CD73 BLOCKADE
20180030144 ยท 2018-02-01
Inventors
- STEPHANIE CHANTEUX (MARSEILLE, FR)
- Carine Paturel (Marcy l'Etoile, FR)
- Ivan Perrot (Cassis, FR)
- Laurent Gauthier (Marseille, FR)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
Abstract
This invention relates to antibodies that bind an epitope present on CD73 expressed at the surface of cells, including tumor cells, and that inhibit the enzymatic (ecto-5 nucleotidase) activity of the CD73 enzyme. Such agents can be used for the treatment of diseases such as cancers.
Claims
1-42. (canceled)
43. An isolated antibody that specifically binds a human CD73 polypeptide at the surface of a cell and that is capable of neutralizing the 5-ectonucleotidase activity thereof, wherein the antibody inhibits the activity of the human CD73 polypeptide without detectably reducing binding between the CD73 polypeptide and a substrate thereof, wherein the antibody is furthermore capable of neutralizing the 5-ectonucleotidase activity of a soluble human CD73 polypeptide.
44. The antibody of claim 43, wherein the antibody binds an epitope present on CD73 in the open conformation when not bound to substrate and in the closed conformation when bound to a substrate.
45. The antibody of claim 43, wherein neutralization of the enzymatic activity of CD73 is determined by assessing neutralization of 5 ectonucleotidase activity in MDA-MB-231 cells by quantifying hydrolysis of AMP to adenosine.
46. The antibody of claim 43, wherein the antibody binds an epitope comprising 1, 2, 3 or 4 of the residues selected from the group consisting of K97, E125, Q153 and K330 (with reference to SEQ ID NO: 1).
47. The antibody of claim 43, wherein said antibody binds an epitope comprising 1, 2, 3, 4 or 5 residues selected from the group consisting of A99, E129, K133, E134, and A135 (with reference to SEQ ID NO: 1).
48. The antibody of claim 43, wherein the antibody specifically hinds a human CD73 polypeptide without causing substantial intracellular internalization of the CD73 polypeptide.
49. The isolated antibody of claim 43, wherein the antibody substantially lacks binding, via an Fc domain, to the human CD16 polypeptide (FcIII receptor).
50. The isolated antibody of claim 43, wherein the antibody binds a CD73 polypeptide dimer in bivalent manner.
51. The isolated antibody of claim 43, wherein the substrate is adenosine 5-(,-methylene)diphosphate (APCP) or AMP.
52. The isolated antibody of claim 43, wherein the antibody is capable of neutralizing the 5-ectonucleotidase activity of a soluble human dimeric CD73 polypeptide when the antibody is provided at a 10-fold of greater molar excess to CD73 polypeptide dimer.
53. The antibody of claim 43, wherein the antibody is capable of causing a decrease in the 5-ectonucleotidase activity of human cellular CD73 polypeptide by more than 50%, more than 70%, of more than 80%.
54. The antibody of claim 43, wherein the antibody is capable of causing a decrease in the 5-ectonucleotidase activity of a human CD73 polypeptide in solution by more than 50%, more than 70%, or more than 80%.
55. The antibody of claim 43, wherein the antibody binds an antigenic determinant within each CD73 polypeptide chain within a CD73 dimer, wherein the antigenic determinants are present on a common face of the CD73 dimer.
56. The antibody of claim 43, wherein the antibody has reduced binding to a mutant CD73 polypeptide comprising a mutation at residue K136 (with reference to SEQ ID NO: 1), relative to binding between the antibody and a wild-type CD73 polypeptide comprising the amino acid sequence of SEQ ID NO: 1.
57. The antibody of claim 43, wherein the antibody has reduced binding to a mutant CD73 polypeptide comprising a mutation at residues K97, E125, Q153 and K330 (with reference to SEQ ID NO: 1), in each case relative to binding between the antibody and a wild-type CD73 polypeptide comprising the amino acid sequence of SEQ ID NO: 1.
58. The antibody of claim 43, wherein the antibody has reduced binding to a mutant CD73 polypeptide comprising a mutation at residues A99, E129, K133, E134, and A135 (with reference to SEQ ID NO: 1), in each case relative to binding between the antibody and a wild-type CD73 polypeptide comprising the amino acid sequence of SEQ ID NO: 1.
59. An isolated antibody that specifically binds a human CD73 polypeptide at the surface of a cell and that is capable of neutralizing the 5-ectonucleotidase activity thereof, wherein the antibody has reduced binding to a mutant CD73 polypeptide comprising a mutation at residue K136 (with reference to SEQ ID NO: 1), relative to binding between the antibody and a wild-type CD73 polypeptide comprising the amino acid sequence of SEQ ID NO: 1.
60. An isolated antibody that specifically binds a human CD73 polypeptide at the surface of a cell and that is capable of neutralizing the 5-ectonucleotidase activity thereof, wherein the antibody has reduced binding to a mutant CD73 polypeptide comprising a mutation at residues K97, E125, Q153 and K330 (with reference to SEQ ID NO: 1), in each case relative to binding between the antibody and a wild-type CD73 polypeptide comprising the amino acid sequence of SEQ ID NO: 1.
61. An isolated antibody that specifically binds a human CD73 polypeptide at the surface of a cell and that is capable of neutralizing the 5-ectonucleotidase activity thereof, wherein the antibody has reduced binding to a mutant CD73 polypeptide comprising a mutation at residues A99, E129, K133, E134, and A135 (with reference to SEQ ID NO: 1), in each case relative to binding between the antibody and a wild-type CD73 polypeptide comprising the amino acid sequence of SEQ ID NO: 1.
62. A pharmaceutical composition comprising an antibody of claim 43, and a pharmaceutically acceptable carrier.
63. A nucleic acid encoding a heavy and/or light chain of an antibody of claim 43.
64. A hybridoma or recombinant host cell producing the antibody of claim 43.
65. A method for the treatment or prevention of cancer in a patient in need thereof, the method comprising administering to said patient an effective amount of an antibody of claim 43.
66. A method for relieving adenosine-mediated inhibition of T cell activity in a subject having a cancer, the method comprising administering to said subject an effective amount of an antibody of claim 43.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0093] As used in the specification, a or an may mean one or more. As used in the claim(s), when used in conjunction with the word comprising, the words a or an may mean one or more than one. As used herein another may mean at least a second or more.
[0094] Where comprising is used, this can optionally be replaced by consisting essentially of or by consisting of.
[0095] Human CD73, also known as ecto-5-nucleotidase and as 5-prime-ribonucleotide phosphohydrolase, EC 3.1.3.5, encoded by the NT5E gene, exhibits 5-nucleotidase, notably AMP-, NAD-, and NMN-nucleosidase, activities. CD73 catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane The amino acid sequence of Human CD73 preprotein (monomer), including a signal sequence at amino acids 1-26, is shown in Genbank under accession number NP_002517, the entire disclosure of which is incorporated herein by reference, and as follows:
TABLE-US-00001 (SEQIDNO:1) MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSR LEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLL LDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLP YKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITAL QPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQA YAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSI KADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDE RNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVH RYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDS GDQDINVVSTYISKMKVIYPAVEGRIKFSTGSHCHGSFSL IFLSLWAVIFVLYQ.
[0096] In the context herein, neutralize the enzymatic activity of CD73, refers to a process in which the 5-nucleotidase (5-ectonucleotidase) activity of CD73 is inhibited. This comprises, notably the inhibition of CD73-mediated generation of adenosine, i.e. the inhibition of CD73-mediated catabolism of AMP to adenosine. This can be measured for example in a cell-free assay that measures the capacity of a test compound to inhibit the conversion of AMP to adenosine, either directly or indirectly. In one embodiment, an antibody preparation causes at least a 50% decrease in the conversion of AMP to adenosine, at least a 70% decrease in the conversion of AMP to adenosine, or at least a 80% decrease in the conversion of AMP to adenosine, referring, for example, to the assays described herein.
[0097] Whenever within this whole specification treatment of cancer or the like is mentioned with reference to anti-CD73 binding agent (e.g. antibody), there is meant: (a) method of treatment of cancer, said method comprising the step of administering (for at least one treatment) an anti-CD73 binding agent, (preferably in a pharmaceutically acceptable carrier material) to an individual, a mammal, especially a human, in need of such treatment, in a dose that allows for the treatment of cancer, (a therapeutically effective amount), preferably in a dose (amount) as specified herein; (b) the use of an anti-CD73 binding agent for the treatment of cancer, or an anti-CD73 binding agent, for use in said treatment (especially in a human); (c) the use of an anti-CD73 binding agent for the manufacture of a pharmaceutical preparation for the treatment of cancer, a method of using an anti-CD73 binding agent for the manufacture of a pharmaceutical preparation for the treatment of cancer, comprising admixing an anti-CD73 binding agent with a pharmaceutically acceptable carrier, or a pharmaceutical preparation comprising an effective dose of an anti-CD73 binding agent that is appropriate for the treatment of cancer; or (d) any combination of a), b), and c), in accordance with the subject matter allowable for patenting in a country where this application is filed.
[0098] The term antibody, as used herein, refers to polyclonal and monoclonal antibodies. Depending on the type of constant domain in the heavy chains, antibodies are assigned to one of five major classes: IgA, IgD, IgE, IgG, and IgM. Several of these are further divided into subclasses or isotypes, such as IgG1, IgG2, IgG3, IgG4, and the like. An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one light (about 25 kDa) and one heavy chain (about 50-70 kDa). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids that is primarily responsible for antigen recognition. The terms variable light chain (V.sub.L) and variable heavy chain (V.sub.H) refer to these light and heavy chains respectively. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are termed alpha, delta, epsilon, gamma and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known. IgG are the exemplary classes of antibodies employed herein because they are the most common antibodies in the physiological situation and because they are most easily made in a laboratory setting. Optionally the antibody is a monoclonal antibody. Particular examples of antibodies are humanized, chimeric, human, or otherwise-human-suitable antibodies. Antibodies also includes any fragment or derivative of any of the herein described antibodies.
[0099] The term specifically binds to means that an antibody can bind preferably in a competitive binding assay to the binding partner, e.g. CD73, as assessed using either recombinant forms of the proteins, epitopes therein, or native proteins present on the surface of isolated target cells. Competitive binding assays and other methods for determining specific binding are further described below and are well known in the art.
[0100] When an antibody is said to compete with a particular monoclonal antibody, it means that the antibody competes with the monoclonal antibody in a binding assay using either recombinant CD73 molecules or surface expressed CD73 molecules. For example, if a test antibody reduces the binding of a reference antibody to a CD73 polypeptide or CD73-expressing cell in a binding assay, the antibody is said to compete respectively with the reference antibody.
[0101] The term affinity, as used herein, means the strength of the binding of an antibody to an epitope. The affinity of an antibody is given by the dissociation constant Kd, defined as [Ab][Ag]/[Ab-Ag], where [Ab-Ag] is the molar concentration of the antibody-antigen complex, [Ab] is the molar concentration of the unbound antibody and [Ag] is the molar concentration of the unbound antigen. The affinity constant K.sub.a is defined by 1/Kd. Methods for determining the affinity of mAbs can be found in Harlow, et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993), and Muller, Meth. Enzymol. 92:589-601 (1983), which references are entirely incorporated herein by reference. One standard method well known in the art for determining the affinity of mAbs is the use of surface plasmon resonance (SPR) screening (such as by analysis with a BIAcore SPR analytical device).
[0102] Within the context herein a determinant designates a site of interaction or binding on a polypeptide.
[0103] The term epitope refers to an antigenic determinant, and is the area or region on an antigen to which an antibody binds. A protein epitope may comprise amino acid residues directly involved in the binding as well as amino acid residues which are effectively blocked by the specific antigen binding antibody or peptide, i.e., amino acid residues within the footprint of the antibody. It is the simplest form or smallest structural area on a complex antigen molecule that can combine with e.g., an antibody or a receptor. Epitopes can be linear or conformational/structural. The term linear epitope is defined as an epitope composed of amino acid residues that are contiguous on the linear sequence of amino acids (primary structure). The term conformational or structural epitope is defined as an epitope composed of amino acid residues that are not all contiguous and thus represent separated parts of the linear sequence of amino acids that are brought into proximity to one another by folding of the molecule (secondary, tertiary and/or quaternary structures). A conformational epitope is dependent on the 3-dimensional structure. The term conformational is therefore often used interchangeably with structural.
[0104] The term deplete or depleting, with respect to CD73-expressing cells, means a process, method, or compound that results in killing, elimination, lysis or induction of such killing, elimination or lysis, so as to negatively affect the number of such CD73-expressing cells present in a sample or in a subject.
[0105] The term internalization, used interchangeably with intracellular internalization, refers to the molecular, biochemical and cellular events associated with the process of translocating a molecule from the extracellular surface of a cell to the intracellular surface of a cell. The processes responsible for intracellular internalization of molecules are well-known and can involve, inter alia, the internalization of extracellular molecules (such as hormones, antibodies, and small organic molecules); membrane-associated molecules (such as cell-surface receptors); and complexes of membrane-associated molecules bound to extracellular molecules (for example, a ligand bound to a transmembrane receptor or an antibody bound to a membrane-associated molecule). Thus, inducing and/or increasing internalization comprises events wherein intracellular internalization is initiated and/or the rate and/or extent of intracellular internalization is increased.
[0106] The term agent is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials. The term therapeutic agent refers to an agent that has biological activity.
[0107] For the purposes herein, a humanized or human antibody refers to an antibody in which the constant and variable framework region of one or more human immunoglobulins is fused with the binding region, e.g. the CDR, of an animal immunoglobulin. Such antibodies are designed to maintain the binding specificity of the non-human antibody from which the binding regions are derived, but to avoid an immune reaction against the non-human antibody. Such antibodies can be obtained from transgenic mice or other animals that have been engineered to produce specific human antibodies in response to antigenic challenge (see, e.g., Green et al. (1994) Nature Genet 7:13; Lonberg et al. (1994) Nature 368:856; Taylor et al. (1994) Int Immun 6:579, the entire teachings of which are herein incorporated by reference). A fully human antibody also can be constructed by genetic or chromosomal transfection methods, as well as phage display technology, all of which are known in the art (see, e.g., McCafferty et al. (1990) Nature 348:552-553). Human antibodies may also be generated by in vitro activated B cells (see, e.g., U.S. Pat. Nos. 5,567,610 and 5,229,275, which are incorporated in their entirety by reference).
