IMPROVED ASSAY FOR DETERMINING NEUTRALISING ANTIBODY TITRE TO A VIRAL VECTOR
20230093697 · 2023-03-23
Inventors
Cpc classification
C12Q1/6897
CHEMISTRY; METALLURGY
G01N2333/015
PHYSICS
C12N2750/14143
CHEMISTRY; METALLURGY
G01N2469/20
PHYSICS
International classification
Abstract
The present invention relates to an improved assay and in particular to an improved assay that is capable of consistently measuring antibody titre, especially neutralising antibody (NAb) titre, at lower thresholds and/or with greater speed than conventionally-known assays. The invention further relates to use of such assays in combination with the provision of gene therapy and/or in combination with the provision of methods aimed at removal/depletion of neutralising antibodies from a patient.
Claims
1. A method for determining neutralising antibody (NAb) titre to a viral vector comprising a capsid of interest in a sample from a subject, the method comprising a transduction inhibition assay (TIA) using a luciferase which includes the following steps: (a) incubating particles of a viral vector comprising the capsid of interest in (1) one or more reference solutions comprising the sample at varying dilutions, and (2) at least one control solution, wherein the viral vector of part (a) comprises a recombinant vector genome comprising a transgene encoding the luciferase; (b) exposing each of the solutions from step (a) to a population of target cells which are susceptible to infection by the viral vector of interest; (c) waiting for a set interval of time to allow transduction to occur; (d) adding a substrate for the luciferase to the reference and control solutions and measuring the signal (RLU) obtained from the luciferase; (e) comparing the signal (RLU) obtained from the luciferase in the at least one control solution with the signal (RLU) obtained from the luciferase in the reference solutions; and (f) calculating the NAb titre; wherein: (i) the set interval of time in step (c) is less than 24 hours, optionally is 19 hours or less, optionally is 12 hours or less, optionally is 8 hours or less, optionally is 6 hours or less and optionally is 3 hours; and (ii) the luciferase is a synthetic luciferase which provides enhanced luminescence relative to a firefly luciferase.
2. The method for determining NAb titre according to claim 1, wherein the set interval in step (c) is 6 hours or less; and optionally wherein the set interval in step (c) is 3 hours.
3. The method for determining NAb titre according to any one of the preceding claims wherein the synthetic luciferase has enhanced luminescence relative to a firefly luciferase having a sequence according to SEQ ID NO: 1.
4. The method for determining NAb titre according to any one of the preceding claims wherein enhanced luminescence of the synthetic luciferase is determined by measuring the luminescence signal (RLU) of the synthetic luciferase and its substrate and the luminescence signal (RLU) of the firefly luciferase and its luciferine substrate under the same conditions.
5. The method for determining NAb titre according to claim 4, wherein the signal (RLU) of the synthetic luciferase and its substrate is greater by at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 150-fold or more than the signal (RLU) of the firefly and its luciferine substrate.
6. The method for determining NAb titre according to any one of the preceding claims wherein the synthetic bright luciferase comprises: (a) a sequence according to SEQ ID NO: 2; (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 2; (c) a sequence which varies from SEQ ID NO: 2 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids; (d) a sequence according to SEQ ID NO: 3; (e) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 3; or (f) a sequence which varies from SEQ ID NO: 3 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids; (g) a sequence according to SEQ ID NO: 4; (h) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 4; or (i) a sequence which varies from SEQ ID NO: 4 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
7. The method for determining NAb titre according to any one of the preceding claims, wherein: (a) at least one control solution comprises a negative control solution which lacks antibodies to the viral vector of interest; or (b) at least one control solution comprises a first negative control solution which lacks antibodies to the viral vector of interest, and a second positive control solution which comprises a sufficient concentration of neutralising antibodies to maximally inhibit transduction of the viral vector.
8. The method for determining NAb titre according to claim 7(b), wherein the positive control solution comprises IVIG (in-vitro immunoglobulin); optionally wherein the IVIG has a concentration of at least 20 μg/ml, 30 μg/ml, 50 μg/ml or more.
9. The method for determining NAb titre according to any one of the preceding claims wherein the sample from the patient is a plasma sample.
10. The method for determining NAb titre according to any one of the preceding claims wherein the sample diluent comprises IgG-depleted fetal bovine serum; optionally wherein the sample diluent further comprises DMEM.
11. The method for determining NAb titre according to any one of the preceding claims wherein the population of target cells comprises at least 20,000, at least 25,000, at least 50,000, at least 100,000, at least 150,000, or more than 150,000 target cells.
12. The method for determining NAb titre according to any one of the preceding claims wherein the target cells are HEK293 or HEK293T cells.
13. The method for determining NAb titre according to any one of the preceding claims wherein the viral particles are adeno-associated virus (AAV) viral particles.
14. The method for determining NAb titre according to claim 13 wherein the viral vector comprises: (a) a capsid of or deriving from naturally occurring AAV serotypes AAV 3 and/or AAV3B; (b) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 5; (c) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 6; (d) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 7; (e) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 8; (f) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 9; (g) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 10; or (h) a capsid of or deriving from naturally occurring serotype AAV5.
15. The method for determining NAb titre according to any one of the preceding claims, wherein the NAb titre is calculated or quantified using a nonlinear regression model to fit the reference solution data to a curve and obtain a precise half-maximal value at which 50% neutralisation occurs.
16. An AAV vector which encapsidates or comprises a recombinant vector genome comprising a transgene encoding a luciferase, wherein the luciferase is a synthetic luciferase which provides enhanced luminescence relative to a firefly luciferase.
17. The AAV vector of claim 16, or the method of any one of claims 1 to 15, wherein the recombinant vector genome is self-complementary.
18. The AAV vector of claim 16 or claim 17, wherein the recombinant vector genome comprises a transgene encoding a synthetic bright luciferase which comprises or consists of: (a) a sequence according to SEQ ID NO: 2; (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 2; (c) a sequence which varies from SEQ ID NO: 2 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids; (d) a sequence according to SEQ ID NO: 3; (e) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 3; (f) a sequence which varies from SEQ ID NO: 3 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids; (g) a sequence according to SEQ ID NO: 4; (h) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 4; or (i) a sequence which varies from SEQ ID NO: 4 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
19. The AAV vector of any one of claims 16 to 18, wherein the viral particles comprise: (a) a capsid of or deriving from naturally occurring AAV serotypes AAV 3 and/or AAV3B; (b) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 5; (c) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 6; (d) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 7; (e) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 8; (f) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 9; or (g) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 10.
20. A method of determining whether a patient is eligible for gene therapy using a viral vector comprising a capsid of interest, the method comprising determining the NAb titre of the patient to said viral vector using the method of any one of claims 1 to 15 and comparing it with a pre-determined threshold value, wherein if the Nab titre is at or below the threshold value, the patient is eligible for gene therapy using the viral vector.
21. A method of monitoring the progress of depletion of immunoglobulin which is specific for a viral vector comprising a capsid of interest, such as plasmapheresis or targeted depletion of immunoglobulin, in a patient wherein the method comprises the steps of: (a) determining the patient NAb titre to a viral vector comprising a capsid of interest within a set interval of time following a round of immunoglobulin depletion by carrying out the method of any one of claims 1 to 15 on a sample from the patient; (b) determining whether the NAb titre following immunoglobulin depletion is below a predetermined threshold value for eligibility of gene therapy; and optionally (c) determining, based on the NAb titre following immunoglobulin depletion, whether a further round of immunoglobulin depletion is appropriate; and optionally comparing the NAb titre following immunoglobulin depletion with an initial NAb titre to determine whether the immunoglobulin depletion has had any significant effect.
22. The method of claim 21, wherein the method additionally comprises: (d) determining the patient NAb titre to a viral vector comprising a capsid of interest within a set interval of time following a further round of immunoglobulin depletion by carrying out the method of any one of claims 1 to 24 on a sample from the patient; (e) determining whether the NAb titre following said further round of immunoglobulin depletion is below a pre-determined threshold value for eligibility of gene therapy; and optionally (f) determining, based on the NAb titre following immunoglobulin depletion, whether yet a further round of immunoglobulin depletion is appropriate; and optionally comparing the NAb titre following the previous rounds of immunoglobulin depletion with one another, and optionally with an initial NAb titre, in order to determine whether the immunoglobulin depletion has had any significant effect.
23. The method of claim 21 or claim 22, wherein the method additionally comprises: (g) determining the patient NAb titre to a viral vector comprising a capsid of interest within a set interval of time following a further round of immunoglobulin depletion by carrying out the method of the invention on a sample from the patient; (h) determining whether the NAb titre following said further round of immunoglobulin depletion is below a pre-determined threshold value for eligibility of gene therapy; and optionally (i) determining whether yet a further round of immunoglobulin depletion is appropriate.
24. The method of any one of claims 21 to 23, wherein the set interval of time is 24 hours or less, 19 hours or less, 12 hours or less, 9 hours or less or 6 hours or less.
25. The method of any one of claims 21 to 24, wherein the further round(s) of immunoglobulin depletion of step (c), step (f) and step (i) is/are carried out within 48 hours or less of the previous round of immunoglobulin depletion; optionally wherein the further round of immunoglobulin depletion of step (c), step (f) and step (i) is carried out the day after the previous round of immunoglobulin depletion; and optionally wherein the further round of immunoglobulin depletion is carried out within 24 hours of the previous round of immunoglobulin depletion.
