antarctica (Antarctic hairgrass). Four of the residue differences found in O. australiensis was the same as one or both of the corresponding residues found in the warm-adapted species but not in either of the cold-adapted species (see Table 1.sup.b).
Example 2: Superior Tolerance to Heat Stress in the Wild Rice Oryza australiensis Due to Thermostable RCA
Materials and Methods
Plant GrowthShort-Term Heat Treatment (Reference FIGS. 1-3)
[0117] Seeds of Oryza sativa L. ssp. japonica cv. Amaroo (Os-A) and O. sativa L. ssp. indica cv. Doongara (Os-D) were obtained from the Yanco Agricultural Institute (Department of Primary Industries, NSW, Australia). Seeds of Oryza meridionalis Ng. were collected from wild populations located in the Cape York Peninsula of Australia at S15 42, E145 03 (henceforth referred to as O. meridionalis CY or Om-CY) and from Keep River north of Western Australia at S15 58, E129 03 (henceforth referred to as O. meridionalis KR or Om-KR). Oryza australiensis Domin. were collected from the same location as O. meridionalis KR. For all experiments, plants were grown in controlled growth cabinets (Thermoline Scientific Equipment, Smithfield, NSW, Australia) under a 12-h photoperiod with a photosynthetic photon flux density (PPFD) of 600 to 800 mol m.sup.2 s.sup.1. Plants were grown at 28/22 C. (day/night) in a 3:1, soil of fine-textured krasnozem (locally sourced from Robertson, NSW, Australia) and an organic mix, in pots with no drainage holes. For leaf elongation rate experiments, plants were grown in 2-L pots and measurements were taken at the 5th-leaf stage. For all other experiments, plants were measured after growing for 60 days in 10-L pots. Soil was kept wet at all times and allowed to pool at the surface once the plants were over 40-days old. A commercial liquid fertilizer (Aquasol, Yates, Australia) was applied once a week following manufacturer's instructions, beginning 10 days after germination.
Plant GrowthLong-Term Heat Treatment (Reference FIG. 25-26)
[0118] Seeds of Oryza sativa L. ssp. japonica cv. Amaroo (Os-A) and Oryza australiensis Domin. were grown as described above and 7 days after germination, seedlings were exposed to three temperatures (25, 35 and 45 C.) during the day (12 h) and 21 degrees at night until plants were 35 days old. Seedlings were harvested weekly by measuring leaf area, and fresh and dry biomass for shoots and roots. Relative growth rates and net assimilation rates were calculated using dry mass and leaf area for the treatment period (7-35 d after germination).
Leaf Elongation Rates
[0119] Leaf elongation rates were measured using a HR4000 Linear Variable Displacement Transducer (LVDT). After emergence of the fifth leaf, plants were transferred to a cabinet containing the LVDT unit and randomly assigned to one of the eight measurement stations. The fifth leaf was clipped to the apparatus and growth was measured for a 24-h period. Plants were grown at 22 C. for the initial 12 h of growth in the dark followed by 28 C. for the first 4 h of the light period. The cabinet temperature was then raised to 45 C. for 4 h and returned to 28 C. for the final 4 h of the day period. Leaf length was measured and logged every 6 mins using the software program VuGrowth, version 1.0 (Applied Measurement, Oakleigh, Victoria, Australia). The ambient temperature of the cabinet was logged ever 10 min by a portable data logger (Onset HOBO, Massachusetts, USA) placed next to the plants. Leaf lengths were converted to leaf elongation rate (LER) by subtracting the leaf length at any given time by the leaf length 1 h prior to that measurement. The experiment was repeated on six occasions with nine plants from each genotype measured in total.
Gas-Exchange and Rubisco Activation State Assays
[0120] Gas-exchanges were measured using a Licor 6400 (LI-COR, Lincoln, USA). The CO.sub.2 in the reference chamber air was set at 380 ppm and a PPFD of 1500 mol m.sup.2 s.sup.1 was used for all measurements. Measurements were made in the growth cabinet and the air temperature of the gas exchange cuvette was set to 28 or 45 C. to match the cabinet temperature. Control measurements were made at 28 C. beginning 2 h into the light period. Measurements at 45 C. commenced after 2 h of exposure to 45 C. and continued over a 2 h period by randomly measuring the different genotypes over that 2 h period. All measurements were made on healthy, fully-expanded leaves. Measurements were made on 3-6 leaves from 3 pot replicates. To determine the activation state of Rubisco, two 0.266 cm.sup.2 leaf disks were rapidly excised from mature fully-expanded leaves using a leaf punch and immediately frozen in liquid nitrogen. The Rubisco activation state was calculated by measuring total and initial Rubisco activities. Samples were collected throughout the light period to coincide with growth measurements. Samples were collected after 2 h at 28 C. (2 h light), 2 h at 45 C. (4 h light), 4 h at 45 C. (6 h light) and again at 28 C. after 1 h of recovery from the higher temperatures (7 h light). Four replicates were collected from separate pots placed randomly throughout the cabinet.