[0108] A chimeric antibody is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
[0109] The term hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding. The hypervariable region generally comprises amino acid residues from a complementarity-determining region or CDR (e.g. residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light-chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy-chain variable domain; Kabat et al. 1991) and/or those residues from a hypervariable loop (e.g. residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light-chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy-chain variable domain; Chothia and Lesk, J. Mol. Biol 1987; 196:901-917), or a similar system for determining essential amino acids responsible for antigen binding. Typically, the numbering of amino acid residues in this region is performed by the method described in Kabat et al., supra. Phrases such as Kabat position, variable domain residue numbering as in Kabat and according to Kabat herein refer to this numbering system for heavy chain variable domains or light chain variable domains. Using the Kabat numbering system, the actual linear amino acid sequence of a peptide may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain. For example, a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of CDR H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a standard Kabat numbered sequence.
[0110] By framework or FR residues as used herein is meant the region of an antibody variable domain exclusive of those regions defined as CDRs. Each antibody variable domain framework can be further subdivided into the contiguous regions separated by the CDRs (FR1, FR2, FR3 and FR4).
[0111] The terms Fc domain, Fc portion, and Fc region refer to a C-terminal fragment of an antibody heavy chain, e.g., from about amino acid (aa) 230 to about aa 450 of human (gamma) heavy chain or its counterpart sequence in other types of antibody heavy chains (e.g., , , and for human antibodies), or a naturally occurring allotype thereof. Unless otherwise specified, the commonly accepted Kabat amino acid numbering for immunoglobulins is used throughout this disclosure (see Kabat et al. (1991) Sequences of Protein of Immunological Interest, 5th ed., United States Public Health Service, National Institute of Health, Bethesda, Md.).
[0112] The terms isolated, purified or biologically pure refer to material that is substantially or essentially free from components which normally accompany it as found in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified.
[0113] The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
[0114] The term recombinant when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (nonrecombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
[0115] Within the context herein, the term antibody that binds a polypeptide or epitope designates an antibody that binds said determinant with specificity and/or affinity.
[0116] The term identity or identical, when used in a relationship between the sequences of two or more polypeptides, refers to the degree of sequence relatedness between polypeptides, as determined by the number of matches between strings of two or more amino acid residues. Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., algorithms). Identity of related polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math. 48, 1073 (1988).
[0117] Methods for determining identity are designed to give the largest match between the sequences tested. Methods of determining identity are described in publicly available computer programs. Computer program methods for determining identity between two sequences include the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res. 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis.), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol. 215, 403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, Md. 20894; Altschul et al., supra). The well-known Smith Waterman algorithm may also be used to determine identity.
Production of Antibodies
[0118] The anti-CD73 agent that can be used for the treatment of cancers binds an extracellular portion of human CD73 polypeptide and neutralizes the enzymatic activity of CD73 expressed on the surface of a cell, e.g. a tumor cell. In one embodiment the agent inhibits the 5-ectonucleotidase activity of CD73. In one embodiment the antibody inhibits CD73-mediated generation of adenosine. In one embodiment the antibody inhibits CD73-mediated catabolism of AMP to adenosine. In one embodiment the antibody inhibits adenosine-mediated inhibition of lymphocyte activity (e.g. T cells). In one embodiment the antibody binds and/or inhibits the enzymatic active site on CD73. In one aspect, the agent is an antibody selected from a full-length antibody, an antibody fragment, and a synthetic or semisynthetic antibody-derived molecule.
[0119] In one aspect, the agent is an antibody selected from a fully human antibody, a humanized antibody, and a chimeric antibody.
[0120] In one aspect, the agent is a fragment of an antibody comprising a constant domain selected from IgG1, IgG2, IgG3 and IgG4.
[0121] In one aspect, the agent is an antibody fragment selected from a Fab fragment, a Fab fragment, a Fab-SH fragment, a F(ab)2 fragment, a F(ab)2 fragment, an Fv fragment, a Heavy chain Ig (a llama or camel Ig), a V.sub.HH fragment, a single domain FV, and a single-chain antibody fragment.
[0122] In one aspect, the agent is a synthetic or semisynthetic antibody-derived molecule selected from a scFV, a dsFV, a minibody, a diabody, a triabody, a kappa body, an IgNAR;
[0123] and a multispecific antibody.
[0124] The present disclosure thus concerns antibodies or other antigen-binding agents binding to CD73.
[0125] In one aspect, the antibody is in at least partially purified form.
[0126] In one aspect, the antibody is in essentially isolated form.
[0127] The antibodies may be produced by a variety of techniques known in the art. Typically, they are produced by immunization of a non-human animal, preferably a mouse, with an immunogen comprising a CD73 polypeptide, preferably a human CD73 polypeptide. The CD73 polypeptide may comprise the full length sequence of a human CD73 polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, i.e., a portion of the polypeptide comprising an epitope exposed on the surface of cells expressing a CD73 polypeptide. Such fragments typically contain at least about 7 consecutive amino acids of the mature polypeptide sequence, even more preferably at least about 10 consecutive amino acids thereof. Fragments typically are essentially derived from the extracellular domain of the receptor. In one embodiment, the immunogen comprises a wild-type human CD73 polypeptide in a lipid membrane, typically at the surface of a cell. In a specific embodiment, the immunogen comprises intact cells, particularly intact human cells, optionally treated or lysed. In another embodiment, the polypeptide is a recombinant CD73 polypeptide.
[0128] The step of immunizing a non-human mammal with an antigen may be carried out in any manner well known in the art for stimulating the production of antibodies in a mouse (see, for example, E. Harlow and D. Lane, Antibodies: A Laboratory Manual., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1988), the entire disclosure of which is herein incorporated by reference). The immunogen is suspended or dissolved in a buffer, optionally with an adjuvant, such as complete or incomplete Freund's adjuvant. Methods for determining the amount of immunogen, types of buffers and amounts of adjuvant are well known to those of skill in the art and are not limiting in any way. These parameters may be different for different immunogens, but are easily elucidated.
[0129] Similarly, the location and frequency of immunization sufficient to stimulate the production of antibodies is also well known in the art. In a typical immunization protocol, the non-human animals are injected intraperitoneally with antigen on day 1 and again about a week later. This is followed by recall injections of the antigen around day 20, optionally with an adjuvant such as incomplete Freund's adjuvant. The recall injections are performed intravenously and may be repeated for several consecutive days. This is followed by a booster injection at day 40, either intravenously or intraperitoneally, typically without adjuvant. This protocol results in the production of antigen-specific antibody-producing B cells after about 40 days. Other protocols may also be used as long as they result in the production of B cells expressing an antibody directed to the antigen used in immunization.
[0130] For polyclonal antibody preparation, serum is obtained from an immunized non-human animal and the antibodies present therein isolated by well-known techniques. The serum may be affinity purified using any of the immunogens set forth above linked to a solid support so as to obtain antibodies that react with CD73 polypeptides.
[0131] In an alternate embodiment, lymphocytes from a non-immunized non-human mammal are isolated, grown in vitro, and then exposed to the immunogen in cell culture. The lymphocytes are then harvested and the fusion step described below is carried out.
[0132] For monoclonal antibodies, the next step is the isolation of splenocytes from the immunized non-human mammal and the subsequent fusion of those splenocytes with an immortalized cell in order to form an antibody-producing hybridoma. The isolation of splenocytes from a non-human mammal is well-known in the art and typically involves removing the spleen from an anesthetized non-human mammal, cutting it into small pieces and squeezing the splenocytes from the splenic capsule through a nylon mesh of a cell strainer into an appropriate buffer so as to produce a single cell suspension. The cells are washed, centrifuged and resuspended in a buffer that lyses any red blood cells. The solution is again centrifuged and remaining lymphocytes in the pellet are finally resuspended in fresh buffer.
[0133] Once isolated and present in single cell suspension, the lymphocytes can be fused to an immortal cell line. This is typically a mouse myeloma cell line, although many other immortal cell lines useful for creating hybridomas are known in the art. Murine myeloma lines include, but are not limited to, those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, U.S.A, X63 Ag8653 and SP-2 cells available from the American Type Culture Collection, Rockville, Md. U.S.A. The fusion is effected using polyethylene glycol or the like. The resulting hybridomas are then grown in selective media that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
[0134] Hybridomas are typically grown on a feeder layer of macrophages. The macrophages are preferably from littermates of the non-human mammal used to isolate splenocytes and are typically primed with incomplete Freund's adjuvant or the like several days before plating the hybridomas. Fusion methods are described in Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986), the disclosure of which is herein incorporated by reference.
[0135] The cells are allowed to grow in the selection media for sufficient time for colony formation and antibody production. This is usually between about 7 and about 14 days.
[0136] The hybridoma colonies are then assayed for the production of antibodies that specifically bind to CD73 polypeptide gene products. The assay is typically a colorimetric ELISA-type assay, although any assay may be employed that can be adapted to the wells that the hybridomas are grown in. Other assays include radioimmunoassays or fluorescence activated cell sorting. The wells positive for the desired antibody production are examined to determine if one or more distinct colonies are present. If more than one colony is present, the cells may be re-cloned and grown to ensure that only a single cell has given rise to the colony producing the desired antibody. Typically, the antibodies will also be tested for the ability to bind to CD73 polypeptides, e.g., CD73-expressing cells.
[0137] Hybridomas that are confirmed to produce a monoclonal antibody can be grown up in larger amounts in an appropriate medium, such as DMEM or RPMI-1640. Alternatively, the hybridoma cells can be grown in vivo as ascites tumors in an animal.
[0138] After sufficient growth to produce the desired monoclonal antibody, the growth media containing monoclonal antibody (or the ascites fluid) is separated away from the cells and the monoclonal antibody present therein is purified. Purification is typically achieved by gel electrophoresis, dialysis, chromatography using protein A or protein G-Sepharose, or an anti-mouse Ig linked to a solid support such as agarose or Sepharose beads (all described, for example, in the Antibody Purification Handbook, Biosciences, publication No. 18-1037-46, Edition AC, the disclosure of which is hereby incorporated by reference). The bound antibody is typically eluted from protein A/protein G columns by using low pH buffers (glycine or acetate buffers of pH 3.0 or less) with immediate neutralization of antibody-containing fractions. These fractions are pooled, dialyzed, and concentrated as needed.
[0139] Positive wells with a single apparent colony are typically re-cloned and re-assayed to insure only one monoclonal antibody is being detected and produced.
[0140] Antibodies may also be produced by selection of combinatorial libraries of immunoglobulins, as disclosed for instance in (Ward et al. Nature, 341 (1989) p. 544, the entire disclosure of which is herein incorporated by reference).
[0141] The identification of one or more antibodies that bind(s) to CD73, particularly substantially or essentially the same epitope as monoclonal antibody 11E1, 8C7 or 6E1, can be readily determined using any one of a variety of immunological screening assays in which antibody competition can be assessed. Many such assays are routinely practiced and are well known in the art (see, e.g., U.S. Pat. No. 5,660,827, issued Aug. 26, 1997, which is specifically incorporated herein by reference). It will be understood that actually determining the epitope to which an antibody described herein binds is not in any way required to identify an antibody that binds to the same or substantially the same epitope as the monoclonal antibody described herein.
[0142] The antibody may be an antibody other than any of antibodies 11E1, 8C7, 3C12 or 6E1, e.g. an antibody comprising heavy and/or light chain variable region amino acid sequences and/or CDRs that differ from those of any one or more of antibodies 11E1, 8C7, 3C12 or 6E1.
[0143] For example, where the test antibodies to be examined are obtained from different source animals, or are even of a different Ig isotype, a simple competition assay may be employed in which the control (11E1, 8C7 or 6E1, for example) and test antibodies are admixed (or pre-adsorbed) and applied to a sample containing CD73 polypeptides. Protocols based upon western blotting and the use of BIACORE analysis are suitable for use in such competition studies.
[0144] In certain embodiments, one pre-mixes the control antibodies (11E1, 8C7, 3C12 or 6E1, for example) with varying amounts of the test antibodies (e.g., about 1:10 or about 1:100) for a period of time prior to applying to the CD73 antigen sample. In other embodiments, the control and varying amounts of test antibodies can simply be admixed during exposure to the CD73 antigen sample. As long as one can distinguish bound from free antibodies (e.g., by using separation or washing techniques to eliminate unbound antibodies) and 11E1, 8C7, 3C12 or 6E1 from the test antibodies (e.g., by using species-specific or isotype-specific secondary antibodies or by specifically labeling 11E1, 8C7, 3C12 or 6E1 with a detectable label) one can determine if the test antibodies reduce the binding of 11E1, 8C7, 3C12 or 6E1 to the antigens, indicating that the test antibody recognizes substantially the same epitope as 11E1, 8C7, 3C12 or 6E1. The binding of the (labelled) control antibodies in the absence of a completely irrelevant antibody can serve as the control high value. The control low value can be obtained by incubating the labelled (11E1, 8C7, 3C12 or 6E1) antibodies with unlabelled antibodies of exactly the same type (11E1, 8C7, 3C12 or 6E1), where competition would occur and reduce binding of the labelled antibodies. In a test assay, a significant reduction in labelled antibody reactivity in the presence of a test antibody is indicative of a test antibody that recognizes substantially the same epitope, i.e., one that cross-reacts or competes with the labelled (11E1, 8C7, 3C12 or 6E1) antibody. Any test antibody that reduces the binding of 11E1, 8C7, 3C12 or 6E1 to CD73 antigens by at least about 50%, such as at least about 60%, or more preferably at least about 80% or 90% (e.g., about 65-100%), at any ratio of 11E1, 8C7, 3C12 or 6E1:test antibody between about 1:10 and about 1:100 is considered to be an antibody that binds to substantially the same epitope or determinant as 11E1, 8C7, 3C12 or 6E1. Preferably, such test antibody will reduce the binding of 11E1, 8C7, 3C12 or 6E1 to the CD73 antigen by at least about 90% (e.g., about 95%).
[0145] Competition can also be assessed by, for example, a flow cytometry test. In such a test, cells bearing a given CD73 polypeptide can be incubated first with 11E1, 8C7, 3C12 or 6E1, for example, and then with the test antibody labelled with a fluorochrome or biotin. The antibody is said to compete with 11E1, 8C7, 3C12 or 6E1 if the binding obtained upon preincubation with a saturating amount of 11E1, 8C7, 3C12 or 6E1 is about 80%, preferably about 50%, about 40% or less (e.g., about 30%, 20% or 10%) of the binding (as measured by mean of fluorescence) obtained by the antibody without preincubation with 11E1, 8C7, 3C12 or 6E1. Alternatively, an antibody is said to compete with 11E1, 8C7, 3C12 or 6E1 if the binding obtained with a labelled 11E1, 8C7, 3C12 or 6E1 antibody (by a fluorochrome or biotin) on cells preincubated with a saturating amount of test antibody is about 80%, preferably about 50%, about 40%, or less (e.g., about 30%, 20% or 10%) of the binding obtained without preincubation with the test antibody.