26. The method of any one of claims 21 to 25, wherein the method comprises: (a) two rounds of immunoglobulin depletion over the course of two days; (b) three rounds of immunoglobulin depletion over the course of three days; (c) four rounds of immunoglobulin depletion over the course of four days; or (d) five rounds of immunoglobulin depletion over the course of five days.
27. The method of any one of claims 21 to 26, wherein the immunoglobulin depletion method is plasmapheresis; and optionally wherein the immunoglobulin depletion method is double filtration plasmapheresis (DFPP).
28. The method of any one of claims 21 to 26, wherein the immunoglobulin depletion method is: (a) a method of immunodepletion which specifically targets immunoglobulin; (b) a method of immunodepletion which uses an extracorporeal device which binds IgG; or (c) a method of immunodepletion which comprises the administration of an agent or enzyme (such as a IgG cysteine protease or IgG endoglycosidases) which digests human IgG, optionally wherein the method comprises administering to the subject an agent or enzyme which reduces Fc receptor binding of serum IgG molecules; optionally wherein the agent or enzyme is an IgG cysteine protease from a Streptococcus bacterium such as Streptococcus pyogenes, or an IgG endoglycosidase from a Streptococcus bacterium, such as Streptococcus pyogenes, Streptococcus equi or Streptococcus zooepidemicus, or from Corynebacterium pseudotuberculosis, Enterococcus faecalis, or Elizabethkingia meningoseptica; and optionally wherein the agent or enzyme comprises a sequence according to SEQ ID NO: 11 or SEQ ID NO: 12, or a fragment or variant thereof which has IgG cysteine protease activity.
29. An AAV viral vector for use in a method of treating a genetic disorder, the method comprising: (a) performing a method of immunoglobulin depletion on a patient; (b) monitoring the progress of depletion of immunoglobulin using the method of any one of claims 21 to 27; and (c) administering the AAV viral vector once the immunoglobulin is sufficiently depleted, wherein the AAV viral vector comprises a transgene that encodes a polypeptide implicated in the genetic disorder, the AAV viral vector comprises a capsid, and the patient has antibodies to the capsid.
Description
DESCRIPTION OF THE FIGURES
[0133] The present invention will now be described by way of non-limitative example with reference to the following figures, in which:
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
EXAMPLES
[0149] Two protocols were developed that can be completed within <9 hours or overnight, respectively referred to as the 6 and 16 hour protocols. Both protocols use the same amount of scAAV-Nluc reporter vector (i.e. 1/6,000, equivalent to 8.3×10.sup.6 vg/ml) and produce equivalent T150 values over 30 samples tested.
[0150] Assay sensitivity and robustness were considered in parallel during development. On one hand, sensitivity of these methods to the neutralising activity of a sample is inversely proportional to the amount of vector used, since the higher the amount of vector used during inhibition, the less likely it is for the assay signal to be meaningfully inhibited via vector neutralisation. On the other hand, the robustness of the assay signal is directly proportional to the amount of vector used because successful transduction and transgene expression depend on MOI. Therefore, to balance sensitivity and robustness for the assays, the smallest amount of vector was sought that would still yield a robust assay signal (Z′>0.5) within a short time frame. Any new batch of reporter scAAV-Nluc vector is recommended to be serially diluted to empirically determine the smallest dilution that still yields a robust assay signal, regardless of the estimated vg/ml or vp/ml titre.
[0151] The number of cells/well, the amount of vector used, and the time of incubation were all optimised. Within 3 h, a 1/3000 dilution of the AAV-Nluc vector (vg:cell MOI of 8.33:1) results in a marginal assay signal (Z′ value between 0 and 0.5). Within 6 h, a robust signal is obtained with a MOI of 0.83:1, simultaneously satisfying the requirements for sensitivity, robustness and the quick turnover of results. These conditions translate to a concentration of 8.3×10.sup.6 vg/ml during vector neutralisation for 1 hour at 37° C. and were not altered when extending the within-day protocol with a 16 hour transduction step.
Materials and Methods
Samples
[0152] Several plasma samples were used during the development and testing of the within-day and over-night protocols. Where indicated, test samples were diluted using a healthy human plasma sample (“TCS137”) with low anti-AAV neutralising activity. For a list of all other tested samples, sourced from TCS Biosciences and LGC, see below:
TABLE-US-00001 cTIA discrete sample ID titre LGC 3 1/80 LGC 30 1/80 LGC 33 1/80 LGC 34 1/80 TCS 67 1/100 TCS 79 1/100 TCS 80 1/100 TCS 81 1/100 TCS 105 1/100 TCS 118 1/100 LGC 35 1/100 LGC 47 1/100 LGC 49 1/100 LGC 50 1/100 TCS 27 1/200 TCS 55 1/200 TCS 70 1/200 TCS 85 1/200 TCS 106 1/200 LGC 9 1/200 TCS126 1/200 TCS127 1/200 TCS 73 1/400 TCS 92 1/400 TCS 93 1/400 TCS 117 1/400 TCS 40 1/800 TCS 44 1/800 TCS 56 1/800 TCS 59 1/800 TCS 62 1/800 TCS 64 1/800 TCS 87 1/800 TCS 108 1/800 TCS 112 1/800 TCS 113 1/800 TCS 89 1/1600 TCS 94 1/1600 TCS 95 1/1600 TCS 99 1/1600 TCS 100 1/1600 TCS 97 1/3200 TCS 98 1/3200 TCS 111 1/6400 TCS 101 1/12800
Assay Protocol
[0153] An in vitro transduction inhibition assay capable of delivering a result in 6 hours or 16 hours (i.e. overnight) was developed and tested. Upon transduction, the AAV-BrightLuc reporter vector (termed “scAAV-Nluc” using the capsid according to SEQ ID NO: 5) delivers a self-complementary AAV genome that expresses the luciferase known commercially as NanoLuc® from the upstream CMV promoter. The NanoLuc® luciferase is a small (19.1 kDa) ATP-independent luciferase that efficiently converts furimazine to furimamide (
[0154] In this assay, the positive control consists of sample diluent spiked with intravenous immunoglobulins (IVIG) at 1:1000 dilution (equivalent to 50 micrograms/milliliter), while the negative control is sample diluent alone. Both controls are supplemented with scAAV-Nluc vector, and the fold difference in signal (negative/positive control) is expected to exceed 100-fold. The sample diluent can be either human plasma (sourced as set out above) or a dilution of commercially available IgG-depleted FBS (see Example 9) in phenol-red free DMEM (Thermo Scientific cat. no. 31053-028), lacking in significant AAV neutralising activity.
[0155] The assay is carried out by using two 96-well plates: a v-bottom plate (Greiner Cellstar product no. 651180), in which a test sample is serially diluted and mixed with scAAV-Nluc over 1 hour, is termed the “neutralisation plate”. A white, sterile, TC (tissue culture) treated plate (Corning 3917) in which the neutralised sample and reporter vector mixtures are incubated with 1×10.sup.5 or 1.5×10.sup.5 HEK239T cells/well for 16 hours or 6 hours respectively is termed the “assay plate”.
[0156] Typically, 66 μl of sample is used to generate a serial dilution by moving and mixing 33 μl of this sample with 33 μl of pre-dispensed sample diluent. Each resulting sample dilution is then supplemented with 66 μl of diluted scAAV-Nluc vector such that the final reporter concentration is 8.3×10.sup.6 vg/ml. After 1 hour incubation at 37° C., the sample and vector mixtures are transferred to the assay plate by mixing in quadruplicate 15 μl of sample and vector mix to a 60 μl volume containing 150,000 HEK293T cells in suspension (6 hour protocol) or in triplicate 25 μl of sample and vector mix to a 50 μl volume containing 100,000 cells in suspension (16 hour protocol). By carrying out the transduction on cells in suspension, the method of the invention avoids the need for preparing the cells on plates in advance, in contrast with conventional reporter-based TIA methods which require the cells to be plated well in advance. Timings may differ according to the precise protocols employed, but in conventional reporter-based TIA methods, cells are generally plated at least overnight or 24 hours in advance of the assay.
[0157] After incubation (for 6 hours or 16 hours) under normal growth conditions (37° C., 5% CO2), each well of the assay plate is supplemented with 75 μl of Nano-Glo assay reagent containing the substrate for the luciferase (Promega N1110) prepared according to manufacturer's instructions. Luminescence is read on a plate reader using a reading height of 5 mm above the plate, and integration time of 0.5 ms.
Analysis
[0158] In this assay, the neutralising titre of a plasma or serum sample is calculated by fitting a four-parameter variable-slope model to the luminescent signal from each sample dilution after normalising with both positive (100% inhibition) and negative (0% inhibition) controls. The primary numerical output is the interpolated titre at 50% transduction inhibition, which the present inventors have termed “T150.” T150 ranks samples in proportion with their NAb content. An optional readout, which is employed in a conventional FACS-based transduction inhibition assay, is the discrete neutralising titre. The discrete neutralising titre is defined as the highest sample dilution in which the level of luminescence is ≥50% of the level of the assay positive control.
[0159] To compare results between two methods (e.g. cTIA vs 6 hour rTIA), a Spearman rank correlation value (r) is computed for the resulting T150s or discrete neutralising titres.