Immunoblot Analysis
[0121] For immunoblot analysis, plant material was harvested at a cabinet temperature of 28 C. or after 2 h at 45 C. as described above for Rubisco activation. Plant material was ground in liquid nitrogen and 100 mg of fine tissue was weighed before extraction by vortexing in 800 l of SDS extraction buffer containing 30% sucrose, 2% SDS, 0.1 M Tris-HCl, pH 8.0, 5% -mercaptoethanol. Samples were centrifuged at 10,000 g for 5 min and 10 l of the supernatant was added to 3 l of 5SDS-loading dye (Invitrogen). Samples were electrophoresed in NuPage BIS-TRIS 6-12% gradient SDS-PAGE gels (Invitrogen) together with pre-stained molecular weight markers (Precision Plus All Blue Standard, Bio-Rad, city, country). Polypeptides were transferred to polyvinylidene difluoride (PVDF) membranes for immunological detection of RCA using an anti-tobacco activase primary antibody (Law, D., Crafts-Brandner, S. & Salvucci, M. (2001) Planta 214, 117-125.) in conjunction with an alkaline phosphatase-conjugated goat anti-rabbit secondary antibody (Sigma Aldrich). Immunoblots were stained with NBT/BCIP (Promega). Immunoblot analyses were conducted in triplicate, i.e., using samples prepared from three different plants. RCA primary antibody used in western blot analysis has a greater affinity for RCA-Oa than RCA-Os. Taking into consideration the difference in antibody reactivity through a standard curve generated from purified recombinant RCA of known concentration, the concentration of RCA in the leaf was obtained.
Statistics
[0122] All graphs and statistics were created using GraphPad Prism 5.0d software (GraphPad Prism Software Inc., San Diego, USA). For both LER and Rubisco activation state data, a two-way ANOVA was run initially. When appropriate, this test was followed by individual one-way ANOVA and Tukey's multiple comparison tests. Gas-exchange data was analysed with a two-sample t-test between control and heat treatment for each genotype independently.
Results
Temperature-Dependent Growth and Photosynthesis
[0123] The relative heat sensitivity of four genotypes was determined by comparing their LER to the LER of Os-A (
[0124] A significant interaction between the effects of growth temperature and exposure time on LER was observed for all the genotypes, except for O. australiensis (Table 8). This interaction was evident by the relatively stable growth rates at 28 C. compared with reduced rates at 45 C. (
TABLE-US-00008 TABLE 8 Results of a two-way ANOVA for the data shown in FIG. 2 with P-values given for comparisons between the two growth temperatures, the exposure time at each temperature and the interaction between the two variables. P-values Exposure Genotype Temperature time Interaction O. sativa cv. Amaroo 0.1477 0.0197 <0.001 O. sativa cv. 0.9734 0.0050 <0.001 Doongara O. meridionalis CY 0.0382 0.0277 <0.001 O. meridionalis KR 0.6711 0.8775 <0.001 O. australiensis 0.2373 0.6785 0.1331 Plants were grown at an ambient temperature of either 28 or 45 C. for an exposure time of 4 h and leaf lengths measured every 6 min using an LVDT (refer to FIG. 1). All statistics were based on six experimental replicates.
[0125] Heat applied to plants during daylight hours for four weeks was used to test whether the heat tolerance effects seen for leaf elongation in O. australiensis could be replicated over longer periods (
[0126] The effect of elevated temperature on net photosynthetic rate (P.sub.n) was also species-specific. Net photosynthesis decreased after 2-4 h at 45 C. for all the genotypes, except O. australiensis (
Rubisco Activation State
[0127] The response of Rubisco activation state to increased temperature (Table 9) was similar to the response observed for LER and P.sub.n in the five genotypes (
[0128] To determine whether there was a significant difference in the response of Rubisco activation state to exposure time at high temperature among the various genotypes, a two-way analysis of variance was performed. The analysis indicated that there was no significant genotypeexposure time interaction (F=0.9516, P=0.5037, df=12). One-way ANOVA revealed significant differences (P=0.0016) between species only after exposure of the plants for 4 h at 45 C., when the activation state of Os-A was lower than O. australiensis and the activation state of Os-D was lower than both Om-KR and O. australiensis (Table 8). There were no significant differences (P>0.05) in activation state between the O. meridionalis and O. australiensis genotypes. Moreover, there was no significant effect (P>0.05) of the elevated temperature on the activation state for these three genotypes. Conversely, both O. sativa cultivars exhibited a significant decrease (P=0.0032 for Os-A and P=0.002 for Os-D) in activation state after a 4-h exposure to 45 C. compared with the activation state at 28 C.