[0146] A simple competition assay in which a test antibody is pre-adsorbed and applied at saturating concentration to a surface onto which a CD73 antigen is immobilized may also be employed. The surface in the simple competition assay is preferably a BIACORE chip (or other media suitable for surface plasmon resonance analysis). The control antibody (e.g., 11E1, 8C7, 3C12 or 6E1) is then brought into contact with the surface at a CD73-saturating concentration and the CD73 and surface binding of the control antibody is measured. This binding of the control antibody is compared with the binding of the control antibody to the CD73-containing surface in the absence of test antibody. In a test assay, a significant reduction in binding of the CD73-containing surface by the control antibody in the presence of a test antibody indicates that the test antibody recognizes substantially the same epitope as the control antibody such that the test antibody cross-reacts with the control antibody. Any test antibody that reduces the binding of control (such as 11E1, 8C7, 3C12 or 6E1) antibody to a CD73 antigen by at least about 30% or more, preferably about 40%, can be considered to be an antibody that binds to substantially the same epitope or determinant as a control (e.g., 11E1, 8C7, 3C12 or 6E1). Preferably, such a test antibody will reduce the binding of the control antibody (e.g., 11E1, 8C7, 3C12 or 6E1) to the CD73 antigen by at least about 50% (e.g., at least about 60%, at least about 70%, or more). It will be appreciated that the order of control and test antibodies can be reversed: that is, the control antibody can be first bound to the surface and the test antibody is brought into contact with the surface thereafter in a competition assay. Preferably, the antibody having higher affinity for the CD73 antigen is bound to the surface first, as it will be expected that the decrease in binding seen for the second antibody (assuming the antibodies are cross-reacting) will be of greater magnitude. Further examples of such assays are provided in, e.g., Saunal (1995) J. Immunol. Methods 183: 33-41, the disclosure of which is incorporated herein by reference.
[0147] The antibodies will bind to CD73-expressing cells from an individual or individuals with a disease characterized by expression of CD73-positive cells, i.e. an individual that is a candidate for treatment with one of the herein-described methods using an anti-CD73 antibody. Accordingly, once an antibody that specifically recognizes CD73 on cells is obtained, it can optionally be tested for its ability to bind to CD73-positive cells (e.g. cancer cells). In particular, prior to treating a patient with one of the present antibodies, one may optionally test the ability of the antibody to bind malignant cells taken from the patient, e.g. in a blood sample or tumor biopsy, to maximize the likelihood that the therapy will be beneficial in the patient.
[0148] In one embodiment, the antibodies are validated in an immunoassay to test their ability to bind to CD73-expressing cells, e.g. malignant cells. For example, a blood sample or tumor biopsy is performed and tumor cells are collected. The ability of a given antibody to bind to the cells is then assessed using standard methods well known to those in the art. Antibodies may bind for example to a substantial proportion (e.g., 20%, 30%, 40%, 50%, 60%, 70%, 80% or more) of cells known to express CD73, e.g. tumor cells, from a significant percentage of individuals or patients (e.g., 10%, 20%, 30%, 40%, 50% or more). Antibodies can be used for diagnostic purposes to determine the presence or level of malignant cells in a patient, for example as a biomarker to assess whether a patient is suitable for treatment with an anti-CD73 agent, or for use in the herein-described therapeutic methods. To assess the binding of the antibodies to the cells, the antibodies can either be directly or indirectly labelled. When indirectly labelled, a secondary, labelled antibody is typically added.
[0149] Determination of whether an antibody binds within an epitope region can be carried out in ways known to the person skilled in the art. As one example of such mapping/characterization methods, an epitope region for an anti-CD73 antibody may be determined by epitope foot-printing using chemical modification of the exposed amines/carboxyls in the CD73 protein. One specific example of such a foot-printing technique is the use of HXMS (hydrogen-deuterium exchange detected by mass spectrometry) wherein a hydrogen/deuterium exchange of receptor and ligand protein amide protons, binding, and back exchange occurs, wherein the backbone amide groups participating in protein binding are protected from back exchange and therefore will remain deuterated. Relevant regions can be identified at this point by peptic proteolysis, fast microbore high-performance liquid chromatography separation, and/or electrospray ionization mass spectrometry. See, e.g., Ehring H, Analytical Biochemistry, Vol. 267 (2) pp. 252-259 (1999) Engen, J. R. and Smith, D. L. (2001) Anal. Chem. 73, 256A-265A. Another example of a suitable epitope identification technique is nuclear magnetic resonance epitope mapping (NMR), where typically the position of the signals in two-dimensional NMR spectra of the free antigen and the antigen complexed with the antigen binding peptide, such as an antibody, are compared. The antigen typically is selectively isotopically labeled with 15N so that only signals corresponding to the antigen and no signals from the antigen binding peptide are seen in the NMR-spectrum. Antigen signals originating from amino acids involved in the interaction with the antigen binding peptide typically will shift position in the spectrum of the complex compared to the spectrum of the free antigen, and the amino acids involved in the binding can be identified that way. See, e.g., Ernst Schering Res Found Workshop. 2004; (44): 149-67; Huang et al., Journal of Molecular Biology, Vol. 281 (1) pp. 61-67 (1998); and Saito and Patterson, Methods. 1996 June; 9 (3): 516-24.
[0150] Epitope mapping/characterization also can be performed using mass spectrometry methods. See, e.g., Downard, J Mass Spectrom. 2000 April; 35 (4): 493-503 and Kiselar and Downard, Anal Chem. 1999 May 1; 71 (9): 1792-1801. Protease digestion techniques also can be useful in the context of epitope mapping and identification. Antigenic determinant-relevant regions/sequences can be determined by protease digestion, e.g. by using trypsin in a ratio of about 1:50 to CD73 or o/n digestion at and pH 7-8, followed by mass spectrometry (MS) analysis for peptide identification. The peptides protected from trypsin cleavage by the anti-CD73 binder can subsequently be identified by comparison of samples subjected to trypsin digestion and samples incubated with antibody and then subjected to digestion by e.g. trypsin (thereby revealing a footprint for the binder). Other enzymes like chymotrypsin, pepsin, etc., also or alternatively can be used in similar epitope characterization methods. Moreover, enzymatic digestion can provide a quick method for analyzing whether a potential antigenic determinant sequence is within a region of the CD73 polypeptide that is not surface exposed and, accordingly, most likely not relevant in terms of immunogenicity/antigenicity.
[0151] Site-directed mutagenesis is another technique useful for elucidation of a binding epitope. For example, in alanine-scanning, each residue within a protein segment is replaced with an alanine residue, and the consequences for binding affinity measured. If the mutation leads to a significant reduction in binding affinity, it is most likely involved in binding. Monoclonal antibodies specific for structural epitopes (i.e., antibodies which do not bind the unfolded protein) can be used to verify that the alanine-replacement does not influence over-all fold of the protein. See, e.g., Clackson and Wells, Science 1995; 267:383-386; and Wells, Proc Natl Acad Sci USA 1996; 93:1-6.
[0152] Electron microscopy can also be used for epitope foot-printing. For example, Wang et al., Nature 1992; 355:275-278 used coordinated application of cryoelectron microscopy, three-dimensional image reconstruction, and X-ray crystallography to determine the physical footprint of a Fab-fragment on the capsid surface of native cowpea mosaic virus.
[0153] Other forms of label-free assay for epitope evaluation include surface plasmon resonance (SPR, BIACORE) and reflectometric interference spectroscopy (RifS). See, e.g., Fgerstam et al., Journal Of Molecular Recognition 1990; 3:208-14; Nice et al., J. Chroma-togr. 1993; 646:159-168; Leipert et al., Angew. Chem. Int. Ed. 1998; 37:3308-3311; Kroger et al., Biosensors and Bioelectronics 2002; 17:937-944.
[0154] It should also be noted that an antibody binding the same or substantially the same epitope as an antibody can be identified in one or more of the exemplary competition assays described herein.
[0155] Upon immunization and production of antibodies in a vertebrate or cell, particular selection steps may be performed to isolate antibodies as claimed. In this regard, in a specific embodiment, the disclosure also relates to methods of producing such antibodies, comprising: (a) immunizing a non-human mammal with an immunogen comprising a CD73 polypeptide; and (b) preparing antibodies from said immunized animal; and (c) selecting antibodies from step (b) that are capable of binding CD73.
[0156] Typically, an anti-CD73 antibody provided herein has an affinity for a CD73 polypeptide (e.g. as a CD73 homodimer) in the range of about 10.sup.4 to about 10.sup.11 M.sup.1 (e.g., about 10.sup.8 to about 10.sup.10 M.sup.1). For example, in a particular aspect the disclosure provides Anti-CD73 antibody that have an average disassociation constant (K.sub.D) of less than 110.sup.9 M with respect to CD73, as determined by, e.g., surface plasmon resonance (SPR) screening (such as by analysis with a BIAcore SPR analytical device). In a more particular exemplary aspect, the disclosure provides anti-CD73 antibodies that have a KD of about 110.sup.8 M to about 110.sup.19 M, or about 110.sup.9 M to about 110.sup.11 M, for CD73.
[0157] Antibodies can be characterized for example by a mean KD of no more than about (i.e. better affinity than) 100, 60, 10, 5, or 1 nanomolar, preferably sub-nanomolar or optionally no more than about 500, 200, 100 or 10 picomolar. KD can be determined for example for example by immobilizing recombinantly produced human CD73 proteins on a chip surface, followed by application of the antibody to be tested in solution. In one embodiment, the method further comprises a step (d), selecting antibodies from (b) that are capable of competing for binding to CD73 with antibody 11E1, 807, 3012 or 6E1.
[0158] In one aspect of any of the embodiments, the antibodies prepared according to the present methods are monoclonal antibodies. In another aspect, the non-human animal used to produce antibodies according to the methods herein is a mammal, such as a rodent, bovine, porcine, fowl, horse, rabbit, goat, or sheep.
[0159] DNA encoding an antibody that binds an epitope present on CD73 polypeptides is isolated from a hybridoma and placed in an appropriate expression vector for transfection into an appropriate host. The host is then used for the recombinant production of the antibody, or variants thereof, such as a humanized version of that monoclonal antibody, active fragments of the antibody, chimeric antibodies comprising the antigen recognition portion of the antibody, or versions comprising a detectable moiety.
[0160] DNA encoding the monoclonal antibodies of the disclosure, e.g., antibody 11E1, 8C7, 3C12 or 6E1, can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). In one aspect, provided is a nucleic acid encoding a heavy chain or a light chain of an anti-CD73 antibody of any embodiment herein. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. As described elsewhere in the present specification, such DNA sequences can be modified for any of a large number of purposes, e.g., for humanizing antibodies, producing fragments or derivatives, or for modifying the sequence of the antibody, e.g., in the antigen binding site in order to optimize the binding specificity of the antibody. In one embodiment, provided is an isolated nucleic acid sequence encoding a light chain and/or a heavy chain of an antibody (e.g. 11E1, 8C7, 3C12 or 6E1), as well as a recombinant host cell comprising (e.g. in its genome) such nucleic acid. Recombinant expression in bacteria of DNA encoding the antibody is well known in the art (see, for example, Skerra et al., Curr. Opinion in Immunol., 5, pp. 256 (1993); and Pluckthun, Immunol. 130, p. 151 (1992).
[0161] Optionally, antibodies of the disclosure can be specified to be antibodies other than any one or more of antibodies 7G2 (Life Technologies Corp.), antibody 4G4 (Abcam, product ref. ab81720), antibody AD2 (Biolegend Corp, product ref. 344004), antibody 1E9 (Santa Cruz Biotechnology Corp., product sc-32299), 067-213 antibody described in US 2014/0235833, the anti-CD73 antibody referenced in Sachsenmeier et al. ((2012) J. Biomed. Screening 17:993-998 and/or in Rust et al. (2013) Mol. Cancer 12:11, or antibody MED19447 (Medimmune Corp, Gaithersburg Md.) referenced in Huang et al. (2015) AACR Annual meeting; Abstract 1538, or derivatives of the foregoing, e.g. that comprise the antigen binding region or heavy and/or light chain CDRs, in whole or in part. In other embodiments, the above-mentioned antibodies may, depending on the nature of the antibody, be modified so as to have the characteristics of the antibodies of the present disclosure.
[0162] Once antibodies are identified that are capable of binding CD73 and/or having other desired properties, they will also typically be assessed, using standard methods including those described herein, for their ability to bind to other polypeptides, including unrelated polypeptides. Ideally, the antibodies only bind with substantial affinity to CD73, and do not bind at a significant level to unrelated polypeptides, or other polypeptides of the 5-nucleotidase family. However, it will be appreciated that, as long as the affinity for CD73 is substantially greater (e.g., 10, 100, 500, 1000, 10,000, or more) than it is for other, unrelated polypeptides), then the antibodies are suitable for use in the present methods.
[0163] In one embodiment, the anti-CD73 antibodies can be prepared such that they do not have substantial specific binding to human Fc receptors, e.g., any one or more of CD16A, CD16B, CD32A, CD32B and/or CD64). Such antibodies may comprise constant regions of various heavy chains that are known not to bind Fc receptors. One such example is a wild type human IgG4 constant region (IgG4 have minimal Fc receptor binding). A human IgG4 constant region can further comprise a stabilizing S228P (S241P) substitution) to retain bivalent binding ability in vivo by preventing Fab arm exchange. Alternatively, antibody fragments that do not comprise (or comprise portions of) constant regions, such as F(ab)2 fragments, can be used to avoid Fc receptor binding. Fc receptor binding can be assessed according to methods known in the art, including for example testing binding of an antibody to Fc receptor protein in a BIACORE assay. Also, generally any antibody IgG isotype can be used in which the Fc portion is modified (e.g., by introducing 1, 2, 3, 4, 5 or more amino acid substitutions) to minimize or eliminate binding to Fc receptors (see, e.g., WO 03/101485, the disclosure of which is herein incorporated by reference). Assays such as cell based assays, to assess Fc receptor binding are well known in the art, and are described in, e.g., WO 03/101485.