Example 1—Design of the scAAV Reporter Cassette: CMV-NanoLuc®-SV40 pA
[0160] The luciferase NanoLuc® (Hall, et al. 2012) was chosen for inclusion in an AAV reporter vector, using a CMV promoter which can drive robust gene expression in multiple cell lines. To boost expression rates, a self-complementary vector genome which bypasses the need for second strand synthesis was used. Together, these features form the basis of the scAAV-Nluc (also referred to herein as “AAV-BrightLuc” and “RC-01-31”) reporter vector.
[0161] To provide the most accurate measure of the vg/ml titre of the RC-01-31 vector, qPCR and capsid ELISA were carried out in parallel with a separate reporter vector, which is otherwise identical to the scAAV-Nluc apart from the inclusion of a transgene encoding GFP (green fluorescent protein) instead of a luciferase. This scAAV-eGFP (also referred to herein as (“AAV-eGFP”) reporter vector is currently used in a current FACS-based transduction inhibition assay (also referred to herein as “cTIA” to distinguish it from the rapid TIA (“rTIA”) of the invention). qPCR revealed a .sup.˜10× difference between these vectors, which was consistent with the results obtained using capsid ELISA (
Example 2—Evaluation of Luciferase Signal after Transduction with AAV-BrightLuc Over 6 Hours and 24 Hours
[0162] A conventional FACS-based transduction inhibition assay (cTIA) was used as a starting point in the development of the present method. Use of the scAAV-eGFP vector stock in the cTIA protocol includes application of 2.9×10.sup.6 vg to about 1.2×10.sup.4 HEK293T cells (per well) yielding a multiplicity of infection (MOI, defined as the ratio between the number of vector genomes and the number of host cells) of 250 (vg:cell) in a 50 μl volume (
[0163] To determine whether the AAV-BrightLuc vector could provide a luminescent signal within 6 hours of infection, several dilutions of this vector were applied to a suspension of HEK239T cells in a 50 μl volume. To provide as many available cell-association sites as possible for AAV, 1×10.sup.5 HEK239T cells (roughly 8× more than cTIA) were used during incubation. In addition to improving transduction rates, this number of cells allowed probing of a range of MOIs (8333:1-0.83:1,
[0164] Phenol red can hinder detection of weak luminescent signals and therefore phenol red-free DMEM (Catalogue no. 21063-029) was used to ensure efficient detection. 10% negative (“10%-ve”) plasma diluted in DMEM was also included during incubation, because it is equivalent to the maximum amount of FBS (foetal bovine serum) supplement used to routinely maintain HEK293T cells. After 6 hours or 24 hours of transduction, 50 μl of Nano-Glo reagent was added to each well and the assay plate was read every 3 minutes over 1 hour using a Molecular Devices i3× spectrophotometer. The resulting raw values were plotted against time for both 6-hour and 24-hour timepoints. The signal to background ratio and Z′ values were calculated against cells grown in the absence of scAAV-Nluc transduction. The CV values (defined herein as (standard deviation/average)*100) for the four technical replicates were calculated for each condition.
[0165] A robust and stable signal (defined here as >5,000 RLUs, or Relative Light Units) was obtained for all dilutions tested at both 6-hour and 24-hour timepoints (
[0166] After 6 hours post transduction, the CV values for the first four dilutions of AAV-BrightLuc vector tested were predominantly under 10%, or predominantly under 20% for the last dilution tested (1/30,000); and predominantly under 80% for the non-transduced cells control (
Example 3—Testing of Additional Dilutions of scAAV-Nluc at 3, 6 and 24 Hours with Different Cell Numbers Per Well
[0167] Several dilutions of scAAV-Nluc revealed robust signal after 6 hours of transduction. To explore the limits of this assay signal, the experiment was repeated with both 1/3,000 and 1/30,000 dilutions of AAV-BrightLuc and included a further 1/300,000 dilution. In addition, to characterise the impact of the cell number (and thus the available AAV association sites) on assay signal, 2.5×10.sup.4, 5×10.sup.4, and 10×10.sup.4 cells/well were tested. Finally, the luminescent signal was measured at 3 hours, 6 hours and 24 hours. A summary of the resulting assay conditions tested is provided in Table 1 below.
TABLE-US-00002 TABLE 1 Summary of the assay conditions used to evaluate the luminescent assay signal over 3, 6 and 24 hours while varying the amount of vector used and cells/well (an MOI of zero means that the MOI was less than 1). dil at at at sample at sample dil 2 neutralisation neutralisation on cells neutralisation on cells MOI neutralisation on cells reporter (1:x) (1:x) cells/well (vg/mL) (vg/mL) (vg) (vg) (vg/cell) (%) (%) scAAV-eGFP 750 10938 11700 5.8E+07 5.8E+07 1.0E+07 2.9E+06 250 1 1 (REFERENCE) scAAV-NLuc NA 3000 100000 NA 1.7E+07 NA 8.3E+05 8 10 10 scAAV-NLuc NA 30000 100000 NA 1.7E+06 NA 8.3E+04 1 10 10 scAAV-NLuc NA 300000 100000 NA 1.7E+05 NA 8.3E+03 0.83 10 10 scAAV-NLuc NA 3000 50000 NA 1.7E+07 NA 8.3E+05 17 10 10 scAAV-NLuc NA 30000 50000 NA 1.7E+06 NA 8.3E+04 2 10 10 scAAV-NLuc NA 300000 50000 NA 1.7E+05 NA 8.3E+03 0.83 10 10 scAAV-NLuc NA 3000 25000 NA 1.7E+07 NA 8.3E+05 33 10 10 scAAV-NLuc NA 30000 25000 NA 1.7E+06 NA 8.3E+04 3 10 10 scAAV-NLuc NA 300000 25000 NA 1.7E+05 NA 8.3E+03 0.83 10 10
[0168] A robust assay signal (>5,000 RLUs) was obtained for all conditions tested at 24 hours after transduction (
[0169] Taken together, these results indicate that use of 100,000 cells/well with a minimum of 1/30,000 dilution of AAV-BrightLuc vector yields a robust assay signal within 6 hours of transduction.
Example 4—Testing of scAAV-Nluc Neutralisation Using IVIG
[0170] In the cTIA, one of the positive controls consists a 1:2000 dilution of IVIG in the presence of 1% negative (“1%-ve”) plasma, defined herein as 1% negative plasma with normal growth media (DMEM) as the diluent. This mix is incubated with 5.8×10.sup.7 vg/ml of AAV-eGFP over 1 hour during neutralisation. Subsequently, 50 μl (2.9×10.sup.6 vg) of this mix is transferred to 1.2×10.sup.4 HEK293T cells growing on a 96-well dish, resulting in an MOI (vg:cells) of 250:1. In a successful run, this positive control yields an eGFP signal equivalent to less than 1% of the un-neutralised negative control (maximum signal), which consists of the same conditions but omits IVIG.
[0171] To determine whether the conditions established in the Materials and Methods section above produce a result equivalent to the cTIA, the level of inhibition with a 1:2000 dilution of IVIG was tested. In this experiment, neutralisation was carried out over 1 hour in a 50 μl volume in the presence of 1:2000 dilution of IVIG and 1%-ve plasma. In addition to the untransduced control, the amount of AAV-BrightLuc vector at this step was either 1/1,500, 1/15,000 or 1/150,000, which corresponds to 1.7×10.sup.7, 1.7×10.sup.6 or 1.7×10.sup.5 vg/ml respectively. 25 μl of this material was mixed with 25 μl of cell suspension containing 1×10.sup.5 cells in phenol-red free DMEM and 1%-ve plasma, yielding MOIs of 8.3, 0.83 and 0.083 to 1 respectively for each amount of AAV-BrightLuc reporter vector used. The assay was completed by supplementing with 50 μl of the Nano-Glo® reagent and reading the plate after 20 minutes of luminescent signal development.
[0172] A robust signal of greater than 1×10.sup.4 RLUs was obtained with both 1/3,000 and 1/30,000 dilutions of vectors (on cells). A weaker (1×10.sup.3 RLU) signal was obtained for the 1/300,000 dilution of the AAV-BrightLuc reporter vector (
[0173] For each condition tested, the percentage of maximum values were calculated by dividing the un-inhibited transduction signal by the matching IVIG-neutralised values. The remaining luminescence signal for 1/3,000, 1/30,000 and 1/300,000 dilutions of AAV-BrightLuc vector were 12.5%, 8% and 7% of maximum respectively (
[0174] Surprisingly, it was found that reduction of the AAV-BrightLuc vector amount used at neutralisation over 3 logs did not reduce the signal to below 1% of maximum, as achieved with the cTIA using eGFP. This is despite the amount of vector used at neutralisation and subsequent MOI (vg:cell) being similar or much lower than that of cTIA. Interestingly, the amount of inhibition achieved seems to plateau to about 93% (luminescent signal at 7% of maximum) instead of progressing to 100% as the amount of vector used is reduced. This indicates that for a fixed amount of IVIG (i.e. 1:2000 dilution) any additional reductions in the amount of vector used at the neutralisation step are unlikely to lead to 100% inhibition. Importantly, the inhibition plateau observed is not due to the inhibition signal equaling that of non-transduced controls (i.e. the assay bottoming out), as the signal produced by the IVIG-inhibited 1/300,000 dilution of AAV-BrightLuc is still roughly .sup.˜15 fold higher than that of non-transduced controls (
[0175] Taken together, these results indicate that there is no advantage to further reductions beyond 1/15,000 dilution (1.7×10.sup.6 vg/ml at neutralisation, MOI 0.83:1) in the amount of AAV-BrightLuc vector, which is the lowest amount of vector that still produces a robust assay signal.