TABLE-US-00009 TABLE 9 Rubisco activation state (%) of five rice genotypes in response to changes in ambient temperature. O. sativa O. meridionalis Temperature cv. Amaroo cv. Doongara CY KR O. australiensis P-value 28 C. 64 1 70 8 72 2 68 5 68 7 0.8540 2 h at 45 C. 44 5 47 9 47 4 55 6 54 9 0.7453 4 h at 45 C. 42 6 27 3 46 7 53 6 67 4 0.0016 28 C. 29 3 30 2 46 12 44 8 66 14 0.0670 recovery P-value 0.0032 0.0022 0.1439 0.1761 0.6866 A one-way ANOVA was used to determine differences between genotypes at a single growth condition and another one-way ANOVA for differences within a genotype across all growth conditions. Plants were analysed before (28 C.), during the heat treatment (2 h at 45 C. and 4 h at 45 C.) and also after a recovery period of 1 h at 28 C. (28 C. recovery). All values are means SE (n = 4).
[0129] The similarity in the temperature response of LER and Rubisco activation state for each genotype led to the determination of a positive relationship between the two variables (
RCA and its Expression
[0130] Sequencing of the RCA genes from O. sativa cv. Amaroo, the two O. meridionalis populations and O. australiensis revealed differences in RCA sequence between the three species, but not between the two O. meridionalis populations. There were 50 base differences between O. australiensis and O. sativa including 44 base substitutions and six deletions in the O. australiensis gene. Three of the base substitutions found in O. australiensis when compared to O. sativa were also found in O. meridionalis. In addition, another four base changes were unique to O. meridionalis. When the DNA sequences of the RCA genes were translated to protein sequences, the differences between O. sativa and O. meridionalis at the nucleotide level did not translate into differences at the amino acid level. In contrast, comparison of the amino acid sequences for RCA from the different genotypes revealed three residue deletions and 15 residue substitutions that were unique to O. australiensis, for both the small form and the large form.
[0131] For all five rice genotypes, the abundance of RCA protein was not affected by exposure to 45 C. for 2 h, nor was the ratio of the large to small form of RCA. Irrespective of temperature there was a similar total abundance of RCA between all genotypes.
CONCLUSIONS
[0132] Three rice species differed in their heat tolerance, as indicated by differences in vegetative growth at 45 C. Domesticated rice, O. sativa, was the most susceptible to inhibition by heat, whereas the wild rice O. meridionalis was less susceptible and O. australiensis exhibited tolerance to heat stress. The variation in tolerance among the species was related to the level of photosynthetic inhibition at the elevated temperature, which in turn was related to the degree to which Rubisco deactivated. Heat-tolerant O. australiensis exhibited no reduction in growth, photosynthesis or Rubisco activation when exposed to 45 C. for over 2 h. To account for the differences in thermotolerance, we propose that differences in the structure of activase between O. australiensis and the other two species, coupled with a potentially greater abundance of the protein, ameliorate the thermotolerance of Rubisco activation in O. australiensis with a consequent effect on photosynthesis and growth.
Example 3: In Planta Rubisco and RCA Stoichiometry
[0133] Rubisco and RCA concentration was determined by Western Blot analysis of extracted total soluble leaf protein calibrated against purified Rubisco and RCA of known concentration.
[0134] To determine in vivo concentrations of the two enzymes, standard curves were generated using purified enzyme of known concentration. The concentration of Rubisco was determined using an antibody specific for the 53 kDa large subunit of Rubisco. Because the quaternary structure of the Rubisco complex comprises 8 large and 8 small (16 kDa) subunits, the total Rubisco content could be deduced from these westerns. Table 4 lists the concentrations of Rubisco and RCA for the two species and the ratio between the two functionally complete enzymes. While there was substantial variation between biological and technical replicates using this indirect method, there was no evidence for statistically differences between the species. However, in the absence of a more precise technique that is relatively simple, we believe that these concentrations are credible. Despite some variation, the in vivo enzyme concentrations we report in Table 10 match the concentrations found after protein purification (i.e. concentrations achieved when extracting RCA and Rubisco from leaves). Considering the concentration of Rubisco and RCA were determined from the same tissue samples we can be relatively confident in the comparative ratios of the two proteins across species. However differences in the absolute concentration of Rubisco and RCA between the species may be affected by differences in growing conditions between harvests, particularly nitrogen availability, which is influenced by life-stage.
TABLE-US-00010 TABLE 10 Rubisco and RCA in vivo concentrations Rubisco RCA (mg .Math. g.sup.1 (mg .Math. g.sup.1 Rubisco:RCA FW#) (uM*) FW) (M) (g:g) (M:M) O. sativa 5.7 1.2 10.3 2.2 1.3 0.6 5.9 2.7 4.4:1 1.7:1 O. australiensis 6.8 2.2 12.3 4.0 1.8 0.5 8.2 2.3 3.8:1 1.5:1 #Milligrams of protein per gram of leaf fresh weight, based on Western blot analysis. *The molarity is based on the functional Rubisco enzyme molecular weight being 553,000 Da and the RCA oligomer with most activity having a molecular weight of 220,000 Da based on native gel analysis (presented in Example 4). One gram of fresh weight is assumed to equate to 1 mL of volume. Both O. sativa and O. australiensis were grown at 28 C.