[0164] In one embodiment, the antibody can comprise one or more specific mutations in the Fc region that result in Fc silent antibodies that have minimal interaction with effector cells. Silenced effector functions can be obtained by mutation in the Fc region of the antibodies and have been described in the art: N297A mutation, the LALA mutations, (Strohl, W., 2009, Curr. Opin. Biotechnol. vol. 20(6):685-691); and D265A (Baudino et al., 2008, J. Immunol. 181: 6664-69) see also Heusser et al., WO2012/065950, the disclosures of which are incorporated herein by reference. In one embodiment, an antibody comprises one, two, three or more amino acid substitutions in the hinge region. In one embodiment, the antibody is an IgG1 or IgG2 and comprises one, two or three substitutions at residues 233-236, optionally 233-238 (EU numbering). In one embodiment, the antibody is an IgG4 and comprises one, two or three substitutions at residues 327, 330 and/or 331 (EU numbering). Examples of silent Fc IgG1 antibodies are the LALA mutant comprising L234A and L235A mutation in the IgG1 Fc amino acid sequence. Another example of an Fc silent mutation is a mutation at residue D265, or at D265 and P329 for example as used in an IgG1 antibody as the DAPA (D265A, P329A) mutation (U.S. Pat. No. 6,737,056). Another silent IgG1 antibody comprises a mutation at residue N297 (e.g. N297A, N297S mutation), which results in aglycosylated/non-glycosylated antibodies. Other silent mutations include: substitutions at residues L234 and G237 (L234A/G237A); substitutions at residues S228, L235 and R409 (S228P/L235E/R409K,T,M,L); substitutions at residues H268, V309, A330 and A331 (H268QN309L/A330S/A331S); substitutions at residues C220, C226, C229 and P238 (C220S/C226S/C229S/P238S); substitutions at residues C226, C229, E233, L234 and L235 (C226S/C229S/E233P/L234V/L235A; substitutions at residues K322, L235 and L235 (K322A/L234A/L235A); substitutions at residues L234, L235 and P331 (L234F/L235E/P331S); substitutions at residues 234, 235 and 297; substitutions at residues E318, K320 and K322 (L235E/E318A/K320A/K322A); substitutions at residues (V234A, G237A, P238S); substitutions at residues 243 and 264; substitutions at residues 297 and 299; substitutions such that residues 233, 234, 235, 237, and 238 defined by the EU numbering system, comprise a sequence selected from PAAAP, PAAAS and SAAAS (see WO2011/066501).
[0165] Fc silent antibodies result in no or low ADCC activity, meaning that an Fc silent antibody exhibits an ADCC activity that is below 50% specific cell lysis. Preferably an antibody substantially lacks ADCC activity, e.g., the Fc silent antibody exhibits an ADCC activity (specific cell lysis) that is below 5% or below 1%. Fc silent antibodies can also result in lack of FcR-mediated cross-linking of CD73 at the surface of a CD73-expression.
[0166] In one embodiment, the antibody has a substitution in a heavy chain constant region at any one, two, three, four, five or more of residues selected from the group consisting of: 220, 226, 229, 233, 234, 235, 236, 237, 238, 243, 264, 268, 297, 298, 299, 309, 310, 318, 320, 322, 327, 330, 331 and 409 (numbering of residues in the heavy chain constant region is according to EU numbering according to Kabat). In one embodiment, the antibody comprises a substitution at residues 234, 235 and 322. In one embodiment, the antibody has a substitution at residues 234, 235 and 331.
[0167] In one embodiment, the Fc silent antibody comprises an Fc domain comprising an amino acid substitution at residues 234, 235 and 331, for example the TM mutation having substitutions L234F, L235E and P331S. In one embodiment, the antibody comprises an Fc domain comprising an amino acid substitution at residues 234, 235 and 322, or at residues 234, 235 and 331, described in US Patent publication no. US2015/0125444, wherein residue 234 is F (phenylalanine); residue 235 is Alanine (A), Asparagine (N), Phenylalanine (F), Glutamine (Q), or Valine (V); residue 322 is Alanine (A), Aspartic acid (D), Glutamic acid (E), Histidine (H), Asparagine (N), or Glutamine (Q); and residue 331 is Alanine (A) or Glycine (G). Amino acid residues are indicated according to EU numbering according to Kabat.
[0168] In one embodiment, the antibody comprises an Fc domain comprising an amino acid substitution that increases binding to human FcRn polypeptides in order to increase the in vivo half-life of the antibody. Exemplary mutations are described in Strohl, W., 2009, Curr. Opin. Biotechnol. vol. 20(6):685-691, the disclosure of which is incorporated herein by reference. Examples of substitutions used in antibodies of human IgG1 isotype are substitutions at residues M252, S254 and T256; substitutions at residues T250 and M428; substitutions at residue N434; substitutions at residues H433 and N434; substitutions at residues T307, E380 and N434; substitutions at residues T307, E380, and N434; substitutions at residues M252, S254, T256, H433, N434 and 436; substitutions at residue 1253; substitutions at residues P257, N434, D376 and N434.
[0169] In one embodiment, the antibody comprises an Fc domain comprising an amino acid substitution that confers decreased sensitivity to cleavage by proteases. Matrix metalloproteinases (MMPs) represent the most prominent family of proteinases associated with tumorigenesis. While cancer cells can express MMPs, the bulk of the extracellular MMP is provided by different types of stromal cells that infiltrate the tumor and each produce a specific set of proteinases and proteinase inhibitors, which are released into the extracellular space and specifically alter the milieu around the tumor. The MMPs present in the tumor microenvironment can cleave antibodies within the hinge region and may thus lead to the inactivation of therapeutic antibodies that are designed to function within the tumor site. In one embodiment, the Fc domain comprising an amino acid substitution has decreased sensitivity to cleavage by any one, two, three or more (or all of) of the proteases selected from the group consisting of: GluV8, IdeS, gelatinase A (MMP2), gelatinase B (MMP-9), matrix metalloproteinase-7 (MMP-7), stromelysin (MMP-3), and macrophage elastase (MMP-12). In one embodiment, the antibody decreased sensitivity to cleavage comprises an Fc domain comprising an amino acid substitution at residues E233-L234 and/or L235. In one embodiment, the antibody comprises an Fc domain comprising an amino acid substitution at residues E233, L234, L235 and G236. In one embodiment, the antibody comprises an Fc domain comprising an amino acid substitution at one or more residues 233-238, e.g., such that E233-L234-L235-G236 sequence is replaced by P233-V234-A235 (G236 is deleted). See, e.g., WO99/58572 and WO2012087746, the disclosures of which are incorporated herein by reference.
[0170] An antigen-binding compound can at any desired stage be assessed for its ability to inhibit the enzymatic activity of CD73, notably to block the 5-nucleotidase activity of CD73 and to reduce the production of adenosine by a CD73-expressing cell, and in turn restore the activity of and/or relieve the adenosine-mediated inhibition of lymphocytes.
[0171] The ability of an antibody to inhibit the enzymatic activity of CD73 can be tested in a cell-free assay using recombinant soluble human CD73 (as dimers) and AMP, where conversion of AMP to adenosine (and/or inhibition thereof) is detected directly (e.g. by measurement of substrates and products, i.e. AMP, adenosine and/or phosphate), or indirectly. In one example, AMP and/or adenosine are detected via HPLC before and after incubation of the test compound with recombinant CD73. Recombinant CD73 is available, e.g., from R&D Systems (Minneapolis, Minn.).
[0172] The inhibitory activity (i.e. cytotoxicity enhancing potential) of an antibody can also be assessed in any of a number of other ways. For example, in an indirect assay, a luciferase-based reagent is used (e.g. CellTiter-Glo system available from Promega), to detect the disappearance of AMP. The luciferase reaction in the assay is inhibited by AMP. Adding the CD73 enzyme to the reaction degrades the AMP, and relieves the inhibition, producing a detectable signal (see Example 2 herein).
[0173] The assays using soluble CD73 will be include testing at conditions where the antibodies are provided at a substantial molar excess (e.g. 10-fold, 20-fold, 50-fold, 100-fold, etc.) to the CD73 polypeptide dimers. When provided in molar excess to the enzyme, the anti-CD73 antibodies will no longer be capable of forming multimeric complexes of antibodies and CD73 dimers; antibodies that retain inhibition of the enzymatic activity of CD73 can then be selected.
[0174] The ability of an antibody to inhibit the 5-ectonucletidase enzymatic activity of CD73 can alternatively or in addition also be tested in a cellular assay (using cells that express CD73). Advantageously, antibodies can be tested or screened first in the cell-free assay to identify antibodies that block the activity of the enzyme to reduce likelihood of selecting antibodies that inhibit CD73 by causing internalization of CD73, and then tested as purified antibody in cellular assays. Cellular assays can be carried out as shown in the Examples herein. For example, a CD73-expressing cell line (e.g. MDA-MB-231 cell line) are plated in flat-bottom 96 well plates in presence of anti-CD73 antibodies and incubated. AMP is added to the cells and incubated at 4 C. (to avoid CD73 down-modulation). Plates are then centrifuged and supernatant is transferred to flat bottom 96 well culture plate. Free phosphate produced by the hydrolysis of AMP into adenosine is then quantified. A decrease in hydrolysis of AMP into adenosine in the presence of antibody indicate the antibody inhibits cellular CD73.
[0175] In one embodiment, an antibody preparation causes at least a 50% decrease in the enzymatic activity of a CD73 polypeptide, preferably at least a 60%, 70% or 80% decrease in the enzymatic activity of a CD73 polypeptide (e.g. a soluble homodimeric CD73 polypeptide; CD73 expressed by cells).
[0176] The activity of an antibody can also be measured in an indirect assay for its ability to modulate the activity of lymphocytes, for example to relieve the adenosine-mediated inhibition of lymphocyte activity, or to cause the activation of lymphocyte activity. This can be addressed, for example, using a cytokine-release assay. In another example, an antibody can be evaluated in an indirect assay for its ability to modulate the proliferation of lymphocytes.
[0177] The antibody can be tested for its ability to internalize or to induce down-modulation of CD73, e.g. whether by internalization or induction of CD73 shedding from the cell surface. Whether an anti-CD73 antibody internalizes upon binding CD73 on a mammalian cell, or whether a CD73 polypeptide undergoes intracellular internalization (e.g. upon being bound by an antibody) can be determined by various assays including those described in the experimental examples herein (e.g., Example 7). In other examples, to test internalization in vivo, the test antibody is labeled and introduced into an animal known to have CD73 expressed on the surface of certain cells. The antibody can be radiolabeled or labeled with fluorescent or gold particles, for instance. Animals suitable for this assay include a mammal such as a nude mouse that contains a human CD73-expressing tumor transplant or xenograft, or a mouse into which cells transfected with human CD73 have been introduced, or a transgenic mouse expressing the human CD73 transgene. Appropriate controls include animals that did not receive the test antibody or that received an unrelated antibody, and animals that received an antibody to another antigen on the cells of interest, which antibody is known to be internalized upon binding to the antigen. The antibody can be administered to the animal, e.g., by intravenous injection. At suitable time intervals, tissue sections of the animal can be prepared using known methods or as described in the experimental examples below, and analyzed by light microscopy or electron microscopy, for internalization as well as the location of the internalized antibody in the cell. For internalization in vitro, the cells can be incubated in tissue culture dishes in the presence or absence of the relevant antibodies added to the culture media and processed for microscopic analysis at desired time points. The presence of an internalized, labeled antibody in the cells can be directly visualized by microscopy or by autoradiography if radiolabeled antibody is used. Optionally, in microscopy, co-localization with a known polypeptide or other cellular component can be assessed; for example co-localization with endosomal/lysosomal marker LAMP-1 (CD107a) can provide information about the subcellular localization of the internalized antibody. Alternatively, in a quantitative biochemical assay, a population of cells comprising CD73-expressing cells are contacted in vitro or in vivo with a radiolabeled test antibody and the cells (if contacted in vivo, cells are then isolated after a suitable amount of time) are treated with a protease or subjected to an acid wash to remove un-internalized antibody on the cell surface. The cells are ground up and the amount of protease resistant, radioactive counts per minute (cpm) associated with each batch of cells is measured by passing the homogenate through a scintillation counter. Based on the known specific activity of the radiolabeled antibody, the number of antibody molecules internalized per cell can be deduced from the scintillation counts of the ground-up cells. Cells are contacted with antibody in vitro preferably in solution form such as by adding the cells to the cell culture media in the culture dish or flask and mixing the antibody well with the media to ensure uniform exposure of the cells to the antibody.
Antibody Epitopes
[0178] In one aspect, the antibodies bind a common antigenic determinant present on both soluble CD73 and CD73 expressed at the cell surface.
[0179] In one aspect, the antibodies bind substantially the same epitope as antibody 11E1, 8C7, 3C12 or 6E1. In one embodiment, the antibodies bind to an epitope of CD73 that at least partially overlaps with, or includes at least one residue in, the epitope bound by antibody 11E1, 8C7, 3C12 or 6E1. The residues bound by the antibody can be specified as being present on the surface of the of the CD73 polypeptide, e.g. in a CD73 polypeptide expressed on the surface of a cell. The amino acid residues on CD73 bound by the antibody can for example be selected from the group consisting of the residues listed in Table 1.
[0180] Binding of anti-CD73 antibody to cells transfected with CD73 mutants can be measured and compared to the ability of anti-CD73 antibody to bind wild-type CD73 polypeptide (e.g., SEQ ID NOS: 1 or 2). A reduction in binding between an anti-CD73 antibody and a mutant CD73 polypeptide (e.g., a mutant CD73 of Table 1) means that there is a reduction in binding affinity (e.g., as measured by known methods such FACS testing of cells expressing a particular mutant, or by Biacore testing of binding to mutant polypeptides) and/or a reduction in the total binding capacity of the anti-CD73 antibody (e.g., as evidenced by a decrease in Bmax in a plot of anti-CD73 antibody concentration versus polypeptide concentration). A significant reduction in binding indicates that the mutated residue is directly involved in binding to the anti-CD73 antibody or is in close proximity to the binding protein when the anti-CD73 antibody is bound to CD73.
[0181] In some embodiments, a significant reduction in binding means that the binding affinity and/or capacity between an anti-CD73 antibody and a mutant CD73 polypeptide is reduced by greater than 40%, greater than 50%, greater than 55%, greater than 60%, greater than 65%, greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90% or greater than 95% relative to binding between the antibody and a wild type CD73 polypeptide. In certain embodiments, binding is reduced below detectable limits. In some embodiments, a significant reduction in binding is evidenced when binding of an anti-CD73 antibody to a mutant CD73 polypeptide is less than 50% (e.g., less than 45%, 40%, 35%, 30%, 25%, 20%, 15% or 10%) of the binding observed between the anti-CD73 antibody and a wild-type CD73 polypeptide.