Example 5—Determining the Neutralising Titre of IVIG Using scAAV-Nluc
[0176] A 1:2000 dilution of IVIG did not result in greater than 99% inhibition when incubated with very low dilutions of AAV-BrightLuc (at neutralisation: 1/150,000 or 1.7×10.sup.5 vg/ml). Further dilutions are not optimal since the luciferase signal produced is less than 1×10.sup.4 RLU. To determine the impact of these conditions on the apparent neutralising titre of IVIG, 100,000 cells/well (as described in Example 3) were incubated with either 1/30,000 (MOI 0.83:1) or 1/3,000 (MOI 8.3:1) of AAV-BrightLuc over 6 hours after a 1 hour neutralisation with IVIG dilutions in 2% negative plasma, during which the vector concentration was respectively 1.7×10.sup.6 and 1.7×10.sup.7 vg/ml. The amount of negative plasma applied to cells during infection is determined by the starting dilution of a sample being tested. For example, a 1:100 starting dilution in cTIA results in 1% negative plasma applied to cells during the 2-day transduction step. At this stage of the assay development, a 2% negative plasma background was chosen so that eventual sample testing could provide enhanced sample stratification by beginning with a 1:50 dilution. Starting at 1:500, a further 21 IVIG dilutions were generated using a 1.41 dilution factor. Positive controls consisted of untransduced cells (NT), while the negative control consisted of AAV-BrightLuc vector incubated for 1 hour and transducing for 6 hours in the presence of 2% negative plasma. The resulting luminescence values were normalised to the signal of negative (0% inhibition) and positive (100% inhibition) controls before a four-parameter variable slope model was used to estimate the resulting EC50s. The neutralising titre of IVIG established with cTIA is 1:10,000. In this experiment, the EC50 titre obtained with both vector dilutions was 1:10,124 and 1:9,461 with 1/15,000 (
[0177] These results indicate that a log difference in the amount of reporter vector used during the transduction inhibition assay has minimal impact on the overall measurement of the neutralising titre. Furthermore, 1:1000 IVIG dilution is required before >99% inhibition of luminescent signal is obtained. Together with results from Example 4, these outcomes indicate that with these assay conditions, the neutralising titre of plasma samples obtained may be 2-fold less than that obtained with cTIA.
Example 6—Comparing 6 Hour rTIA (Rapid TIA) with cTIA Neutralising Titres
[0178] The best assay conditions for sample testing have been determined to include the use of 1×10.sup.5 cells/well (Example 3) and a vector dilution at neutralisation between 1/1,500 (1.7×10.sup.7 vg/ml) and 1/15,000 (1.7×10.sup.6 vg/ml) (Example 5). At both these amounts of AAV-BrightLuc vector, 1:1000 IVIG resulted in 99% inhibition of the luminescent signal, justifying its use as positive control in all future experiments (Example 5).
[0179] To further compare the two methods, the discrete neutralising titre and calculated EC50s of samples tested with cTIA was determined by using the conditions established in the above Examples, but with the following modifications:
1. 1 hour neutralisation of a 1/6,000 dilution (8.3×10.sup.6 vg/ml) of scAAV-Nluc vector in the presence of 50% negative plasma or sample (1:2 starting dilution of sample)
2. To enable titering to begin with a 1:2 dilution of a test sample, a final 10% negative plasma applied to cells (using the methodology set out above)
3. 6 hours of transduction on 1.5×10.sup.5 cells/well—an increase in cells/well of 50% to ensure robust luminescent signal (>1×10.sup.4 RLU)
[0180] Starting at 1:2 dilution of a test sample in negative plasma, a further 11 dilutions were generated using a 2-fold dilution factor. A 1:1000 dilution of IVIG at neutralisation was used as positive control, while the negative control consisted of AAV-BrightLuc vector incubated for 1 hour and applied to cells (transduction) for 6 hours in the presence of 10% negative plasma. The resulting luminescence values were normalised to the signal of negative (0% inhibition) and positive (100% inhibition) controls before a four-parameter variable slope model was used to estimate the neutralising titre. The term “EC50” is used here interchangeably with the term “T150” (meaning transduction inhibition 50%) to reflect the estimation of inhibition titre of a sample using this method.
[0181] 36 normal healthy human plasma samples obtained from LGC and TCS (commercial providers) were assayed with the protocol conditions described in this section. To enable comparison, the existing cTIA titres for these samples were re-analysed to estimate their TI50/EC50 values. Because some cTIA assays were carried out with only 4 dilutions (1/100, 200, 300 and 400), T150's were not generated from all available samples. Therefore, 26 and 36 comparison points could be generated for TI50 (
[0182] Comparison of rTIA and cTIA results was carried out by computing the Spearman rank correlation test for both T150s and discrete titres. For each correlation plot, the shape of each data point indicates the discrete titre obtained in cTIA. Correlation coefficients of 0.85 (
[0183] A 3-fold drop in rTIA T150s was obtained for all samples over 1/400 by comparison with cTIA. Surprisingly, it was found that this decrease in apparent neutralising titre was exacerbated (up to 10-fold) for samples 1/400. A similar outcome was observed when discrete titres were compared.
[0184] A better correlation between rTIA and cTIA was obtained when discrete titres were used (0.91 vs 0.85 for TI50s) likely because of the expanded number of comparison points available (26 for T150s vs 36 for discrete titres). Together, the excellent correlation between cTIA and rTIA indicates that both assays will likely rank patients similarly. Given this excellent correlation between rTIA and cTIA and the availability of samples from patients that have already been screened and dosed based on the latter, it is clear that the method of the invention provides comparably accurate results to conventional methods in a shorter time-frame.
Example 7—Development and Testing of a 16 Hour (Overnight) Transduction Inhibition Assay Protocol
[0185] In addition to the 6 hour rTIA protocol, an overnight (16 hour) protocol using the same AAV-BrightLuc vector was designed to ensure maximum flexibility with sample testing in the clinical setting. Results from Example 6 revealed that the greatest discrepancies in neutralising titre were obtained with a cTIA titre of ≤1:400. Therefore, instead of IVIG which has an apparent titre of 1/10,000 with both cTIA and rTIA, plasma sample TCS93 was chosen for testing. The 6 hour protocol used in Example 6 (described in the Materials & Methods section) was used without further modifications beyond the transduction time component. Two assay plates were set up, to be completed at 6 hours and 16 hours post transduction. T150s were calculated as previously described (see Example 6).
[0186] For this sample, a TI50 of 1:139 and 1:225 was obtained at 6 hours and 16 hours respectively, yielding a .sup.˜40% increase in the apparent neutralising titre (
Example 8—Expanded Testing of the Overnight (16 h) Protocol
[0187] Preliminary testing described in Example 7 established that evaporation reduced the resulting luminescent signal in the outer edges of the 96-well assay plate, likely by altering cell growth conditions overnight. To circumvent this problem, the outer edges of the plate were not included in the assay plate layout. The final 6 hour rTIA includes 1.5×10.sup.5 cells/well cultured over 6 hours of transduction. The same number of cells may grow to contact inhibition overnight, resulting in possible distortion of the assay signal which is dependent on optimal cell growth and by extension, gene expression. To prevent issues related to cell growth, the number of cells/well was reduced to 1×10.sup.5.
[0188] All other assay conditions were kept identical to the 6 hour protocol described in the above Examples. Testing of available samples produced 25 and 33 comparison points (cTIA vs rTIA) for T150s and discrete titres respectively. Sample ranking using the 16 hour protocol was similar to cTIA (Spearman rank coefficient of 0.90 and 0.93 for T150s and discrete titres respectively,
Example 9—Standardising of Sample Diluent: Comparison of IgG-Depleted FBS and AAV-NAF Negative Healthy Human Plasma
[0189] Commercial companion diagnostic assays require the standardisation of all reagents used. The sample diluent used in Examples 2 to 8 above was plasma from a healthy human donor. Because of the limited availability and production traceability of human plasma samples, a different and more commonly available assay diluent was sought. HEK293T cells are routinely maintained in DMEM supplemented with 10% foetal bovine serum (FBS). This component of the growth media is available in protein-G IgG depleted form with an advertised IgG concentration of less than 5 ug/mL (Gibco catalogue 16250086). In the present experiment, the use of IgG-depleted FBS as sample diluent was investigated.
[0190] Sample TCS85, an abundant test plasma sample, was diluted as previously described (Materials & Methods above) using negative plasma, and either a 50% or 10% dilution thereof in phenol red-free DMEM. In parallel, the same sample was diluted in IgG-depleted FBS, as well as a 50% or 10% dilution thereof in phenol red-free DMEM. Because of sample treatment, the resulting concentration of diluent (negative plasmas or IgG-depleted FBS) in the assay plate is 10%, 5% or 1% for neat, 50%, and 10% compositions of the sample diluent. The assay was then carried out using the 16 hour protocol described above in Example 8.
[0191] The T150s obtained with IgG-depleted FBS are very similar to those obtained with negative plasma (“TCS137,”
Example 10—Re-Testing of Healthy Plasma Samples Using 50% IgG-Depleted FBS as Sample Diluent
[0192] The 16 hour protocol described above was used to retest healthy plasma samples. Testing of available samples produced 24 and 32 comparison points (AAV-eGFP vs AAV-BrightLuc) for T150s and discrete titres respectively. Sample ranking using IgG-depleted FBS as sample diluent was similar to cTIA (Spearman rank coefficient of 0.94 for both T150s and discrete titres,
[0193] Finally, the 16 hour protocol results from both negative plasma and IgG-depleted FBS samples were compared. A Spearman rank correlation of 0.99 was obtained indicating strong agreement between the T150 values produced by these protocols (
[0194] Taken together, these results indicate that the 16 hour protocol using 50% IgG-depleted FBS as sample diluent performs very similarly to the 6 hour protocol as described in Example 2 to Example 6 and the 16 hour protocol described in Example 8.