Example 4: RCA Concentration-Dependent Oligomer Formation (Native Gels)
[0135] Native gel analysis has allowed for the concentration-dependent self-oligomerisation of RCA subunits to be observed. To the inventors' knowledge this is the first time native gels have been used to visualise the interaction of RCA subunits. Others have shown similar RCA self-assembly in cotton and tobacco using fluorescence and small angle X-ray scattering techniques (Henderson, J. N., Hazra, S., Dunkle, A. M., Salvucci, M. E. & Wachter, R. M. (2013) Biochimica et Biophysica Acta (BBA)Proteins and Proteomics 1834, 87-97; Wachter, R. et al. (2013) Photosynthesis Res. 117, 557-566.). Similarly, O. australiensis (Oa) and O. sativa (Os) RCA form a larger complex through self-association when the enzyme concentration is increased. The inhibition of activation activity at low RCA concentrations is a result of the self-associating complex falling below a certain threshold of about three RCA subunits. Note that due to differences in protein isoelectric points and protein physical shape, native bands may migrate 15% from what is expected based on molecular weight alone.
[0136] Rather than being distinct in size, increasing concentration of RCA led to a range of RCA oligomer sizes, shifting from lower to higher molecular weights as the concentration increased. With increasing concentration, the beta isoform seems to form at least three distinct oligomer molecular weights while the alpha isoform is found as mostly a single oligomer that shifts to higher molecular weights with increased RCA concentration.
[0137] Although there was distinct RCA complex and Rubisco complex bands on native gels there was no discernible Rubisco/RCA complex when the two enzymes were mixed.
[0138] To establish temperature effects on the protein complexes of interest, samples were incubated at 28 C. or 38 C. for 20 minutes before loading on native gels. The higher temperature did not interfere with the individual Rubisco or RCA complexes. This supports the conclusion that while the Rubisco complexes and RCA complexes from Oa and Os exhibit different thermostability characteristics, each is stable at high temperatures and the interaction of the Rubisco with RCA (leaf extracted or recombinant), i.e. the Rubisco-RCA complex, is heat-labile, particularly in O. sativa (see
[0139] SDS-PAGE separation of leaf-purified RCA from O. australiensis and from wheat. Total leaf protein was initially precipitated in 35% saturated ammonium sulphate followed by anion-exchange chromatography using Q-sepharose media and varying salt concentrations. The beta isoform eluted from anion-exchange at 0.2 M KCl while the alpha isoform eluted at 0.5 M KCl. The 0.2 M fraction containing RCA was used in subsequent assays of RCA interaction with wheat Rubisco.
[0140] Bands of interest from the native gels were excised and LC-MS/MS was run on trypsin-digested proteins extracted from those bands. Identified proteins are listed in Table 11. Protein identification was as expected with the clear identification of the two Rubisco subunits and identification of RCA ranging in molecular weight. Two proteins identified in some of the leaf-extracted RCA bands were glutamine synthase and sucrose synthase. It is unlikely that an interaction between RCA and glutamine or sucrose synthase is occurring, rather it is more likely that these proteins form complexes of similar molecular weight to RCA, therefore occupying the same band-space. Note that only the beta isoform of RCA was identified in all bands associated with RCA, however considering that the two isoforms are identical apart for 38 amino-acids at the C-terminus of the alpha isoform, it is likely that both were present but the peptide sequences had a higher probability of matching the identical regions and assigning the peptide to the beta rather than alpha isoform.
TABLE-US-00011 TABLE 11 Spot Peptide Number Protein Identification Matches# 1 Rubisco large subunit 30 Rubisco small subunit 5 2 Rubisco large subunit 22 Rubisco small subunit 6 3 Peroxisomal hydroxyl-acid oxidase 1 4 RCA beta isoform 21 Glutamine synthase 5 5 RCA beta isoform 2 6 RCA beta isoform 6 Glutamine synthase 1 7 RCA beta isoform 4 Sucrose synthase 2 # Refers to the total number of peptides that matched the identified protein.
Example 5: Concentration-Dependent Activity of RCA
[0141]
[0142] If the lower specific activity seen in RCA extracted from Oa leaf were to be caused by a non-specific inhibitory substance, it would be expected that such a substance would also inhibit recombinant RCA. To test this we ran a mixing experiment where Os leaf extract, from which RCA had been removed, was added to recombinant Oa beta RCA and RCA activity measured (
Example 6: RCA Heat-Stability
[0143] To determine the heat-stability of RCA three techniques were used. Two techniques, the NADH coupled assay and the phosphate assay measure the hydrolysis of ATP by RCA, which is a function the enzyme performs irrespective of the presence of Rubisco but is specifically necessary for Rubisco activation. The third technique, the Rubisco activation assay, directly measures the ability of RCA to activate Rubisco by assessing CO.sub.2 binding. All three techniques require RCA to be purified, at least partially. For Rubisco activation assays, Rubisco as well as RCA must be purified prior to experimentation. Experiments used either partially purified RCA from leaf extracts or complete purification of recombinant protein expressed in E. coli.