[0182] In some embodiments, anti-CD73 antibodies are provided that exhibit significantly lower binding for a mutant CD73 polypeptide in which a residue in a segment comprising an amino acid residue bound by antibody 11E1, 8C7, 3C12 or 6E1 is substituted with a different amino acid. In one embodiment, the mutant is a mutant selected from mutants 3 and 16-22 of Table 1, compared to binding to a wild-type CD73 polypeptide (e.g. the polypeptide of SEQ ID NO: 1).
[0183] Optionally an antibody that loses binding to one or more mutants of mutants 3 and/or 16-22 does not exhibit significantly lower binding for one or more other mutants CD73 polypeptides of Table 1, e.g., one or more (or all of) mutants 2, 5, 6 or 7.
[0184] In one aspect, the anti-CD73 antibodies have reduced binding to a CD73 polypeptide having a mutation at residue K136 (with reference to SEQ ID NO: 1); optionally, the mutant CD73 polypeptide has the mutation: K136A.
[0185] In one aspect, the anti-CD73 antibodies have reduced binding to a CD73 polypeptide having a mutation at a residue selected from the group consisting of: K97, E125, Q153 and K330 (with reference to SEQ ID NO: 1); optionally, the mutant CD73 polypeptide has the mutations: K97A, E125A, Q153A and/or K330A (e.g., K97A, E125A and K330A; K97A, E125A and/or Q153A).
[0186] In one aspect, the anti-CD73 antibodies have reduced binding to a CD73 polypeptide having a mutation at a residue selected from the group consisting of: A99, E129, K133, E134, and A135 (with reference to SEQ ID NO: 1); optionally, the mutant CD73 polypeptide has the mutations: A99S, E129A, K133A, E134N, and/or A135S.
[0187] Optionally, in one aspect, the anti-CD73 antibodies do not have reduced binding to a CD73 polypeptide having a mutation at a residue selected from the group consisting of: Q70, R73, A74, A107 and R109 (with reference to SEQ ID NO: 1); optionally, the mutant CD73 polypeptide has the mutations: A99S, Q705, R73A, A74E, A1071 and/or R109G.
[0188] In one aspect, the anti-CD73 antibodies bind an epitope on CD73 comprising residue K136 (with reference to SEQ ID NO: 1).
[0189] In one aspect, the anti-CD73 antibodies bind an epitope on CD73 comprising one, two, three or four of the residues selected from the group consisting of K97, E125, Q153 and K330 (with reference to SEQ ID NO: 1).
[0190] In one aspect, the anti-CD73 antibodies bind an epitope on CD73 comprising one, two, three, four or five of the residues selected from the group consisting of A99, E129, K133, E134, and A135 (with reference to SEQ ID NO: 1).
[0191] In one aspect, the anti-CD73 antibodies bind an epitope on CD73 comprising one, two, three, four, five or more of the residues selected from the group consisting of K97, A99, E125, E129, K133, E134, A135 and K136 (with reference to SEQ ID NO: 1). In one aspect, the anti-CD73 antibodies bind an epitope on CD73 comprising one, two, three, four, five or more of the residues selected from the group consisting of K97, A99, E125, E129, K133, E134, A135, K136, Q153 and K330 (with reference to SEQ ID NO: 1.
[0192] Optionally, in one aspect, the anti-CD73 antibodies do not bind an epitope on CD73 comprising one, two, three, four or five of the residues selected from the group consisting of Q70, R73, A74, A107 and R109 (with reference to SEQ ID NO: 1).
Antibody CDR Sequences
Antibody 11E1
[0193] The amino acid sequence of the heavy chain variable region of antibody 11E1 is listed as SEQ ID NO: 3, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 4. In a specific embodiment, the disclosure provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 11E1; optionally the antibody comprises the hypervariable region of antibody 11E1. In any of the embodiments herein, antibody 11E1 can be characterized by the amino acid sequences and/or nucleic acid sequences encoding it. In one embodiment, the monoclonal antibody comprises the Fab or F(ab).sub.2 portion of 11E1. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 11E1. According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 11E1. Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 11E1 or one, two or three of the CDRs of the light chain variable region of 11E1. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five or more amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 11E1 are fused to an immunoglobulin constant region of the human IgG type, optionally a human constant region, optionally a human IgG1, IgG2, IgG3 or IgG4 isotype, optionally further comprising an amino acid substitution to reduce effector function (binding to human Fc receptors).
[0194] In another aspect, the disclosure provides an antibody, wherein the antibody comprises: a HCDR1 region of 11E1 comprising an amino acid sequence as set forth in Table A-1, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region of 11E1 comprising an amino acid sequence as set forth in Table A-1, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region of 11E1 comprising an amino acid sequence as set forth in Table A-1, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region of 11E1 comprising an amino acid sequence as set forth in Table A-1, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region of 11E1 comprising an amino acid sequence as set forth in Table A-1, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR3 region of 11E1 comprising an amino acid sequence as set forth in Table A-1, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be deleted or substituted by a different amino acid. The HCDR1, 2, 3 and LCDR1, 2, 3 sequences can optionally be specified as all (or each, independently) being those of the Kabat numbering system (as indicated in Table A-1 for each CDR), those of the Chotia numbering system as indicated in Table A-1 for each CDR), those of the IMGT numbering system as indicated in Table A-1 for each CDR), or any other suitable numbering system.
TABLE-US-00002 TABLEA-1 CDR HCDR1 HCDR2 HCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 1E11 Kabat 5 SYNMY 8 YIDPYNGGTSYNQKFKG 11 GYGNYKAWFAY Chotia 6 GYAFTSY 9 PYNG 12 YGNYKAWFA IMGT 7 GYAFTSYN 10 IDPYNGGT 13 ARGYGNYKAW FAY CDR LCDR1 LCDR2 LCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 1E11 Kabat 14 KASQSVTNDVA 17 YASNRYT 19 QQDYSSLT Chotia 15 SQSVTND 18 YAS 20 DYSSL IMGT 16 QSVTND 18 YAS 19 QQDYSSLT
Antibody 6E1
[0195] The amino acid sequence of the heavy chain variable region of antibody 6E1 is listed as SEQ ID NO: 21, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 22. In a specific embodiment, the disclosure provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 6E1; optionally the antibody comprises the hypervariable region of antibody 6E1. In any of the embodiments herein, antibody 6E1 can be characterized by the amino acid sequences and/or nucleic acid sequences encoding it. In one embodiment, the monoclonal antibody comprises the Fab or F(ab).sub.2 portion of 6E1. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 6E1. According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 6E1. Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 6E1 or one, two or three of the CDRs of the light chain variable region of 6E1. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five or more amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 6E1 are fused to an immunoglobulin constant region of the human IgG type, optionally a human constant region, optionally a human IgG1, IgG2, IgG3 or IgG4 isotype, optionally further comprising an amino acid substitution to reduce effector function (binding to human Fc receptors).
[0196] In another aspect, the disclosure provides an antibody, wherein the antibody comprises: a HCDR1 region of 6E1 comprising an amino acid sequence as set forth in Table A-2, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region of 6E1 comprising an amino acid sequence as set forth in Table A-2, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region of 6E1 comprising an amino acid sequence as set forth in Table A-2, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region of 6E1 comprising an amino acid sequence as set forth in Table A-2, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region of 6E1 comprising an amino acid sequence as set forth in Table A-2, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR3 region of 6E1 comprising an amino acid sequence as set forth in Table A-2, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be deleted or substituted by a different amino acid. The HCDR1, 2, 3 and LCDR1, 2, 3 sequences can optionally be specified as all (or each, independently) being those of the Kabat numbering system (as indicated in Table A-2 for each CDR), those of the Chotia numbering system as indicated in Table A-2 for each CDR), those of the IMGT numbering system as indicated in Table A-2 for each CDR), or any other suitable numbering system.
TABLE-US-00003 TABLEA-2 CDR HCDR1 HCDR2 HCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 6E1 Kabat 5 SYNMY 23 YIDPYNGGSSYNQKFKG 25 GYNNYKAWFAY Chotia 6 GYAFTSY 9 PYNG 26 YNNYKAWFA IMGT 7 GYAFTSYN 24 IDPYNGGS 27 ARGYNNYKAW FAY CDR LCDR1 LCDR2 LCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 6E1 Kabat 14 KASQSVTNDVA 17 YASNRYT 19 QQDYSSLT Chotia 15 SQSVTND 18 YAS 20 DYSSL IMGT 16 QSVTND 18 YAS 19 QQDYSSLT
Antibody 3C12
[0197] The amino acid sequence of the heavy chain variable region of antibody 3C12 is listed as SEQ ID NO: 36, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 37. In a specific embodiment, the disclosure provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 3C12; optionally the antibody comprises the hypervariable region of antibody 3C12. In any of the embodiments herein, antibody 3C12 can be characterized by the amino acid sequences and/or nucleic acid sequences encoding it. In one embodiment, the monoclonal antibody comprises the Fab or F(ab).sub.2 portion of 3C12. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 3C12. According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 3C12. Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 3C12 or one, two or three of the CDRs of the light chain variable region of 3C12. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five or more amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 3C12 are fused to an immunoglobulin constant region of the human IgG type, optionally a human constant region, optionally a human IgG1, IgG2, IgG3 or IgG4 isotype, optionally further comprising an amino acid substitution to reduce effector function (binding to human Fc receptors).
[0198] In another aspect, the disclosure provides an antibody, wherein the antibody comprises: a HCDR1 region of 3C12 comprising an amino acid sequence as set forth in Table A-3, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region of 3C12 comprising an amino acid sequence as set forth in Table A-3, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region of 3C12 comprising an amino acid sequence as set forth in Table A-3, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region of 3C12 comprising an amino acid sequence as set forth in Table A-3, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region of 3C12 comprising an amino acid sequence as set forth in Table A-3, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR3 region of 3C12 comprising an amino acid sequence as set forth in Table A-3, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be deleted or substituted by a different amino acid. The HCDR1, 2, 3 and LCDR1, 2, 3 sequences can optionally be specified as all (or each, independently) being those of the Kabat numbering system (as indicated in Table A-3 for each CDR), those of the Chotia numbering system as indicated in Table A-3 for each CDR), those of the IMGT numbering system as indicated in Table A-3 for each CDR), or any other suitable numbering system.
TABLE-US-00004 TABLEA-3 CDR HCDR1 HCDR2 HCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 3C12 Kabat 30 SYNMN 33 YIDPYNGGSSYNLTFKG 11 GYGNYKAWFAY Chotia 31 GYAFASY 9 PYNG 12 YGNYKAWFA IMGT 32 GYAFASYN 24 IDPYNGGS 13 ARGYGNYKAWF AY CDR LCDR1 LCDR2 LCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 3C12 Kabat 38 KASQSVSNDVA 17 YASTRYT 19 QQDYSSLT Chotia 34 SQSVSND 18 YAS 20 DYSSL IMGT 35 QSVSND 18 YAS 19 QQDYSSLT
Antibody 8C7
[0199] The amino acid sequence of the heavy chain variable region of antibody 8C7 is listed as SEQ ID NO: 28, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 29. In a specific embodiment, the disclosure provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 8C7; optionally the antibody comprises the hypervariable region of antibody 8C7. In any of the embodiments herein, antibody 8C7 can be characterized by the amino acid sequences and/or nucleic acid sequences encoding it. In one embodiment, the monoclonal antibody comprises the Fab or F(ab).sub.2 portion of 8C7. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 8C7. According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 8C7. Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 8C7 or one, two or three of the CDRs of the light chain variable region of 8C7. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five or more amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 8C7 are fused to an immunoglobulin constant region of the human IgG type, optionally a human constant region, optionally a human IgG1, IgG2, IgG3 or IgG4 isotype, optionally further comprising an amino acid substitution to reduce effector function (binding to human Fc receptors).
[0200] In another aspect, the disclosure provides an antibody, wherein the antibody comprises: a HCDR1 region of 8C7 comprising an amino acid sequence as set forth in Table A-4, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region of 8C7 comprising an amino acid sequence as set forth in Table A-4, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region of 8C7 comprising an amino acid sequence as set forth in Table A-4, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region of 8C7 comprising an amino acid sequence as set forth in Table A-4, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region of 8C7 comprising an amino acid sequence as set forth in Table A-4, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR3 region of 8C7 comprising an amino acid sequence as set forth in Table A-4, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, optionally wherein one or more of these amino acids may be deleted or substituted by a different amino acid. The HCDR1, 2, 3 and LCDR1, 2, 3 sequences can optionally be specified as all (or each, independently) being those of the Kabat numbering system (as indicated in Table A-4 for each CDR), those of the Chotia numbering system as indicated in Table A-4 for each CDR), those of the IMGT numbering system as indicated in Table A-4 for each CDR), or any other suitable numbering system.
TABLE-US-00005 TABLEA-4 CDR HCDR1 HCDR2 HCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 8C7 Kabat 30 SYNMN 33 YIDPYNGGSSYNLTFKG 11 GYGNYKAWFAY Chotia 31 GYAFASY 9 PYNG 12 YGNYKAWFA IMGT 32 GYAFASYN 24 IDPYNGGS 13 ARGYGNYKAWF AY CDR LCDR1 LCDR2 LCDR3 def- SEQ SEQ SEQ mAb inition ID Sequence ID Sequence ID Sequence 8C7 Kabat 44 KASQSVSNDVA 17 YASTRYT 19 QQDYSSLT Chotia 34 SQSVSND 18 YAS 20 DYSSL IMGT 35 QSVSND 18 YAS 19 QQDYSSLT
[0201] In another aspect of any of the embodiments herein, any of the CDRs 1, 2 and 3 of the heavy and light chains of 11E1, 8C7, 3C12 or 6E1 may be characterized by a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, and/or as having an amino acid sequence that shares at least 50%, 60%, 70%, 80%, 85%, 90% or 95% sequence identity with the particular CDR or set of CDRs listed in the corresponding SEQ ID NO.
[0202] In one embodiment, an antibody may comprise a heavy chain comprising: [0203] a a heavy chain CDR1 (HCDR1) comprising an amino acid sequence of SEQ ID NO: 38; and/or [0204] b a heavy chain CDR2 (HCDR2) comprising an amino acid sequence of SEQ ID NO: 39 (or 40); and/or [0205] c a heavy chain CDR3 (HCDR3) comprising an amino acid sequence of SEQ ID NO: 41.