Example 11—Examining the Effect of Plasmapheresis on Antibody and NAb Titre
[0195] Double filtration plasmapheresis (DFPP) is a routine method for removing antibodies from circulation and is conventionally used in patients prior to undergoing transplantation surgery. Biobank plasma samples from 36 patients who had undergone up to 5 rounds of DFPP prior to kidney transplant were retrospectively analysed. Pre- and post-cycle plasma samples were tested for anti-AAV antibodies using both ELISA and a GFP-based conventional TIA (cTIA) using the methodology described above.
[0196] After each successive round of DFPP in transplant patients, the total and neutralising titres of AAV Ab decreased. A pattern of antibody re-synthesis and/or redistribution from tissues was observed between cycles, although subsequent rounds always enabled further reductions in antibody titre compared to baseline. ELISA analysis (
[0197] The GFP-based TIA (cTIA) found (
Example 12—Comparing the Results of TIA with ELISA
[0198] To demonstrate the utility of the AAV-NLuc based TIA assay in a disease relevant population, the neutralising titre was measured in 62 haemophilia B patient samples. Nanoluc-based TIA was carried out as described above, with a 16 h (overnight) immunocomplex formation step and 100,000 HEK239T cells in the 75 μL transduction reaction. An indirect ELISA to measure anti-AAV IgGs was carried out as follows: The capture substrate, an AAV viral vector particle, was coated onto the surface of a NUNC MaxiSorp 96-well plate overnight at +2 to +8° C. Following a wash step to remove any unbound AAV antigen, the plates were blocked. A further wash step to remove the blocking buffer was followed by the addition of controls and test samples.
[0199] Following incubation, and washing away any unbound material, a polyclonal anti-human antibody conjugated to HRP was added. After incubation with the detection antibody and a further wash step, the substrate chromogen SIGMA FAST™, OPD (o-Phenylenediamine dihydrochloride) peroxidase was added to the wells. The reaction was stopped by addition of 3M HCl and the optical density was determined using a microplate reader set to 492 nm with a reference wavelength of 630 nm. When comparing the TIA and ELISA results, it was found that an ELISA cut-off of 10 μg/mL produces false-negative and false-positive rates of 16 and 27% respectively (
[0200] Finally, a comparison (
Example 13—Comparing the Effects of Consecutive Vs Non-Consecutive DFPP
[0201] The plasma samples tested in Example 11 above were obtained from patients who were undergoing DFPP prior to kidney transplantation. In that instance, the five cycles of DFPP were in most cases not carried out on successive days (deemed “consecutive”) but at longer intervals (deemed “non-consecutive”), usually with 48 hours or 72 hours elapsing between cycles, and occasionally more.
[0202] As shown in Example 11 above and
[0203] The BL-TIA assay of the invention was used to retest samples from six of the patients from Example 11 above, four of whom underwent 3 rounds of DFPP on successive days (“consecutive”). As shown in
[0204] Analysis of samples from this “consecutive” administration of DFPP yielded a reduction in NAb titre (measured using the T150) of 66%, 60%, and 58% for the first, second and third cycles, respectively (
[0205] An analysis of the initial and final samples from these 6 patients found an average of 85% reduction in AAV NAb titre (
[0206] Analysing consecutive rounds of DFPP confirm that the first round is most efficient: 66% of AAV NAbs were removed on the first consecutive day with similar, but lower, percentages removed on subsequent days. Overall, 3 “consecutive” rounds of DFPP decreased AAV NAb titres by 79±9%.
[0207] To further understand the minimum number of cycles required to reduce AAV NAbs, regression analysis was performed, using average reductions obtained using three “consecutive” DFPP cycles (i.e. where each cycle is performed the day after the previous cycle). This analysis showed that four “consecutive” cycles of DFPP yield a similar NAb reduction to five “non-consecutive” cycles. Importantly, five “consecutive” cycles are predicted to reduce the starting AAV NAb titre by 94% (
[0208] Accordingly, using the TIA of the invention which crucially provides an accurate NAb titre result in substantially less than 24 hours and (as demonstrated above) can reliably do so after only 16 or even 6 hours of transduction, it can be seen that consecutive rounds of apheresis can reduce anti-AAV Nabs to levels aligned with clinical trial inclusion.
Example 14—Comparing the Efficacy of the TIA Across AAV Serotypes
[0209] This TIA procedure described in the above examples can be used to compare the neutralising antibody (NAb) status of multiple (e.g. 96 or more) individual human plasma samples following incubation with any AAV serotype containing a vector genome encoding the Nanoluc luciferase from the CMV promoter.
[0210] All plasma samples are mixed 1:1 with a dilution of AAV vector (e.g. 1×10.sup.4, 1×10.sup.5, 1×10.sup.6 or more vg/mL of AAV-Nluc or AAV5-Nluc vector, or any other serotype of AAV, whether naturally-occurring or synthetic/engineered) so as to obtain a 50% plasma-vector mixture and incubated over a given amount of time (e.g. 1, 2 or 3 h) at 37° C. to enable complex formation between neutralizing factors in the plasma (e.g. antibodies) and AAV particles.
[0211] Subsequently, this material is diluted 1:5 in a cell suspension to obtain a mixture containing an appropriate number of cells (e.g. 25,000, 50,000 or 100,000 cells) of a relevant cell line or primary cells (e.g. HEK239T, HUH7s, liver primary cells etc).
[0212] After overnight incubation at 37° C., 5% CO.sub.2, cells are lysed and NanoLuc expression quantified by mixing 1:1 with the NanoGlo reagent following the instructions provided with the reagent. The methods described above are used to categorize samples as either positive or negative for the presence of AAV neutralization.
[0213] The TIA of the invention provides a sufficient luminescent signal within the time-frame for many serotypes, including AAV5, which do not efficiently transduce a given cell line of interest (e.g. HEK293T). Thus the TIA of the invention provides acceptable assay quality and robustness parameters (e.g. Z′>0.5 and CVs <25%) even for those serotypes.
[0214] A key advantage of this method is the ability to compare transduction of serotypes with large variation in transduction efficiency in a short period of time (so as to support higher throughput) on the same cell line using typically low amounts of vector, such as those used by a efficiently transducing serotype. Low amounts of reporter vector (i.e. scAAV-NLuc) enable more sensitive TIAs and provide a more complete picture of seroprevalence. Taken together, this method enables comparison of seroprevalence by conducting the experiment under identical (amount of vector, time of incubation, cell type), high-throughput, and sensitive conditions.