Example 7: RCA Recombinant Gene Expression and Protein Purification
[0144] The transformed E. coli containing the vectors pEV61 (containing the rcaIOs-2Pb gene (encoding the O. sativa long isoform RCA)), pEV63 (containing the rcaIOau-2Pb gene (encoding the O. australiensis long isoform RCA)), pGA220 (containing the rcalIOs-3Pb gene (encoding the O. sativa short isoform RCA)) and pGA221 (containing the rcalIOau-3Pb gene (encoding the O. australiensis short isoform RCA)) for expression of the O. sativa and O. australiensis and isoforms of RCA. The plasmid maps of these vectors are given in
[0145] All of the vectors except pGA221 expressed RCA and for every 100 ml of cell culture approximately 2.5 mg of protein was purified. The purification of recombinant RCA involved precipitation of the RCA by adding saturated ammonium sulphate to the homogenised E. coli cell extract. Precipitated RCA was then suspended in buffer and loaded onto a gel-filtration column and the relevant peak collected. A second chromatographic step of passing the RCA through a strong anion-exchange column provided the final purified RCA. Running the purified protein on a gel showed the extent of the purification, with almost no other proteins visible.
Example 8: RCA from Leaf Extracts and Partial Purification
[0146] Unlike purification of the recombinant protein, leaf-extracted RCA was more challenging to work with, which is why rice RCA has never been successfully analysed in vitro. A couple of attempts to purify leaf extracted RCA in a similar manner to purification of the recombinant protein failed. The challenge with leaf-extracted RCA is the limited amount of RCA available per unit of leaf and the presence of proteases which quickly degrade the protein. Partial purification of RCA from leaf extract was possible, which involved precipitating out RCA with saturated ammonium sulphate, followed by desalting. While RCA was by no means the only protein left in the sample, it was the most abundant and gels indicated that there was little degradation by proteases. As RCA is the only protein responsible for activation of Rubisco, the presence of other proteins in the sample has little effect on the .sup.14C-Rubisco activation assays. Activation assays performed on leaf-extracted RCA samples are useful as the impact of post-translational modifications and protein-protein interactions on the activity of RCA are at least partly accommodated. In other words, this assay is more representative of what can be expected in vivo in transgenic plants.
[0147] SDS-PAGE Gel image analysis of the partially purified leaf extracts show O. australiensis had a lower content of RCA, which was factored into some Rubisco activation results. However, the concentration of RCA in relation to partially purified protein extracted from the leaf was similar between O. sativa and O. australiensis, being about 25% of the partially purified protein for both species. Similar concentrations of RCA between the species observed in leaf extracts is highly relevant to gene expression and protein abundance.
[0148] Gels showed O. sativa to have a greater abundance of the isoform relative to O. australiensis, with O. sativa having about equal quantities of the two isoforms while O. australiensis has much more than a isoform. The ratio of the two isoforms seems to change with growth temperature. In particular, O. sativa grown for 72 hours at a raised day temperature of 40 C. had almost no visible form but substantially more form relative to plants grown at a day temperature of 30 C.
Example 9: Rubisco Purification
[0149] For the Rubisco activation assay purified Rubisco, the substrate in the assay, is also required. One gram of leaf fresh weight yielded approximately one milligram of Rubisco. Purification of Rubisco involves extraction from leaves followed by precipitation of the protein with saturated ammonium sulphate. Following ammonium sulphate precipitation the sample was passed through a sucrose gradient using high-speed centrifugation with the large Rubisco complex migrating to higher concentrations of sucrose. Following sucrose gradient separation the sample was separated by anion-exchange chromatography resulting in a highly pure extract of Rubisco.
Example 10: ATPase Assays
[0150] RCA requires ATP to activate Rubisco. The ATPase activity of RCA is not directly related to the Rubisco activation activity, as Rubisco is not required for ATP hydrolysis to occur. The ATPase activity of RCA from both species (Oa and Os) was measured over a range of temperatures. Two alternative methods were used to determine ATPase activity. Firstly, a coupled reaction involving the conversion of NADH to NAD.sup.+ and the subsequent change in absorbance at 340 nm was measured (
[0151] Results from both ATPase activity based assays show that, irrespective of species, the isoform has a substantially higher specific activity than the isoform.