[0206] In one embodiment, an antibody may comprise a light chain comprising: [0207] a a light chain CDR1 (LCDR1) comprising an amino acid sequence selected from SEQ ID NO: 42; and/or [0208] b a light chain CDR2 (LCDR2) comprising an amino acid sequence of SEQ ID NO: 43; and/or [0209] c a light chain CDR3 (LCDR3) comprising an amino acid sequence of SEQ ID NO: 19 or 20.
[0210] In any of the antibodies, e.g., 11E1, 8C7, 3C12 or 6E1, the specified variable region and CDR sequences may comprise sequence modifications, e.g. a substitution (1, 2, 3, 4, 5, 6, 7, 8 or more sequence modifications). In one embodiment, a CDRs 1, 2 and/or 3 of the heavy and light chains comprises one, two, three or more amino acid substitutions, where the residue substituted is a residue present in a sequence of human origin. In one embodiment the substitution is a conservative modification. A conservative sequence modification refers to an amino acid modification that does not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are typically those in which an amino acid residue is replaced with an amino acid residue having a side chain with similar physicochemical properties. Specified variable region and CDR sequences may comprise one, two, three, four or more amino acid insertions, deletions or substitutions. Where substitutions are made, preferred substitutions will be conservative modifications. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g. glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g. threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within the CDR regions of an antibody can be replaced with other amino acid residues from the same side chain family and the altered antibody can be tested for retained function (i.e., the properties set forth herein) using the assays described herein.
[0211] The sequences of the variable regions of the antibodies are listed in Table B below (if leader sequences are present any antibody chain can be specified to start at the amino acid position immediately following the end of the leader sequence). In any embodiment herein, a VL or VH sequence can be specified or numbered so as to contain or lack a signal peptide or any part thereof.
TABLE-US-00006 TABLEB SEQ IDNO: AminoAcidSequence 11E1VH 3 EIQLQQSGPELVKPGASVKVSCKASGYAFTSYNMYWVKQSHGKSLEWIG YIDPYNGGTSYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCAR GYGNYKAWFAYWGQGTLVTVSA 11E1VL 4 DAVMTQTPKFLLVSAGDRVTITCKASQSVTNDVAWYQQKPGQSPKLLIY YASNRYTGVPDRFTGSGYGTDFTFTISTVQAEDLAVYFCQQDYSSLTFG AGTKLELK 6E1VH 21 EFQLQQSGPELVKPGASVKVSCKASGYAFTSYNMYWVKQSHGKRLEWIG YIDPYNGGSSYNQKFKGKATLTVDKSSSTAYMHLNNLTSEDSAVYYCAR GYNNYKAWFAYWGQGTLVTVSA 6E1VL 22 SIVMTQTPKFLLVSAGDRVTITCKASQSVTNDVAWYQQKPGQSPKLLIY YASNRYTGVPDRFTGSGYGTDFTFTISTMQAEDLAVYFCQQDYSSLTFG AGTKLELK 8C7VH 28 EVQLQQSGPELVKPGASVKVSCKASGYAFASYNMNWVKQSHGKSLDWIGYIDPY NGGSSYNLTFKGKATLTVDKSSTTAYMHLNSLTSEDSAVYYCARGYGNYKAWFA YWGQGTLVTVSAASTKGP 8C7VL 29 SIVMTPTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASTR YTGVPDRFTGSGYGTDFTFTISTVQAEDLAVYFCQQDYSSLTFGAGTKLELKRT VAAP 3C12VH 36 QIQLQQSGPELVKPGASVKVSCKASGYAFASYNMNWVKQSHGKSLDWIGYIDPY NGGSSYNLTFKGKATLTVDKSSTTAYMHLNSLTSEDSAVYYCARGYGNYKAWFA YWGQGTLVTVSAASTKGP 3C12VL 37 DVVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASTR YTGVPDRFTGSGYGTDFTFTISTVQAEDLAVYFCQQDYSSLTFGAGTKLELKRT VAAP
[0212] Fragments and derivatives of antibodies (which are encompassed by the term antibody or antibodies as used in this application, unless otherwise stated or clearly contradicted by context) can be produced by techniques that are known in the art. Fragments comprise a portion of the intact antibody, generally the antigen binding site or variable region. Examples of antibody fragments include Fab, Fab, Fab-SH, F (ab) 2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a single-chain antibody fragment or single chain polypeptide), including without limitation (1) single-chain Fv molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multispecific (e.g. bispecific) antibodies formed from antibody fragments. Included, inter alia, are a nanobody, domain antibody, single domain antibody or a dAb.
[0213] In certain embodiments, the DNA of a hybridoma producing an antibody, can be modified prior to insertion into an expression vector, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous non-human sequences (e.g., Morrison et al., PNAS pp. 6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, chimeric or hybrid antibodies are prepared that have the binding specificity of the original antibody. Typically, such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody.
[0214] Optionally an antibody is humanized. Humanized forms of antibodies are specific chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab, F (ab) 2, or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from the murine immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of the original antibody (donor antibody) while maintaining the desired specificity, affinity, and capacity of the original antibody.
[0215] In some instances, Fv framework residues of the human immunoglobulin may be replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in either the recipient antibody or in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of the original antibody and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details see Jones et al., Nature, 321, pp. 522 (1986); Reichmann et al, Nature, 332, pp. 323 (1988); Presta, Curr. Op. Struct. Biol., 2, pp. 593 (1992); Verhoeyen et Science, 239, pp. 1534; and U.S. Pat. No. 4,816,567, the entire disclosures of which are herein incorporated by reference.) Methods for humanizing the antibodies are well known in the art.
[0216] The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called best-fit method, the sequence of the variable domain of an antibody is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the mouse is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol. 151, pp. 2296 (1993); Chothia and Lesk, J. Mol. 196, 1987, pp. 901). Another method uses a particular framework from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework can be used for several different humanized antibodies (Carter et al., PNAS 89, pp. 4285 (1992); Presta et al., J. Immunol., 151, p. 2623 (1993)).
[0217] It is further important that antibodies be humanized with retention of high affinity for CD73 and other favorable biological properties. To achieve this goal, according to one method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the consensus and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen (s), is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding. In a one example, the FRs of a humanized antibody chain are derived from a human variable region having at least about 60% overall sequence identity, and preferably at least about 80% overall sequence identity, with the variable region of the nonhuman donor (e.g., a 11E1, 8C7, 3C12 or 6E1 antibody). Optionally, the humanized heavy and/or light chain variable region shares at least about 60%, 70% or 80% overall sequence identity with the respective heavy and/or light chain variable region of the nonhuman donor (e.g., a 11E1, 8C7, 3C12 or 6E1 antibody).
[0218] Another method of making humanized monoclonal antibodies is to use a XenoMouse (Abgenix, Fremont, Calif.) as the mouse used for immunization. A XenoMouse is a murine host according that has had its immunoglobulin genes replaced by functional human immunoglobulin genes. Thus, antibodies produced by this mouse or in hybridomas made from the B cells of this mouse, are already humanized. The XenoMouse is described in U.S. Pat. No. 6,162,963, which is herein incorporated in its entirety by reference.
[0219] Human antibodies may also be produced according to various other techniques, such as by using, for immunization, other transgenic animals that have been engineered to express a human antibody repertoire (Jakobovitz et al., Nature 362 (1993) 255), or by selection of antibody repertoires using phage display methods. Such techniques are known to the skilled person and can be implemented starting from monoclonal antibodies as disclosed in the present application.
Antibody Formulations
[0220] An anti-CD73 antibody can be incorporated in a pharmaceutical formulation comprising in a concentration from 1 mg/ml to 500 mg/ml, wherein said formulation has a pH from 2.0 to 10.0. The formulation may further comprise a buffer system, preservative(s), tonicity agent(s), chelating agent(s), stabilizers and surfactants. In one embodiment, the pharmaceutical formulation is an aqueous formulation, i.e., formulation comprising water. Such formulation is typically a solution or a suspension. In a further embodiment, the pharmaceutical formulation is an aqueous solution. The term aqueous formulation is defined as a formulation comprising at least 50% w/w water. Likewise, the term aqueous solution is defined as a solution comprising at least 50% w/w water, and the term aqueous suspension is defined as a suspension comprising at least 50% w/w water.
[0221] In another embodiment, the pharmaceutical formulation is a freeze-dried formulation, whereto the physician or the patient adds solvents and/or diluents prior to use.
[0222] In another embodiment, the pharmaceutical formulation is a dried formulation (e.g. freeze-dried or spray-dried) ready for use without any prior dissolution.
[0223] In a further aspect, the pharmaceutical formulation comprises an aqueous solution of such an antibody, and a buffer, wherein the antibody is present in a concentration from 1 mg/ml or above, and wherein said formulation has a pH from about 2.0 to about 10.0.
[0224] In a another embodiment, the pH of the formulation is in the range selected from the list consisting of from about 2.0 to about 10.0, about 3.0 to about 9.0, about 4.0 to about 8.5, about 5.0 to about 8.0, and about 5.5 to about 7.5.
[0225] In a further embodiment, the buffer is selected from the group consisting of sodium acetate, sodium carbonate, citrate, glycylglycine, histidine, glycine, lysine, arginine, sodium dihydrogen phosphate, disodium hydrogen phosphate, sodium phosphate, and tris(hydroxymethyl)-aminomethan, bicine, tricine, malic acid, succinate, maleic acid, fumaric acid, tartaric acid, aspartic acid or mixtures thereof. Each one of these specific buffers constitutes an alternative embodiment.
[0226] In a further embodiment, the formulation further comprises a pharmaceutically acceptable preservative. In a further embodiment, the formulation further comprises an isotonic agent. In a further embodiment, the formulation also comprises a chelating agent. In a further embodiment the formulation further comprises a stabilizer. In a further embodiment, the formulation further comprises a surfactant. For convenience reference is made to Remington: The Science and Practice of Pharmacy, 19.sup.th edition, 1995.
[0227] It is possible that other ingredients may be present in the peptide pharmaceutical formulation. Such additional ingredients may include wetting agents, emulsifiers, antioxidants, bulking agents, tonicity modifiers, chelating agents, metal ions, oleaginous vehicles, proteins (e.g., human serum albumin, gelatine or proteins) and a zwitterion (e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine). Such additional ingredients, of course, should not adversely affect the overall stability of the pharmaceutical formulation.
[0228] Pharmaceutical compositions containing an antibody may be administered to a patient in need of such treatment at several sites, for example, at topical sites, for example, skin and mucosal sites, at sites which bypass absorption, for example, administration in an artery, in a vein, in the heart, and at sites which involve absorption, for example, administration in the skin, under the skin, in a muscle or in the abdomen. Administration of pharmaceutical compositions may be through several routes of administration, for example, subcutaneous, intramuscular, intraperitoneal, intravenous, lingual, sublingual, buccal, in the mouth, oral, in the stomach and intestine, nasal, pulmonary, for example, through the bronchioles and alveoli or a combination thereof, epidermal, dermal, transdermal, vaginal, rectal, ocular, for examples through the conjunctiva, uretal, and parenteral to patients in need of such a treatment.
[0229] Suitable antibody formulations can also be determined by examining experiences with other already developed therapeutic monoclonal antibodies. Several monoclonal antibodies have been shown to be efficient in clinical situations, such as Rituxan (Rituximab), Herceptin (Trastuzumab) Xolair (Omalizumab), Bexxar (Tositumomab), Campath (Alemtuzumab), Zevalin, Oncolym and similar formulations may be used with the antibodies. For example, a monoclonal antibody can be supplied at a concentration of 10 mg/mL in either 100 mg (10 mL) or 500 mg (50 mL) single-use vials, formulated for IV administration in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium citrate dihydrate, 0.7 mg/mL polysorbate 80, and Sterile Water for Injection. The pH is adjusted to 6.5. In another embodiment, the antibody is supplied in a formulation comprising about 20 mM Na-Citrate, about 150 mM NaCl, at pH of about 6.0.
Diagnosis and Treatment of Malignancies
[0230] Methods of treating an individual, notably a human patient, using an anti-CD73 antibody as described herein are also provided for. In one embodiment, the disclosure provides for the use of an antibody as described herein in the preparation of a pharmaceutical composition for administration to a human patient. Typically, the patient suffers from, or is at risk for, cancer.
[0231] For example, in one aspect, provided is a method of restoring or potentiating the activity of lymphocytes in a patient in need thereof, comprising the step of administering a neutralizing anti-CD73 antibody to said patient. The antibody can be for example a human or humanized anti-CD73 antibody, which antibody reduces or abrogates the 5-nucleotidase activity of human CD73. In one embodiment, the method directed at increasing the activity of lymphocytes (e.g. T cells) in patients having a disease in which increased lymphocyte activity is beneficial or which is caused or characterized by immunosuppression, immunosuppressive cells, or, e.g., adenosine generated by CD4 T cells, CD8 T cells, B cells). The methods will be particularly useful for example patients having a solid tumor in which it is suspected the tumor microenvironment (and CD73-mediated adenosine production therein) may contribute to lack of recognition by the immune system (immune escape). The tumor may, for example, be characterized by CD73-expressing immune cells, e.g., CD4 T cells, CD8 T cells, B cells.
[0232] More specifically, the methods and compositions are utilized for the treatment of a variety of cancers and other proliferative diseases. Because these methods operate by reducing adenosine that inhibits the anti-tumor activity of lymphocytes and possibly additionally by increasing ATP that can increase the anti-tumor activity of lymphocytes, they are applicable to a very broad range of cancers, including in particular solid tumors in which adenosine in the tumor microenvironment may play a strong role in suppressing the anti-tumor immune response. In one embodiment, a human patient treated with an anti-CD73 antibody has liver cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, breast cancer, lung cancer, non-small cell lung cancer (NSCLC), castrate resistant prostate cancer (CRPC), melanoma, uterine cancer, colon cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, environmentally induced cancers including those induced by asbestos, hematologic malignancies including, for example, multiple myeloma, B-cell lymphoma, Hodgkin lymphoma/primary mediastinal B-cell lymphoma, non-Hodgkin's lymphomas, acute myeloid lymphoma, chronic myelogenous leukemia, chronic lymphoid leukemia, follicular lymphoma, diffuse large B-cell lymphoma, Burkitt's lymphoma, immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, mantle cell lymphoma, acute lymphoblastic leukemia, mycosis fungoides, anaplastic large cell lymphoma, T-cell lymphoma, and precursor T-lymphoblastic lymphoma, and any combinations of said cancers. The present disclosure is also applicable to treatment of metastatic cancers. Patients can be tested or selected for one or more of the above described clinical attributes prior to, during or after treatment.