Sequence Listing Table
[0215]
TABLE-US-00003 SEQ ID NO. Sequence description/derivation 1 Amino acid sequence of a firefly luciferase derived from Photinus pyralis (UniProt database Q27758) 2 Amino acid sequence of a synthetic luciferase commercially named “NanoLuc” (Promega); derived from Oplophorus gracilirostris 3 Amino acid sequence of a synthetic luciferase commercially named “TurboLuc” (Thermo Scientific); derived from the marine copepod Metridia pacifica luciferase family 4 Amino acid sequence of a synthetic luciferase commercially named “Lucia” (InvivoGen); derived from planktonic copepods 5 Amino acid sequence of an AAV capsid used in “scAAV-Nluc” 6 Recombinant AAV capsid protein, SEQ ID NO: 31 from WO 2013/029030 7 Recombinant AAV capsid protein, SEQ ID NO: 46 from WO 2013/029030 8 Recombinant AAV capsid protein, SEQ ID NO: 47 from WO 2013/029030 9 Recombinant AAV capsid protein, SEQ ID NO: 54 from WO 2013/029030 10 Recombinant AAV capsid protein, SEQ ID NO: 56 from WO 2013/029030 11 An enzyme having IgG cysteine protease activity 12 An enzyme having IgG cysteine protease activity
TABLE-US-00004 SEQ ID NO: 1 MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVNITYAEYFEMSVRLAEAMKRYGLNTN HRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMNISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDS KTDYQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGSPKGVALPHRTACVRFSHARDPIFGNQI IPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTLIDKYDLSNLHEI ASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGE LCVRGPMIMSGYVNDPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGCQVAPAELESILLQHPNIFD AGVAGLPGDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILIKAK KGGKSKL SEQ ID NO: 2 MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIE KIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRV TINGVTGWRLCERILA SEQ ID NO: 3 MEAEAERGKLPGKKLPLEVLIELEANARKAGCTRGCLICLSKIKCTAKMKKYIPGRCADYGGDKKTGQAGIVGAIVDI PEISGFKEMEPMEQFIAQVDRCADCTTGCLKGLANVKCSDLLKKWLPGRCATFADKIQSEVDNIKGLAGD SEQ ID NO: 4 MEIKVLFALICIAVAEAKPTEINEDLNIAAVASNFATTDLETDLFTNWETMNVISTDTEQVNTDADRGKLPGKKLPP DVLRELEANARRAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGEKESAQGGIGEAIVDIPEIPGFKDKEPLDQFIAQ VDLCADCTTGCLKGLANVQCSDLLKKWLPQRCTTFASKIQGRVDKIKGLAGDR SEQ ID NO: 5 MAADGYLPDWLEDNLSEGIREWWALKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADAAA LEHDKAYDQQLQAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAPGKKRPV DQSPQEPDSSSGVGKSGKQPARKRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAPMADNNEGAD GVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKKLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPA DVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLY YLNRTQGTTSGTTNQSRLLFSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWTAASKYHLNGRDS LVNPGPAMASHKDDEEKFFPMHGNLIFGKEGTTASNAELDNVMITDEEEIRTTNPVATEQYGTVANNLQSSNTAP TTRTVNDQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQIMIKNTPVPANPPTTFSP AKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL (= SEQ ID NO: 31 of WO 2013/029030) SEQ ID NO: 6 MAADGYLPDWLEDNLSEGIREWWALQPGAPKPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAA ALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPV DQSPQEPDSSSGVGKSGKQPARKRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAPMADNNEGAD GVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKKLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPA DVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLY YLNRTQGTTSGTTNQSRLLFSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWTAASKYHLNGRDS LVNPGPAMASHKDDEEKFFPMHGNLIFGKEGTTASNAELDNVMITDEEEIRTTNPVATEQYGTVANNLQSSNTAP TTRTVNDQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQIMIKNTPVPANPPTTFSP AKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRPL (= SEQ ID NO: 46 of WO 2013/029030) SEQ ID NO: 7 MAADGYLPDWLEDNLSEGIREWWALQPGAPKPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAA ALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPV DQSPQEPDSSSGVGKSGKQPARKRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAPMADNNEGAD GVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKKLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPA DVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLY YLNRTQGTTSGTTNQSRLLFSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWTAASKYHLNGRDS LVNPGPAMASHKDDEEKFFPMHGNLIFGKEGTTASNAELDNVMITDEEEIRTTNPVATEQYGTVANNLQSSNTAP TTRTVNDQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQIMIKNTPVPANPPTTFSP AKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRPL (= SEQ ID NO: 47 of WO 2013/029030) SEQ ID NO: 8 MAADGYLPDWLEDNLSEGIREWWALQPGAPKPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAA ALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPV DQSPQEPDSSSGVGKSGKQPARKRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAPMADNNEGAD GVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFS PRDWQRLINNNWGFRPKKLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPA DVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLY YLNRTQGTTSGTTNQSRLLFSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWTAASKYHLNGRDS LVNPGPAMASHKDDEEKFFPMHGNLIFGKEGTTASNAELDNVMITDEEEIRTTNPVATEQYGTVANNLQSSNTAP TTRTVNDQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQIMIKNTPVPANPPTTFSP AKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRPL (= SEQ ID NO: 54 of WO 2013/029030) SEQ ID NO: 9 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADATA LEHDKAYDQQLQAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAPGKKRPV EPSPQRSPDSSTGIGKKGQQPARKRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAPMADNNEGA DGVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCH FSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFP ADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYL YYLNRTQGTTSGTTNQSRLLFSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWTAASKYHLNGRD SLVNPGPAMASHKDDEEKFFPMHGNLIFGKEGTTASNAELDNVMITDEEEIRTTNPVATEQYGTVANNLQSSNTA PTTRTVNDQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSA AKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVYSEPRPIGTRYLTRNL (= SEQ ID NO: 56 of WO 2013/029030) SEQ ID NO: 10 MAADGYLPDWLEDTLSEGIRQWWALKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADAAA LEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAPGKKRPVE PSPQRSPDSSTGIGKKGQQPARKRLNFGQTGDSESVPDPQPLGEPPAAPTSLGSNTMASGGGAPMADNNEGAD GVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCHF SPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPA DVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLY YLNRTQGTTSGTTNQSRLLFSQAGPQSMSLQARNWLPGPCYRQQRLSKTANDNNNSNFPWTAASKYHLNGRDS LVNPGPAMASHKDDEEKFFPMHGNLIFGKEGTTASNAELDNVMITDEEEIRTTNPVATEQYGTVANNLQSSNTAP TTRTVNDQGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAA KFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVYSEPRPIGTRYLTRNL (= SEQ ID NO: 1 of WO 2016/012285) SEQ ID NO: 11 DSFSANQEIRYSEVTPYHVTSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNML HWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVID MFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYA NVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQ DSWNQTN (= SEQ ID NO: 2 of WO 2016/012285) SEQ ID NO: 12 EEKTVQVQKGLPSIDSLHYLSENSKKEFKEELSKAGQESQKVKEILAKAQQADKQAQELAKMKIPEKIPMKPLHGPL YGGYFRTWHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATKHVPKLNKQGTRVIRTIPWRFL AGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVDVEHDSIPKVDKKEDTAGVERSIQVFEEIGKLIG PKGVDKSRLFIMDSTYMADKNPLIERGAPYINLLLVQVYGSQGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQY MIGFSFYEENAQEGNLWYDINSRKDEDKANGINTDITGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKY AKQKEFKDATDNIFHSDYSVSKALKTVMLKDKSYDLIDEKDFPDKALREAVMAQVGTRKGDLERFNGTLRLDNPAI QSLEGLNKFKKLAQLDLIGLSRITKLDRSVLPANMKPGKDTLETVLETYKKDNKEEPATIPPVSLKVSGLTGLKELDLSG FDRETLAGLDAATLTSLEKVDISGNKLDLAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSL RLPVANEKVDLQSQLLFGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDSTLGTTT DKTLATDKEETYKVDFFSPADKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSADPVNARKVFDGQLGSETDNIS LGWDSKQSIIFKLKEDGLIKHWRFFNDSARNPETTNKPIQEASLQIFNIKDYNLDNLLENPNKFDDEKYWITVDTY SAQGERATAFSNTLNNITSKYWRVVFDTKGDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELSQQKDKFSQKML DELKIKEMALETSLNSKIFDVTAINANAGVLKDCIEKRQLLKK
NUMBERED ASPECTS OF THE INVENTION
[0216] 1. A method for determining neutralising antibody (NAb) titre to a viral vector comprising a capsid of interest in a sample from a subject, the method comprising a transduction inhibition assay (TIA) using a luciferase which comprises the following steps: [0217] (a) incubating particles of a viral vector comprising the capsid of interest in (1) one or more reference solutions comprising the sample at varying dilutions, and (2) at least one control solution, wherein the viral vector of part (a) comprises a recombinant vector genome comprising a transgene encoding the luciferase; [0218] (b) exposing each of the solutions from step (a) to a population of target cells which are susceptible to infection by the viral vector of interest; [0219] (c) waiting for a set interval of time to allow transduction to occur; [0220] (d) adding a substrate for the luciferase to the reference and control solutions and measuring the signal (RLU) obtained from the luciferase; [0221] (e) comparing the signal (RLU) obtained from the luciferase in the at least one control solution with the signal (RLU) obtained from the luciferase in the reference solutions; and [0222] (f) calculating the NAb titre;
wherein: [0223] (i) the set interval of time in step (c) is less than 24 hours, optionally is 19 hours or less, optionally is 12 hours or less, optionally is 8 hours or less, optionally is 6 hours or less and optionally is 3 hours; and [0224] (ii) the luciferase is a synthetic luciferase which provides enhanced luminescence relative to a firefly luciferase.
2. The method of aspect 1, wherein the set interval in step (c) is 6 hours or less.
3. The method of aspect 1, wherein the set interval in step (c) is 3 hours.
4. The method of any one of the preceding aspects wherein the synthetic luciferase has enhanced luminescence relative to a firefly luciferase having a sequence according to SEQ ID NO: 1.
5. The method of any one of the preceding aspects wherein the synthetic luciferase is derived from a naturally-occurring wild-type luciferase having one or more of the following modifications: [0225] (a) greater stability relative to the wild-type luciferase; [0226] (b) smaller size (kDa) relative to the wild-type luciferase; [0227] (c) deletion or removal of one or more subunits of the wild-type luciferase; [0228] (d) one or more conservative or nonconservative amino acid substitutions, additions and/or deletions relative to the wild-type amino acid sequence.
6. The method of any one of the preceding aspects wherein the synthetic luciferase is less than 50 kDa, less than 30 kDa, less than 25 kDa or less than 20 kDa.
7. The method of any one of the preceding aspects wherein the synthetic luciferase is ATP-independent.
8. The method of any one of the preceding aspects wherein the synthetic luciferase uses furimazine, or a derivative or variant thereof, as a substrate.
9. The method of any one of the preceding aspects, wherein the synthetic luciferase uses coelenterazine, or a derivative or variant thereof, as a substrate.
10. The method of any one of the preceding aspects wherein enhanced luminescence of the synthetic luciferase is determined by measuring the luminescence signal (RLU) of the synthetic luciferase and its substrate and the luminescence signal (RLU) of the firefly luciferase and its luciferine substrate under the same conditions.
11. The method of aspect 10, wherein the signal (RLU) of the synthetic luciferase and its substrate is greater by at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 150-fold or more than the signal (RLU) of the firefly and its luciferine substrate.
12. The method of aspect 10, wherein the signal (RLU) of the synthetic luciferase and its substrate is greater by at least 80- to 100-fold or more than the signal (RLU) of the firefly luciferase and its luciferine substrate.