[0152] To compare the temperature response between the two methods used to determine ATP hydrolysis (the phosphate and NADH coupled reaction), normalised values attained from both methods were plotted together (
Example 11: .SUP.14.C Rubisco Activation Assays
[0153] A two-stage assay in which RCA is initially incubated with inactivated Rubisco for a set period of time, followed by measurements of Rubisco specific activity, allows for determination of the efficiency of RCA activation of Rubisco. For all of the experiments, inactivated Rubisco was incubated with RCA for a period of five minutes at given temperatures. The total activity of Rubisco, independent of RCA, was determined by removing Rubisco from the incubation mix allowing for all Rubisco sites to become active. Of note, at temperatures as high as 42 C. the total activity did not fall but increased slightly. The absence of a reduction in total Rubisco activity with increasing temperature supports the consensus view that RCA is heat labile while Rubisco is relatively insensitive to high temperature (Salvucci, M. E. & Crafts-Brandner, S. J. (2004) Plant Physiol. 134, 1460-1470; Crafts-Brandner, S. J. & Salvucci, M. E. (2000) Proc. Natl. Acad. Sci. U.S.A 97, 13430-13435.).
[0154] Two independent sets of experiments measuring the activity of leaf-extracted RCA were undertaken.
The values were subsequently adjusted for RCA concentration differences between the two species (
[0155] Rubisco activation shows RCA.sub.Os to be more active at a temperature of 30 C. but the activity of RCA.sub.Os declines sharply at temperatures of 36 C. and above. Contrastingly, RCA.sub.Oa is less active at moderate temperatures but the enzyme maintains close to a constant rate up to temperatures of 42 C. Analysis of individually plotted curves give a peak in RCA activation performance of 29.90.5 C. for O. sativa and 33.00.3 C. for O. australiensis.
[0156] After differences in RCA protein concentration between the species are accounted for, activation at 36 C. is not significantly different between the species (as indicated in
[0157] Analysis of Rubisco activation by the recombinant purified protein was also undertaken (
[0158] Until now Oa-leaf RCA heat-stability has only been measured at a fraction activated level of 0.1 Oa-leaf RCA and has now been measured as fraction activated rates >0.3 by increasing the concentration of extracted leaf protein and consequently RCA concentration. To evaluate whether the heat-stability of Oa-leaf RCA is maintained even when the activity matches that of Os, a temperature response curve of Rubisco activation was performed with varying concentrations of Oa leaf-extracted RCA (
[0159] When Rubisco activation in Oa extracts was enhanced by using enzyme concentrations comparable to those in Os extracts, RCA from the leaf of Oa exhibited superior heat-stability relative to that from Os. The highest concentration of Oa RCA measured had the same absolute rate as Os RCA at 25 C. Above 25 C. the activity of Oa RCA outperformed Os RCA and at 42 C. Oa had an absolute rate of activity four-times that of Os. It seems from the current results that heat-stability is slightly reduced when the concentration is as high as 0.96 mg.Math.mL.sup.1, with close to a 50% drop in activity at 42 C. relative to 30 C., compared with less than a 20% fall at concentrations of 0.24 and 0.49 mg.Math.mL.sup.1. It may reflect a stoichiometric relationship between RCA and Rubisco. However even at this high concentration, the fraction activated is still well above the 80% reduction by Os RCA at comparable temperatures.
Example 12: Thermostability of the Rice RCA Oligomer
[0160] Differential Scanning Fluorimetry (DSF) is a relatively new and simple way of determining the thermal stability of proteins. It relies on the signal of a dye that preferentially fluoresces in a non-polar (unfolding protein) rather than polar environment (folded or aggregated protein). DSF was performed on recombinant RCA.sub.Os and RCA.sub.Oa using SYPRO Orange dye and a temperature ramping of 1 C. per minute from 25 C. to 90 C. (
Example 13: Heat-Dependent Regulation of RCA Isoforms
[0161] Protein abundance of the alpha and beta isoforms of RCA from heat-treated rice plants was examined and the same samples were subjected to anion-exchange chromatography and run on SDS-PAGE gels. The benefit of the anion-exchange sample preparation step is that the two isoforms of RCA can be seen more clearly. Interestingly, there is much less alpha isoform present in Oa than what looked to be present in the original ammonium sulphate precipitated samples. Possibly there was an overlapping protein that made it seem like the previous samples of Oa had a greater abundance of the alpha isoform.
[0162] Image analysis SDS-PAGE gel alongside RCA isoform gene expression shows a broadly similar pattern of response to higher growth temperatures between gene expression and protein abundance of the two Os isoforms (
Example 14: Concentration-Dependent ATPase Specific Activity (Recombinant Protein)
[0163] Inhibition of Rubisco activation at low RCA concentration may be attributed to either a failure of the protein to self-assemble into a functioning oligomer or to a positive allosteric interaction between RCA and Rubisco. To establish which phenomenon accounts for the loss of function at low RCA concentration, the specific activity of ATP hydrolysis by RCA was determined over a range of RCA concentrations (
Example 15: Temperature Response of Recombinant RCA
[0164] The temperature response of partially purified leaf-extracted RCA from the Oryza species shows Rubisco activation activity by RCA from O. sativa to be susceptible to temperatures of 36 C. and above (
[0165] ATP hydrolysis activity was assayed as described by Barta, C., Carmo-Silva, A. E. & Salvucci, M. E. (2011) Methods Mol. Biol. 684, 375-382. Recombinant RCA.sub.Oa has lower ATP hydrolysis activity than RCA.sub.Os at comparable concentrations (
Example 16: Oligomeric RCA Heat Stability Versus RCA-Rubisco Heat Stability
[0166] The heat-labile nature of both O. sativa and O. australiensis recombinant RCA-Rubisco complexes as presented by the solid lines in
Example 17: Interaction of RCA with O. australiensis Rubisco
[0167] Until now all Rubisco activation experiments have used Rubisco extracted and purified from O. sativa. Examining the interaction of RCA.sub.Os and RCA.sub.Oa with O. australiensis Rubisco is important considering the RCA-Rubisco interaction is critical to the temperature limitation in RCA activity.