[0233] In one embodiment, the anti-CD73 antibody is administered an amount effective to achieve and/or maintain in an individual (e.g. for 1, 2, 3, 4 weeks, and/or until the subsequent administration of antigen binding compound) a blood concentration of at least the EC.sub.50, optionally the EC.sub.70, optionally substantially the EC.sub.100, for neutralization of the enzymatic activity of CD73. In one embodiment, the active amount of anti-CD73 antibody is an amount effective to achieve the EC.sub.50, optionally the EC.sub.70, optionally substantially the EC.sub.100, for neutralization of the enzymatic activity of CD73 in an extravascular tissue of an individual. In one embodiment, the active amount of anti-CD73 antibody is an amount effective to achieve (or maintain) in an individual the EC.sub.50, optionally the EC.sub.70, optionally substantially the EC.sub.100, for inhibition of neutralize the enzymatic activity of CD73.
[0234] Optionally, in one embodiment, in contrast to some antibodies that are directed to the depletion of CD73-expressing tumor cells by ADCC (which, e.g., can provide full efficacy at concentrations equal or substantially lower than that which provides receptor saturation), the anti-CD73 antibody is a pure blocker (no substantial Fc receptor-mediated activity) and is administered in an amount effective to neutralize the enzymatic activity of CD73 for a desired period of time, e.g. 1 week, 2 weeks, a month, until the next successive administration of anti-CD73 antibody.
[0235] In one embodiment, the anti-CD73 antibody is administered in an amount effective to achieve and/or maintain (e.g. for 1, 2, 3, 4 weeks, and/or until the subsequent administration of anti-CD73 antibody) in an individual a blood concentration of at least the EC.sub.50, optionally the EC.sub.70, optionally substantially the EC.sub.100, for inhibition of CD73-mediated catabolism of AMP to adenosine (e.g., by assessing neutralization of 5 ectonucleotidase activity in MDA-MB-231 cells by quantifying hydrolysis of AMP to adenosine, see Example 5). In one embodiment, the amount of anti-CD73 antibody is an amount effective to achieve (or maintain) the EC.sub.50, optionally the EC.sub.70, optionally substantially the EC.sub.100, for inhibition of CD73-mediated catabolism of AMP to adenosine in an extravascular tissue of an individual.
[0236] In one embodiment, provided is a method for treating or preventing cancer in an individual, the method comprising administering to an individual having disease an anti-CD73 antibody in an amount that achieves or maintains for a specified period of time a concentration in circulation, optionally in an extravascular tissue of interest (e.g. the tumor or tumor environment), that is higher than the concentration required for 50%, 70%, or full (e.g. 90%) receptor saturation CD73-expressing cells in circulation (for example as assessed in PBMC). Optionally the concentration achieved is at least 20%, 50% or 100% higher than the concentration required for the specified receptor saturation.
[0237] In one embodiment, provided is a method for treating or preventing cancer in an individual, the method comprising administering to the individual an anti-CD73 antibody in an amount that achieves or maintains for a specified period of time a concentration in circulation, optionally in an extravascular tissue of interest (e.g. the tumor or tumor environment), that is higher than the EC.sub.50, optionally EC.sub.70 or optionally EC.sub.100, for binding to CD73-expressing cells (e.g., as assessed by titrating anti-CD73 antibody on CD73-expressing cells, for example MDA-MB-231 cells as in Example 4). Optionally the concentration achieved is at least 20%, 50% or 100% higher than the EC.sub.50, optionally EC.sub.70 or optionally EC.sub.100, for binding to CD73-expressing cells.
[0238] In any embodiment, the antibody can for example have an EC.sub.50, optionally EC.sub.70 or optionally EC.sub.100, for binding to CD73-expressing cells in human PBMC of between 0.5-100 ng/ml, optionally 1-100 ng/ml, optionally 30-100 ng/ml, e.g. about 30-90 ng/ml, (e.g., as assessed by titrating anti-CD73 antibody on CD73-expressing cells, for example MDA-MB-231 cells as in Example 4). For example the EC.sub.50 may be about 30, 37, 39, 43, 57, 58, 61, 62, 90, 95, 143 ng/ml.
[0239] The EC.sub.50 for neutralization of the enzymatic activity of CD73 with the anti-CD73 antibody can be for example between about 0.01 g/ml and 1 g/ml, optionally between 0.1 g/ml and 10 g/ml, optionally between 0.1 g/ml and 1 g/ml. For example the EC.sub.50 may be about 0.1 g/ml, about 0.2 g/ml or about 0.3 g/ml. Thus an amount of this anti-CD73 antibody is for example administered so at to achieve and/or maintain a blood concentration of at least 0.1 g/ml, optionally at least 0.2 g/ml, optionally at least 1 g/ml, or optionally at least 2 g/ml.
[0240] When tissues outside of the vasculature are targeted (the tumor environment, e.g., in the treatment of solid tumors), an approximately 10-fold higher dose is typically believed to be needed, compared to the dose that provides the corresponding concentration in circulation. An amount of anti-CD73 antibody administered so at to achieve (and/or maintain) a concentration in circulation (blood) of about 1 g/ml, 2 g/ml, 10 g/ml, or 20 g/ml is expected to achieve (and/or maintain) an extravascular tissue (e.g. tumor tissue) concentration of about 0.1 g/ml, 0.2 g/ml, 1 g/ml, 2 g/ml, respectively.
[0241] In one embodiment, an anti-CD73 antibody is for example administered in an amount so at to achieve and/or maintain a tissue (e.g. tumor environment) concentration of at least 0.1 g/ml, optionally at least 0.2 g/ml, optionally at least 1 g/ml, or optionally at least 2 g/ml. The antibody can for example be administered in an amount to achieve and/or maintained a blood concentration of at least about 1 g/ml, 2 g/ml, 10 g/ml, or 20 g/ml, e.g. between 1-100 g/ml, 10-100 g/ml, 1-50 g/ml, 1-20 g/ml, or 1-10 g/ml. The amount administered can be adjusted to as to provide for maintenance of the desired concentration for the duration of a specified period of time following administration (e.g. 1, 2, 3, 4 weeks, etc).
[0242] In some embodiments, an amount of anti-CD73 antibody is administered so as to obtain a concentration in blood (serum) or an extravascular tissue (e.g. tumor environment) that corresponds to at least the EC.sub.70 or the EC.sub.100 for neutralization of the enzymatic activity of CD73. The antibody can for example be administered in an amount to achieve and/or maintained a blood concentration or an extravascular tissue (e.g. tumor environment) of at least about 1 g/ml, 2 g/ml, 10 g/ml, or 20 g/ml.
[0243] The EC.sub.50, EC.sub.70 or the EC.sub.100 can be assessed for example in a cellular assay for neutralization of the enzymatic activity of CD73 as shown in the Examples herein (e.g. neutralization of 5 ectonucleotidase activity in MDA-MB-231 cells by quantifying hydrolysis of AMP to adenosine, see Example 5). EC.sub.50 with respect to neutralization of the enzymatic activity of CD73, refers to the efficient concentration of anti-CD73 antibody which produces 50% of its maximum response or effect with respect to neutralization of the enzymatic activity.). EC.sub.70 with respect to neutralization of the enzymatic activity of CD73, refers to the efficient concentration of anti-CD73 antibody which produces 70% of its maximum response or effect. EC.sub.100 with respect to neutralization of the enzymatic activity of CD73, refers to the efficient concentration of anti-CD73 antibody which produces its substantially maximum response or effect with respect to such neutralization of the enzymatic activity.
[0244] In some embodiments, particularly for the treatment of solid tumors, the concentration achieved is designed to lead to a concentration in tissues (outside of the vasculature, e.g. in the tumor or tumor environment) that corresponds to at least the EC.sub.50 for neutralization of the enzymatic activity, optionally at about, or at least about, the EC.sub.100.
[0245] In one embodiment, the amount of anti-CD73 antibody is between 1 and 20 mg/kg body weight. In one embodiment, the amount is administered to an individual weekly, every two weeks, monthly or every two months.
[0246] In one embodiment provided is a method of treating a human individual having a cancer, comprising administering to the individual an effective amount of an anti-CD73 antibody of the disclosure for at least one administration cycle (optionally at least 2, 3, 4 or more administration cycles), wherein the cycle is a period of eight weeks or less, wherein for each of the at least one cycles, one, two, three or four doses of the anti-CD73 antibody are administered at a dose of 1-20 mg/kg body weight. In one embodiment, the anti-CD73 antibody is administered by intravenous infusion.
[0247] Suitable treatment protocols for treating a human include, for example, administering to the patient an amount as disclosed herein of an anti-CD73 antibody, wherein the method comprises at least one administration cycle in which at least one dose of the anti-CD73 antibody is administered. Optionally, at least 2, 3, 4, 5, 6, 7 or 8 doses of the anti-CD73 antibody are administered. In one embodiment, the administration cycle is between 2 weeks and 8 weeks.
[0248] In one embodiment, provided is a method for treating or preventing a disease (e.g. a cancer, a solid tumor, a hematological tumor) in an individual, the method comprising administering to an individual having disease (e.g. a cancer, a solid tumor) an anti-CD73 antibody that neutralizes the enzymatic activity of CD73 for at least one administration cycle, the administration cycle comprising at least a first and second (and optionally a 3.sup.rd, 4.sup.th, 5.sup.th, 6.sup.th, 7.sup.th and/or 81.sup.th or further) administration of the anti-CD73 antibody, wherein the anti-CD73 antibody is administered in an amount effective to achieve, or to maintain between two successive administrations, a blood (serum) concentration of anti-CD73 antibody of at least 0.1 g/ml, optionally at least 0.2 g/ml, optionally at least 1 g/ml, or optionally at least 2 g/ml (e.g. for treatment of a hematological tumor), or optionally at least about 1 g/ml, 2 g/ml, 10 g/ml, or 20 g/ml, e.g. between 1-100 g/ml, 1-50 g/ml, 1-20 g/ml, or 1-10 g/ml (e.g. for treatment of a solid tumor, for treatment of a hematological tumor). In one embodiment, a specified continuous blood concentration is maintained, wherein the blood concentration does not drop substantially below the specified blood concentration for the duration of the specified time period (e.g. between two administrations of antibody, number of weeks, 1 week, 2 weeks, 3 weeks, 4 weeks), i.e. although the blood concentration can vary during the specified time period, the specified blood concentration maintained represents a minimum or trough concentration. In one embodiment, a therapeutically active amount of an anti-CD73 antibody is an amount of such antibody capable of providing (at least) the EC.sub.50 concentration, optionally the EC.sub.70 concentration optionally the EC.sub.100 concentration, in blood and/or in a tissue for neutralization of the enzymatic activity of CD73 for a period of at least about 1 week, about 2 weeks, or about one month, following administration of the antibody.
[0249] Prior to or during a course of treatment with an anti-CD73 antibody of the disclosure, presence or levels or CD73-expressing cells, adenosine, ADP and/or AMP levels can be assessed within and/or adjacent to a patient's tumor to assess whether the patient is suitable for treatment (e.g. to predict whether the patient is likely to respond to treatment). Increased presence or levels or CD73-expressing cells, levels of adenosine, ADP and/or AMP may indicate an individual is suitable for treatment with (e.g. likely to benefit from) an anti-CD73 antibody of the disclosure (including but not limited to an antibody that inhibits substrate-bound CD73).
[0250] Prior to or during a course of treatment with an anti-CD73 antibody of the disclosure, adenosine, ADP and/or AMP levels can also be assessed within and/or adjacent to a patient's tumor to assess whether the patient is benefitting from treatment with an anti-CD73 antibody. Decreased levels of adenosine, ADP and/or AMP compared following an administration (or dosing of antibody) compared to levels prior to treatment (or dosing of antibody) may indicate an individual is benefitting from treatment with an anti-CD73 antibody of the disclosure (including but not limited to an antibody that inhibits substrate-bound CD73). Optionally, if a patient is benefitting from treatment with the anti-CD73 antibody, methods can further comprise administering a further dose of the anti-CD73 antibody to the patient (e.g., continuing treatment).
[0251] In one embodiment, assessing adenosine, ADP and/or AMP levels within and/or adjacent to a patient's tumor the tissue sample comprises obtaining from the patient a biological sample of a human tissue selected from the group consisting of tissue from a cancer patient, e.g., cancer tissue, tissue proximal to or at the periphery of a cancer, cancer adjacent tissue, adjacent non-tumorous tissue or normal adjacent tissue, and detecting adenosine, ADP and/or AMP levels within the tissue. The levels from the patient can be comparing the level to a reference level, e.g. corresponding to a healthy individual.
[0252] In one embodiment, the disclosure provides a method for the treatment or prevention of a cancer in an individual in need thereof, the method comprising:
[0253] a) detecting CD73-expressing cells (or adenosine, ADP and/or AMP) the tumor environment, optionally within the tumor and/or within adjacent tissue, and
[0254] b) upon a determination that tumor environment comprises CD73-expressing cells (or adenosine, ADP and/or AMP), optionally at a level that is increased compared to a reference level, administering to the individual an anti-CD73 antibody. Optionally, detecting CD73-expressing cells (or adenosine, ADP and/or AMP) within the tumor environment comprises obtaining from the individual a biological sample that comprises cancer tissue and/or tissue proximal to or at the periphery of a cancer (e.g., cancer adjacent tissue, adjacent non-tumorous tissue or normal adjacent tissue), and detecting levels of CD73-expressing cells (or adenosine, ADP and/or AMP). CD73-expressing cells may comprise, for example, tumor cells, CD4 T cells, CD8 T cells, B cells.
[0255] A patient having a cancer can be treated with the anti-CD73 antibody with our without a prior detection step to assess expression of CD73 on cells in the tumor microenvironment (e.g. on tumor cells, CD4 T cells, CD8 T cells, B cells). Optionally, the treatment methods can comprises a step of detecting a CD73 nucleic acid or polypeptide in a biological sample of a tumor from an individual (e.g., in cancer tissue, tissue proximal to or at the periphery of a cancer, cancer adjacent tissue, adjacent non-tumorous tissue or normal adjacent tissue). A determination that a biological sample comprises cells expressing CD73 (e.g. prominently expressing; expressing CD73 at a high level, high intensity of staining with an anti-CD73 antibody, compared to a reference) indicates that the patient has a cancer that may have a strong benefit from treatment with an agent that inhibits CD73. In one embodiment, the method comprises determining the level of expression of a CD73 nucleic acid or polypeptide in a biological sample and comparing the level to a reference level corresponding to a healthy individual. A determination that a biological sample comprises cells expressing CD73 nucleic acid or polypeptide at a level that is increased compared to the reference level indicates that the patient has a cancer that can be treated with an anti-CD73 antibody of the disclosure. Optionally, detecting a CD73 polypeptide in a biological sample comprises detecting CD73 polypeptide expressed on the surface of a malignant cell, a CD4 T cell, CD8 T cell, B cell. In one embodiment, a determination that a biological sample comprises cells that prominently expresses CD73 nucleic acid or polypeptide indicates that the patients has a cancer that can be treated with an anti-CD73 antibody of the disclosure. Prominently expressed, when referring to a CD73 polypeptide, means that the CD73 polypeptide is expressed in a substantial number of cells taken from a given patient. While the definition of the term prominently expressed is not bound by a precise percentage value, in some examples a receptor said to be prominently expressed will be present on at least 10%, 20% 30%, 40%, 50 %, 60%, 70%, 80%, or more of the tumor cells taken from a patient.