13. The method of any one of the preceding aspects wherein the synthetic bright luciferase comprises: [0229] (a) a sequence according to SEQ ID NO: 2; [0230] (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 2; or [0231] (c) a sequence which varies from SEQ ID NO: 2 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
14. The method of any one of aspects 1 to 12, wherein the synthetic bright luciferase comprises: [0232] (a) a sequence according to SEQ ID NO: 3; [0233] (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 3; or [0234] (c) a sequence which varies from SEQ ID NO: 3 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
15. The method of any one of aspects 1 to 12, wherein the synthetic bright luciferase comprises: [0235] (a) a sequence according to SEQ ID NO: 4; [0236] (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 4; or [0237] (c) a sequence which varies from SEQ ID NO: 4 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
16. The method of any one of the preceding aspects, wherein at least one control solution comprises a negative control solution.
17. The method of aspect 16 wherein the negative control solution lacks antibodies to the viral vector of interest.
18. The method of any one of aspects 1 to 15 wherein at least one control solution comprises a first negative control solution and a second positive control solution 19. The method of aspect 18 wherein the first negative control solution lacks antibodies to the viral vector of interest.
20. The method of aspect 18 or aspect 19 wherein the second positive control solution comprises a sufficient concentration of neutralising antibodies to maximally inhibit transduction of the viral vector of interest.
21. the method of any one of aspects 18 to 20 wherein the positive control solution comprises IVIG (in-vitro immunoglobulin).
22. The method of aspect 21 wherein the IVIG solution has a sufficiently high concentration to ensure the maximal possible inhibition of the viral vector of interest.
23. the method of aspect 21 or aspect 22 wherein the IVIG solution has a concentration of at least 20 μg/ml, 30 μg/ml, 50 μdml or more.
24. The method of aspect 23 wherein the IVIG has a concentration of at least 50 μg/ml.
25. The method of any one of aspects 18 to 24, wherein the method includes a step of serially diluting the positive control solution and carrying out steps (a) to (d) of aspect 1 on the serial dilutions in order to establish the 50% inhibition level (EC50) of the positive control solution.
26. The method of any one of the preceding aspects wherein the sample from the patient comprises or is a plasma sample.
27. The method of any one of the preceding aspects, wherein the population of target cells comprises (a) at least 20,000 target cells; [0238] (b) at least 25,000 target cells; [0239] (c) at least 50,000 target cells; [0240] (d) at least 100,000 target cells; [0241] (e) at least 150,000 target cells; or [0242] (f) more than 150,000 target cells.
28. The method of any one of the preceding aspects, wherein the population of target cells comprises mammalian cells.
29. The method of any one of the preceding aspects wherein the target cells comprise HEK-293, HEK-293T, CHO, BHK, MDCK, 10T1/2, WEHI cells, COS, BSC 1, BSC 40, BMT 10, VERO, W138, MRCS, A549, HT1080, 293, B-50, 3T3, NIH3T3, HepG2, Saos-2, Huh7, HER, HEK, HEL, or HeLa cells.
30. The method of any one of the preceding aspects, wherein the target cells comprise HEK293 cells or HEK293T cells.
31. The method of any one of the preceding aspects, wherein the viral particles comprise adeno-associated virus (AAV) viral particles.
32. The method of aspect 31, wherein the AAV particles comprise a capsid of or deriving from naturally-occurring AAV serotypes AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV 10, AAV11, AAV 12, or a mixture thereof; optionally wherein the AAV particles comprise a capsid of or deriving from AAV5.
33. The method of aspect 31, wherein the AAV particles comprise a capsid which is non-naturally occurring or synthetic or engineered.
34. The method of aspect 33 wherein the non-naturally occurring capsid is derived from AAV3 or AAV3B.
35. The method of aspect 33 or aspect 34 wherein the AAV particles comprise: [0243] (a) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 5; [0244] (b) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 6 (SEQ ID NO: 31 from WO 2013/029030); [0245] (c) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 7 (SEQ ID NO: 46 from WO 2013/029030); [0246] (d) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 8 (SEQ ID NO: 47 from WO 2013/029030); [0247] (e) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 9 (SEQ ID NO: 54 from WO 2013/029030); or [0248] (f) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 10 (SEQ ID NO: 56 from WO 2013/029030).
36. The method of any one of aspects 1 to 30, wherein the viral particles comprise lentiviral particles.
37. The method of any one of the preceding aspects, wherein step (a) of aspect 1 comprises incubating the particles of the viral vector of interest at a concentration of between 1.7×10.sup.7 and 1.7×10.sup.5 vg/ml.
38. The method of any one of the preceding aspects, wherein step (a) of aspect 1 comprises incubating the particles of the viral vector of interest at a concentration of 8.3×10.sup.6 vg/ml.
39. The method of any one of the preceding aspects, wherein step (b) of aspect 1 comprises exposing the viral particles and target cells at a ratio vg:cells (multiplicity of infection (MOI)) of 250:1 or less, 200:1 or less, 100:1 or less, 50:1 or less, 25:1 or less, 10:1 or less, or 1:1 or less.
40. The method of any one of the preceding aspects, wherein the sample diluent comprises or is healthy human plasma.
41. The method of any one of aspects 1 to 39 wherein the sample diluent comprises fetal bovine serum (FBS).
42. The method of aspect 41 wherein the sample diluent comprises IgG-depleted FBS.
43. The method of any one of aspects 40 to 42, wherein the sample diluent further comprises DMEM.
44. The method of aspect 43 wherein the DMEM is phenol-red free DMEM.
45. The method of any one of the preceding aspects, wherein the sample dilution and/or the positive control dilution comprises a serial dilution.
46. The method of aspect 45 wherein the serial dilution comprises a 2-fold dilution factor.
47. The method of aspect 45 or aspect 46 wherein the serial dilution comprises one or more of 1:2, 1:4, 1:8, 1:16, 1:32, 1:64, 1:128, 1:256, 1:1024, 1:2048, or 1:4096.
48. The method of any one of aspects 45 to 47, wherein the serial dilution comprises one or more of 1:10, 1:50, 1:100, 1:200, 1:400, 1:800, 1:1600, or 1:3200.
49. The method of any one of aspects 45 to 48, wherein the serial dilution comprises between 5 and 15 dilutions.
50. The method of any one of aspects 45 to 49, wherein the serial dilution comprises between 8 and 11 dilutions.
51. The method of any one of the preceding aspects, wherein step (b) of aspect 1 comprises providing the population of cells on an assay plate and adding the solutions thereto.
52. The method of aspect 51 wherein the assay plate is a multi-well assay plate.
53. The method of any one of the preceding aspects wherein step (d) of aspect 1 includes a step of lysing the cells to release the synthetic luciferase into the solution, prior to adding the substrate.
54. The method of any one of aspects 1 to 52, wherein step (d) of aspect 1 comprises adding a substrate which can penetrate the target cells.
55. The method of any one of aspects 1 to 52, wherein the synthetic luciferase is capable of being secreted from the target cells into the solution.
56. The method of any one of the preceding aspects, wherein step (f) of aspect 1 comprises the step of calculating or quantifying the NAb titre as the dilution of the reference solution at which the signal (RLU) obtained is 50% of the signal (RLU) obtained in the control solution.
57. The method of aspect 56, wherein the NAb titre is calculated or quantified as a single value (discrete titre).
58. The method of aspect 56, wherein the NAb titre is calculated or quantified as a range of values.
59. The method of any one of aspects 56 to 58, wherein the NAb titre is calculated or quantified through a visual comparison between the dilutions of the reference solutions and the control solution(s).
60. The method of any one of aspects 56 to 58 wherein the NAb titre is calculated or quantified using a nonlinear regression model to fit the reference solution data to a curve and obtain a precise half-maximal value at which 50% neutralisation occurs.
61. The method of aspect 60 wherein the non-linear regression model is applied to the luminescent signal (RLU) from each sample dilution.
62. The method of aspect 61 wherein the non-linear regression model is applied to the luminescent signal (RLU) from each sample dilution after normalising with positive (maximal inhibition) and/or negative (0% inhibition) controls.
63. The method of aspect 61 or aspect 62 wherein NAb titre is calculated or quantified by fitting a four-parameter variable-slope model to the luminescent signal from each sample dilution after normalising with both positive (maximal inhibition) and negative (0% inhibition) controls.
64. The method of any one of aspects 60 to 63 wherein the NAb titre is calculated or quantified as the interpolated titre at 50% transduction inhibition (T150).
65. An AAV viral vector which comprises or encapsidates a recombinant vector genome comprising a transgene encoding a luciferase, wherein the luciferase is a synthetic luciferase which provides enhanced luminescence relative to a firefly luciferase.
66. The AAV viral vector of aspect 65 or the method of any one of aspects 1 to 63, wherein the recombinant vector genome is self-complementary.
67. The AAV viral vector of aspect 65 or aspect 66, wherein the synthetic luciferase has enhanced luminescence relative to a firefly luciferase having a sequence according to SEQ ID NO: 1.
68. The AAV viral vector of any one of aspects 65 to 67, wherein enhanced luminescence of the synthetic luciferase is determined by measuring the luminescence signal (RLU) of the synthetic luciferase and its substrate and the luminescence signal (RLU) of the firefly luciferase and its luciferine substrate under the same conditions.
69. The AAV viral vector of any one of aspects 65 to 68, wherein the signal (RLU) of the synthetic luciferase and its substrate is greater by at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 150-fold or more than the signal (RLU) of the firefly and its luciferine substrate.
70. The AAV viral vector of aspect 69, wherein the signal (RLU) of the synthetic luciferase and its substrate is greater by at least 80- to 100-fold or more than the signal (RLU) of the firefly luciferase and its luciferine substrate.