[0170] The results show that the primary structure of Rubisco from O. australiensis is different from that of O. sativa and Rubisco can influence the stability of the RCA-Rubisco complex. From interactions between Os and Oa leaf extracted RCA and Os and Oa Rubisco (
Example 18: Regulation of the Alpha and Beta Isoform of RCAHeat-Dependent Up-Regulation of the Alpha Isoform
[0171] With increased growth temperature from 28 to 38 C. there is an increase in mRNA expression of the alpha isoform of RCA. The beta isoform expression stays relatively constant, with high growth temperatures increasing the ratio of alpha to beta RCA isoforms (
[0172] Protein abundance of the alpha and beta isoforms of RCA is proportional to mRNA levels. Visualisation of partially purified RCA extracts run on SDS-PAGE indicate greater alpha RCA protein abundance from 72 h of heat exposure onwards. Unlike RNA expression, there is no discernible increase in alpha isoform protein abundance before 72 h but a greater abundance at 28 C. after recovery from heat exposure. The results suggest protein abundance has a 48-h lag-time behind changes in gene expression.
[0173] To test whether changes in isoform composition of the RCA complex influence the heat-stability of RCA enzymatic function, the temperature effects on Rubisco activation by RCA extracted from plants over the time-course of heat treatment were measured at 28 and 38 C. and are shown in
Example 19: The Ability of RCA from Rice to Activate Wheat Rubisco
[0174] To determine the activation activity of rice RCA and wheat RCA on Rubisco from wheat (Rubisco.sub.wheat), RCA was partially purified from leaves. The alpha and beta isoforms were separated using anion-exchange chromatography and the beta isoform was used to determine the Rubisco activation activity. The beta isoform was used as it had a higher purity of RCA and less Rubisco than the alpha isoform fraction. Although by no means pure (approx. 60-70% of total protein) the samples were of higher purity than the ammonium sulphate precipitate samples previously used (see
[0175] When comparing Rubisco from the two rice species and wheat, there was a similar response to temperature (
[0176] When Rubisco.sub.wheat was activated by leaf-extracted beta isoform, at moderate temperature of less than 34 C., wheat RCA was at least twice as active as the rice RCA isoforms (
[0177] Panel C of
Example 20: Growth Chamber Experiment with Transgenic Rice Lines Under High Day Temperature at 45 C.
Plant Expression Vectors and Transformation
[0178] The coding sequences for the short RCA (rcalI) and long RCA (rcal) coding region from O. australiensis were obtained by chemical DNA synthesis and were adapted to rice codon usage. Different vectors were made (
As target tissue for transformation, immature embryo or embryo-derived callus derived from japonica and indica rice cultivars which were cut into small pieces, essentially using the technique described in PCT patent publication WO 92/09696. Agrobacterium was cocultivated with the rice tissues for some days, and then removed by suitable antibiotics. Transformed rice cells were selected by addition of glufosinate ammonium (with phosphinothricin 5 mg/L) to the rice tissue culture medium.
Calli growing on media with glufosinate ammonium were transferred to regeneration medium. When plantlets with roots and shoots had developed, they were transferred to soil, and placed in the greenhouse.
Genotypes
[0179] Five transgenic linesnumbered 475 to 479, were tested. Information on the plants tested are set out in Table 12.