71. The AAV viral vector of any one of aspects 65 to 70, wherein the synthetic bright luciferase is less than 50 kDa, less than 30 kDa, less than 25 kDa or less than 20 kDa.
72. The AAV viral vector of any one of aspects 65 to 71, wherein the synthetic bright luciferase is ATP-independent.
73. The AAV viral vector of any one of aspects 65 to 72, wherein the synthetic bright luciferase comprises: [0249] (a) a sequence according to SEQ ID NO: 2; [0250] (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 2; or [0251] (c) a sequence which varies from SEQ ID NO: 2 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
74. The AAV viral vector of any one of aspects 65 to 72, wherein the synthetic bright luciferase comprises: [0252] (a) a sequence according to SEQ ID NO: 3; [0253] (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 3; or [0254] (c) a sequence which varies from SEQ ID NO: 3 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
75. The AAV viral vector of any one of aspects 65 to 72, wherein the synthetic bright luciferase comprises: [0255] (a) a sequence according to SEQ ID NO: 4; [0256] (b) a sequence having at least 90% or at least 95% identity with SEQ ID NO: 4; or [0257] (c) a sequence which varies from SEQ ID NO: 4 by no more than one, no more than two, no more than three, no more than four or no more than five amino acids.
76. The AAV viral vector of any one of aspects 65 to 75, wherein the viral vector comprises: [0258] (a) a capsid of or deriving from naturally occurring AAV serotypes AAV 3 and/or AAV3B; [0259] (b) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 5; [0260] (c) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 6 (SEQ ID NO: 31 from WO 2013/029030); [0261] (d) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 7 (SEQ ID NO: 46 from WO 2013/029030); [0262] (e) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 8 (SEQ ID NO: 47 from WO 2013/029030); [0263] (f) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 9 (SEQ ID NO: 54 from WO 2013/029030); or [0264] (g) a capsid having at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO: 10 (SEQ ID NO: 56 from WO 2013/029030).
77. A method of determining whether a patient is eligible for gene therapy using a viral vector comprising a capsid of interest, the method comprising determining the NAb titre of the patient to said viral vector using the method of any one of aspects 1 to 64 above and comparing it with a pre-determined threshold value, wherein if the Nab titre is at or below the threshold value, the patient is eligible for gene therapy using the viral vector.
78. A method of monitoring the progress of depletion of immunoglobulin which is specific for a viral vector comprising a capsid of interest, such as plasmapheresis or targeted (e.g. affinity-based) depletion of immunoglobulin, in a patient wherein the method comprises the steps of: [0265] (a) determining the patient NAb titre to a viral vector comprising a capsid of interest within a set interval of time following a round of immunoglobulin depletion by carrying out the method of any one of aspects 1-64 on a sample from the patient; [0266] (b) determining whether the NAb titre following immunoglobulin depletion is below a predetermined threshold value for eligibility of gene therapy; [0267] and optionally [0268] (c) determining, based on the NAb titre following immunoglobulin depletion, whether a further round of immunoglobulin depletion is appropriate.
79. The method of aspect 78, wherein the set interval of time is 24 hours or less, 19 hours or less, 12 hours or less, 9 hours or less or 6 hours or less.
80. The method of aspect 78 or aspect 79, wherein step (c) includes a step of comparing the NAb titre following immunoglobulin depletion with an initial NAb titre to determine whether the immunoglobulin depletion has had any significant effect.
81. The method of any one of aspects 78 to 80, wherein the method additionally comprises: [0269] (d) determining the patient NAb titre to a viral vector comprising a capsid of interest within a set interval of time following a further round of immunoglobulin depletion by carrying out the method of any one of aspects 1 to 64 on a sample from the patient; [0270] (e) determining whether the NAb titre following the further round of immunoglobulin depletion is below a pre-determined threshold value for eligibility of gene therapy; and optionally [0271] (f) determining, based on the NAb titre following immunoglobulin depletion, whether yet a further round of immunoglobulin depletion is appropriate.
82. The method of aspect 81, wherein step (f) includes a further step of comparing the NAb titre following the previous rounds of immunoglobulin depletion with one another, and optionally with an initial NAb titre, in order to determine whether the immunoglobulin depletion has had any significant effect.
83. The method of any one of aspects 78 to 82, wherein the method additionally comprises: [0272] (g) determining the patient NAb titre to a viral vector comprising a capsid of interest within a set interval of time following a further round of immunoglobulin depletion by carrying out the method of the invention on a sample from the patient; [0273] (h) determining whether the NAb titre following said further round of immunoglobulin depletion is below a pre-determined threshold value for eligibility of gene therapy; and optionally [0274] (i) determining whether yet a further round of immunoglobulin depletion is appropriate.
84. The method of any one of aspects 78 to 83, wherein the further round(s) of immunoglobulin depletion of step (c), step (f) and step (i) is/are carried out within 48 hours or less of the previous round of immunoglobulin depletion; optionally wherein the further round of immunoglobulin depletion of step (c), step (f) and step (i) is carried out the day after the previous round of immunoglobulin depletion; and optionally wherein the further round of immunoglobulin depletion is carried out within 24 hours of the previous round of immunoglobulin depletion.
85. The method of any one of aspects 78 to 84, wherein the method comprises: [0275] (a) two rounds of immunoglobulin depletion over the course of two days; [0276] (b) three rounds of immunoglobulin depletion over the course of three days; [0277] (c) four rounds of immunoglobulin depletion over the course of four days; or [0278] (d) five rounds of immunoglobulin depletion over the course of five days.
86. The method of any one of aspects 78 to 85, wherein the immunoglobulin depletion method is plasmapheresis; and optionally wherein the immunoglobulin depletion method is double filtration plasmapheresis (DFPP).
87. The method of any one of aspects 1 to 64, wherein the method is characterised in that the population of target cells is in suspension.
88. The method of any one of aspects 1 to 64 or aspect 87, wherein step (b) of aspect 1 comprises exposing each of the solutions from step (a) of aspect 1 to a population of target cells in suspension, which are susceptible to infection by the viral vector of interest.
89. The method of any one of aspects 1 to 64, 87 or 88, wherein the population of target cells is not plated in advance of the method.
90. The method of any one of aspects 1 to 64 or 87 to 89 wherein the target cells are not immobilised or otherwise adhered to an assay plate.
91. The method of any one of aspects 1 to 64 wherein all steps of the method, including any preparation steps, are completed within 24 hours or less; optionally within 18 hours or less; optionally within 12 hours or less; optionally within 8 hours or less; and optionally in less than 8 hours.
92. A kit comprising the AAV viral vector of any one of aspects 65 to 76, together with a reagent which includes a substrate for a luciferase encoded by the AAV viral vector.
93. The kit of aspect 92, further comprising instructions for carrying out an assay method according to any one of aspects 1 to 64.
94. The kit of aspect 92 or aspect 93, further comprising a container comprising target cells; optionally wherein the target cells comprise mammalian cells.
95. The kit of aspect 94 wherein the target cells comprise HEK-293, HEK-293T, CHO, BHK, MDCK, 10T1/2, WEHI cells, COS, BSC 1, BSC 40, BMT 10, VERO, W138, MRCS, A549, HT1080, 293, B-50, 3T3, NIH3T3, HepG2, Saos-2, Huh7, HER, HEK, HEL, or HeLa cells.
96. The kit of aspect 94, wherein the target cells comprise HEK293 cells or HEK293T cells.
97. The kit of any one of aspects 92 to 96, wherein the kit further comprises insulating means.
98. The kit of any one of aspects 92 to 97, wherein the kit further comprises cooling means.
99. The kit of any one of aspects 94 to 96, wherein the container comprises insulating means.
100. The kit of any one of aspects 94 to 96 or aspect 99, wherein the container comprises cooling means.
101. An AAV viral vector for use in a method of treating a genetic disorder, the method comprising:
(a) performing a method of immunoglobulin depletion on a patient;
(b) monitoring the progress of depletion of immunoglobulin using the method of any one of aspects 78 to 86; and
(c) administering the AAV viral vector once the immunoglobulin is sufficiently depleted, wherein the AAV viral vector comprises a transgene that encodes a polypeptide implicated in the genetic disorder, the AAV viral vector comprises a capsid, and the patient has antibodies to the capsid.
102. The method of any one of aspects 78 to 85, wherein the immunoglobulin depletion method is: [0279] (a) a method of immunodepletion which specifically targets immunoglobulin; [0280] (b) a method of immunodepletion which uses an extracorporeal device which binds IgG; or [0281] (c) a method of immunodepletion which comprises the administration of an agent or enzyme (such as a IgG cysteine protease or IgG endoglycosidases) which digests human IgG, optionally wherein the method comprises administering to the subject an agent or enzyme which reduces Fc receptor binding of serum IgG molecules; optionally wherein the agent or enzyme is an IgG cysteine protease from a Streptococcus bacterium such as Streptococcus pyogenes, or an IgG endoglycosidase from a Streptococcus bacterium, such as Streptococcus pyogenes, Streptococcus equi or Streptococcus zooepidemicus, or from Corynebacterium pseudotuberculosis, Enterococcus faecalis, or Elizabethkingia meningoseptica; and optionally wherein the agent or enzyme comprises a sequence according to SEQ ID NO: 11 or SEQ ID NO: 12, or a fragment or variant thereof which has IgG cysteine protease activity.