TABLE-US-00012 TABLE 12 List of transgenic rice events used in the high day temperature experiment. Designation Description Clone Information 475 pTNVS299 Single copy line 476 pTNVS299 Single copy line 477 pTKA40 Single copy line 478 pTKAW40 Single copy line 479 pTKAW39 Single copy line 480 azygous control NA
Experimental Design
[0180] Transgenic rice (T3 homozygous rcalIOa single copy lines) and pooled azygous lines were sown in 66-wells sowing trays after seeds had been soaked in water for 1.5 days. The seedlings were transplanted to 9 cm pots after 20 days and 14 individuals of similar size/height (visual score) were chosen for the experiment. A randomized block design with border plants was used. The growth chamber normal/control conditions were 12 h light (ca. 300 mol m.sup.2 s.sup.1 PAR), 22 C. during the night and 28-29 C. during the day. The maximum temperature was imposed for 12 h during the light period while plants were held at 22 C. overnight. Temperature was increased stepwise from 28/29 C. to 45 C. over a 48 hour period 10 days after transplanting (30 days after sowing). See
Leaf Elongation Rates (LVDT)
[0181] Leaf elongation was measured on plants every day for five consecutive days, once in the morning period (about 9 am until about 1 pm), and again in the afternoon period, which commenced by 2 pm when plants were attached to the machine. Measurements for the afternoon plants were therefore terminated the following morning. One plant of each genotype (five viable transgenic lines and one azygous control) was attached to the pulley system and readings commenced, with leaf length logged 10 times hourly. Nutrient solution was liberally supplied throughout. Plants were chosen successively from 14 blocks, with a new young emerging leaf being required for each of the ten measurements made over five days. Rates of elongation were analysed in the normal way, using logs in Excel spreadsheets to calculate rates (mm h.sup.1) over the period of steady-state elongation in the hottest period. Rates did not differ significantly between genotypes during the night.
Leaf Gas Exchange
[0182] After 2 weeks of high day temperature treatment, leaf gas exchange measurements were carried out during the peak temperature in the afternoon. The following parameters were recorded with an open infrared gas analyser system LI-6400XT (LI-COR Inc., Lincoln, Nebr., USA):
[0183] a) Net photosynthesis rates (A.sub.n) under saturating light of 1500 PAR (integrated light source of the LI-6400XT leaf chamber) and at 400 ppm CO.sub.2 and 45 C. (block temperature setting),
[0184] b) maximum carboxylation rates of Rubisco (V.sub.c,max), derived from the slope of A.sub.n vs. C.sub.i (internal sub-stomatal CO.sub.2 concentration) curves that were recorded by stepwise changing CO.sub.2 concentration around the leaf inside the leaf chamber,
[0185] c) the rate of A.sub.n induction during dark-light transitions, subjecting plants to low light (ca. 50 PAR) for about 30 min, then illuminating the measured leaf at 1500 PAR while following the rise of A.sub.n over time (ca. 15 min).
[0186] The initial slope was taken as surrogate for induction kinetics of photosynthesis and hence of Rubisco activation (Carmo-Silva and Salvucci, 2013 Plant Physiol. 161, 1645-1655; Yamori et al., 2012 Plant J. Cell Mol. Biol. 71, 871-880).
[0187] Statistical analysis (ANOVA test) was carried out with in-house developed R-package.
Flowering Time/Biomass/Seed Weight
[0188] The days to flowering are recorded for every plant. After first plant starts to flower temperature will be reduced to 28-29 C. (control conditions) in order to avoid pollen sterility. All plants are harvested at full maturity and number of tillers, panicles and seeds as well as vigor (visual score 1 to 6), seed set (%), fresh and dry weight (g) per plant are taken. Seed weight is recorded after drying seeds.
Results
Rubisco Activation and Photosynthesis
[0189] The transgenic rice plants 479 with the pTKAW39 vector showed higher values of A.sub.n and Vc,max than their azygous controls after 2 weeks of heat treatment (
Leaf Elongation Rate (LER)
[0190] Six plant lines, numbered 472 to 479, and an azygous control, 480 were tested for leaf elongation rate (LER) and the results are set out in Table 13 and Table 14. These rates are means calculated across the heat period as defined in
TABLE-US-00013 TABLE 13 LERs for seven RCA rice transformants and an azygous control (Line 480) Leaf elongation rate Genotype (mm h.sup.1) during designation heat period 472 3.92 b 473 3.62 b 474 3.87 b 475 4.80 a 476 3.91 b 478 3.70 b 479 4.26 a,b 480 3.88 b
Tiller Development
[0191] Tiller numbers were counted for plants in each block after a week of heat treatment (six-week-old plants) as a measure of shoot development (Table 14). Tiller numbers were re-counted after seven weeks of heat treatment and are reported in
[0192]
TABLE-US-00014 TABLE 14 Numbers of tillers in six-week-old plants Genotype 480 Block 479 475 (C) 476 478 1 7 5 5 6 5 2 8 5 5 5 5 3 8 5 7 5 6 4 7 5 7 8 4 5 7 8 4 4 5 6 7 5 8 5 5 7 6 6 7 5 7 8 7 8 6 4 6 9 8 7 5 5 4 10 7 8 7 6 4 11 6 6 6 7 9 12 9 5 8 5 5 13 4 5 4 6 3 14 7 7 6 5 4 Average 7.0 6.1 6.1 5.4 5.1 S.E.M. 0.29 0.32 0.33 0.27 0.38
[0193] It will be appreciated by persons skilled in the art that numerous variations and/or modifications may be made to the invention as shown in the specific embodiments without departing from the spirit or scope of technology as broadly described. The present embodiments are, therefore, to be considered in all respects as illustrative and not restrictive,