[0256] Determining whether an individual has a cancer characterized by cells that express a CD73 polypeptide can for example comprise obtaining a biological sample (e.g. by performing a biopsy) from the individual that comprises cells from the cancer environment (e.g. tumor or tumor adjacent tissue), bringing said cells into contact with an antibody that binds an CD73 polypeptide, and detecting whether the cells express CD73 on their surface. Optionally, determining whether an individual has cells that express CD73 comprises conducting an immunohistochemistry assay.
[0257] In one embodiment, the disclosure provides a method for the treatment or prevention of a cancer in an individual in need thereof, the method comprising:
[0258] a) determining the CD73 polypeptide status of cells within the tumor environment, optionally within the tumor and/or within adjacent tissue, and
[0259] b) upon a determination that tumor environment comprises cells that express CD73 polypeptide, optionally at a level that is increased compared to a reference level, administering to the individual an anti-CD73 antibody. In one embodiment, the cells are tumor cells. In another embodiment, the cells within the tumor environment, tumor and/or adjacent tissue are non-malignant immune cells, e.g., T cells. Optionally, determining the CD73 polypeptide status within the tumor environment comprises obtaining from the individual a biological sample that comprises cancer tissue and/or tissue proximal to or at the periphery of a cancer (e.g., cancer adjacent tissue, adjacent non-tumorous tissue or normal adjacent tissue), bringing said cells into contact with an antibody that binds a CD73 polypeptide, and detecting cells that express CD73.
[0260] The antibody compositions may be used in as monotherapy or combined treatments with one or more other therapeutic agents, including agents normally utilized for the particular therapeutic purpose for which the antibody is being administered. The additional therapeutic agent will normally be administered in amounts and treatment regimens typically used for that agent in a monotherapy for the particular disease or condition being treated. Such therapeutic agents include, but are not limited to anti-cancer agents and chemotherapeutic agents.
[0261] In one embodiment, the second or additional second therapeutic agent is an antibody or other Fc domain-containing protein capable of inducing ADCC toward a cell to which it is bound, e.g. via CD16 expressed by an NK cell. Typically, such antibody or other protein will comprise a domain that binds to an antigen of interest, e.g. an antigen present on a tumor cell (tumor antigen), and an Fc domain or portion thereof, and will exhibit binding to the antigen via the antigen binding domain and to Fc receptors (e.g. CD16) via the Fc domain. In one embodiment, its ADCC activity will be mediated at least in part by CD16. In one embodiment, the additional therapeutic agent is an antibody having a native or modified human Fc domain, for example a Fc domain from a human IgG1 or IgG3 antibody. The term antibody-dependent cell-mediated cytotoxicity or ADCC is a term well understood in the art, and refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors (FcRs) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. Non-specific cytotoxic cells that mediate ADCC include natural killer (NK) cells, macrophages, monocytes, neutrophils, and eosinophils. The term ADCC-inducing antibody refers to an antibody that demonstrates ADCC as measured by assay(s) known to those of skill in the art. Such activity is typically characterized by the binding of the Fc region with various FcRs. Without being limited by any particular mechanism, those of skill in the art will recognize that the ability of an antibody to demonstrate ADCC can be, for example, by virtue of it subclass (such as IgG1 or IgG3), by mutations introduced into the Fc region, or by virtue of modifications to the carbohydrate patterns in the Fc region of the antibody.
[0262] In one embodiment, the second or additional second therapeutic agent is an agent (e.g., an antibody) that inhibits CTLA-4 or the PD-1 axis (i.e. inhibits PD-1 or PD-L1). Antibodies that bind CTLA-4, PD1 or PD-L1 can be used, for example, at the exemplary the doses and/or frequencies that such agents are used as monotherapy, e.g., as described below.
[0263] PD-1 is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS and BTLA. PD-1 is expressed on activated B cells, T cells, and myeloid cells Okazaki et al. (2002) Curr. Opin. Immunol. 14: 391779-82; Bennett et al. (2003) J Immunol 170:711-8). Two ligands for PD-1 have been identified, PD-L1 and PD-L2, that have been shown to downregulate T cell activation upon binding to PD-1 (Freeman et al. (2000) J Exp Med 192:1027-34; Latchman et al. (2001) Nat Immunol 2:261-8; Carter et al. (2002) Eur J Immunol 32:634-43). PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med. 8:787-9). The interaction between PD-1 and PD-L1 results in a decrease in tumor infiltrating lymphocytes, a decrease in T-cell receptor mediated proliferation, and immune evasion by the cancerous cells. Immune suppression can be reversed by inhibiting the local interaction of PD-1 with PD-L1, and the effect is additive when the interaction of PD-1 with PD-L2 is blocked as well. Blockade of PD-1 can advantageously involve use of an antibody that prevents PD-L1-induced PD-1 signalling, e.g. by blocking the interaction with its natural ligand PD-L1. In one aspect the antibody binds PD-1 (an anti-PD-1 antibody); such antibody may block the interaction between PD-1 and PD-L1 and/or between PD-1 and PD-L2. In another aspect the antibody binds PD-L1 (an anti-PD-L1 antibody) and blocks the interaction between PD-1 and PD-L1.
[0264] There are currently at least six agents blocking the PD-1/PD-L1 pathway that are marketed or in clinical evaluation, any of these may be useful in combination with the anti-CD73 antibodies of the disclosure. One agent is BMS-936558 (Nivolumab/ONO-4538, Bristol-Myers Squibb; formerly MDX-1106). Nivolumab, (Trade name Opdivo) is an FDA-approved fully human IgG4 anti-PD-L1 mAb that inhibits the binding of the PD-L1 ligand to both PD-1 and CD80 and is described as antibody 5C4 in WO 2006/121168, the disclosure of which is incorporated herein by reference. For melanoma patients, the most significant OR was observed at a dose of 3 mg/kg, while for other cancer types it was at 10 mg/kg. Nivolumab is generally dosed at 10 mg/kg every 3 weeks until cancer progression.
[0265] MK-3475 (human IgG4 anti-PD1 mAb from Merck), also referred to as lambrolizumab or pembrolizumab (Trade name Keytruda) has been approved by the FDA for the treatment of melanoma and is being tested in other cancers. Pembrolizumab was tested at 2 mg/kg or 10 mg/kg every 2 or 3 weeks until disease progression. DNA constructs encoding the variable regions of the heavy and light chains of the humanized antibodies h409All have been deposited with the American Type Culture Collection Patent Depository (10801 University Blvd., Manassas, Va.). The plasmid containing the DNA encoding the heavy chain of h409A-I 1 was deposited on Jun. 9, 2008 and identified as 081469_SPD-H and the plasmid containing the DNA encoding the light chain of h409AI 1 was deposited on Jun. 9, 2008 and identified as 0801470 SPD-L-I 1.
[0266] MPDL3280A/RG7446 (anti-PD-L1 from Roche/Genentech) is a human anti-PD-L1 mAb that contains an engineered Fc domain designed to optimize efficacy and safety by minimizing FcR binding and consequential antibody-dependent cellular cytotoxicity (ADCC). Doses of 51, 10, 15, and 25 mg/kg MPDL3280A were administered every 3 weeks for up to 1 year. In phase 3 trial, MPDL3280A is administered at 1200 mg by intravenous infusion every three weeks in NSCLC.
[0267] AMP-224 (Amplimmune and GSK) is an immunoadhesin comprising a PD-L2 extracellular domain fused to an Fc domain.
[0268] Pidlizumab (CT-011; CureTech) (humanized IgG1 anti-PD1 mAb from CureTech/Teva), Pidlizumab (CT-011; CureTech) (see e.g., WO2009/101611) Thirty patients with rituximab-sensitive relapsed FL were treated with 3 mg/kg intravenous CT-011 every 4 weeks for 4 infusions in combination with rituximab dosed at 375 mg/m2 weekly for 4 weeks, starting 2 weeks after the first infusion of CT-011.
[0269] Further known PD-1 antibodies and other PD-1 inhibitors include AMP-224 (a B7-DC/IgG1 fusion protein licensed to GSK), AMP-514 described in WO 2012/145493, antibody MEDI-4736 (an anti-PD-L1 developed by AstraZeneca/Medimmune) described in WO2011/066389 and US2013/034559, antibody YW243.55.S70 (an anti-PD-L1) described in WO2010/077634, MDX-1105, also known as BMS-936559, is an anti-PD-L1 antibody developed by Bristol-Myers Squibb described in WO2007/005874, and antibodies and inhibitors described in WO2006/121168, WO2009/014708, WO2009/114335 and WO2013/019906, the disclosures of which are hereby incorporated by reference. Further examples of anti-PD1 antibodies are disclosed in WO2015/085847 (Shanghai Hengrui Pharmaceutical Co. Ltd.), for example antibodies having light chain variable domain CDR1, 2 and 3 of SEQ ID NO: 6, SEQ ID NO: 7 and/or SEQ ID NO: 8, respectively, and antibody heavy chain variable domain CDR1, 2 and 3 of SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 5, respectively, wherein the SEQ ID NO references are the numbering according to WO2015/085847, the disclosure of which is incorporated herein by reference. Antibodies that compete with any of these antibodies for binding to PD-1 or PD-L1 also can be used.
[0270] CTLA-4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152 is another inhibitory member of the CD28 family of receptors, and is expressed on T cells. Antibodies that bind and inhibit CTLA-4 are known in the art. In one example, the antibody is ipilimumab (trade name Yervoy, Bristol-Myers Squibb), a human IgG antibody. An exemplary administration regimen for Yervoy is 3 mg/kg invtravenously over 90 minutes every three weeks. In one example, the antibody used in combination with the anti-CD73 antibodies of the disclosure is an antibody that competes with ipilimumab for binding to CTLA-4.
[0271] In the treatment methods, the CD73-binding compound and the second therapeutic agent can be administered separately, together or sequentially, or in a cocktail. In some embodiments, the antigen-binding compound is administered prior to the administration of the second therapeutic agent. For example, the CD73-binding compound can be administered approximately 0 to 30 days prior to the administration of the second therapeutic agent. In some embodiments, an CD73-binding compound is administered from about 30 minutes to about 2 weeks, from about 30 minutes to about 1 week, from about 1 hour to about 2 hours, from about 2 hours to about 4 hours, from about 4 hours to about 6 hours, from about 6 hours to about 8 hours, from about 8 hours to 1 day, or from about 1 to 5 days prior to the administration of the second therapeutic agent. In some embodiments, a CD73-binding compound is administered concurrently with the administration of the therapeutic agents. In some embodiments, a CD73-binding compound is administered after the administration of the second therapeutic agent. For example, a CD73-binding compound can be administered approximately 0 to 30 days after the administration of the second therapeutic agent. In some embodiments, a CD73-binding compound is administered from about 30 minutes to about 2 weeks, from about 30 minutes to about 1 week, from about 1 hour to about 2 hours, from about 2 hours to about 4 hours, from about 4 hours to about 6 hours, from about 6 hours to about 8 hours, from about 8 hours to 1 day, or from about 1 to 5 days after the administration of the second therapeutic agent.
Examples
Example 1: Generation of New Anti-huCD73 Antibodies
[0272] To obtain anti-human CD73 antibodies, Balb/c mice were immunized with a recombinant human CD73-His extracellular domain recombinant protein (cloned and produced at Innate Pharma as described below). Mice received one primo-immunization with an emulsion of 50 g CD73 protein and Complete Freund Adjuvant, intraperitoneally, a 2nd immunization with an emulsion of 50 g CD73 protein and Incomplete Freund Adjuvant, intraperitoneally, and finally a boost with 10 g CD73 protein, intravenously. Immune spleen cells were fused 3 days after the boost with X63.Ag8.653 immortalized B cells, and cultured in the presence of irradiated spleen cells. Hydridomas were plated in semi-solid methylcellulose-containing medium and growing clones were picked using a clonepix 2 apparatus (Molecular Devices).
[0273] Primary screen: Supernatant (SN) of growing clones were tested in a primary screen by flow cytometry using parental and huCD73-, cynoCD73- or moCD73-expressing recombinant host cell lines. HuCD73- and cynoCD73-expressing recombinant host cells were stained with 0.35 M and 0.035 M CFSE, respectively. For the flow cytometry screening, all cells were equally mixed and the presence of reacting antibodies in supernanants was revealed by Goat anti-mouse polyclonal antibody (pAb) labeled with PE. 47 antibodies were found to bind both human and cynomolgus CD73. All antibodies that bound huCD73 and cynoCD73 were produced as chimeric human IgG1 antibodies with a heavy chain N297Q (Kabat EU numbering) mutation which results in lack of N-linked glycosylation and substantial lack of binding to Fc receptors.
[0274] Secondary screen: this informative screen (see Example 2) was done on recombinant CD73 protein to evaluate the CD73 enzymatic activity blockade properties of the 47-selected antibodies. 35/47 antibodies appear to completely or partially block CD73 activity.
[0275] Cloning, production and purification of recombinant huCD73
[0276] Molecular Biology
[0277] The huCD73 protein was cloned from MIAPACA-2 cDNA using the following primers TACGACTCACAAGCTTGCCGCCACCATGTGTCCCCGAGCCGCGCG (SEQ ID NO: 45) (Forward) and CCGCCCCGACTCTAGAtcaGTGATGGTGATGATGGTGcttgatccgaccttcaactg SEQ ID NO: 46) (Reverse). The purified PCR product was then cloned into an expression vector using the InFusion cloning system. A 6His tag was added in the C-terminal part of the protein for the purification step.
TABLE-US-00007 AminoacidsequenceoftheclonedhuCD73: (SEQIDNO:2) MCPRAARAPATLLLALGAVLWPAAGA WELTILHTNDVHSRLEQTSEDSSKCV NASRCMGGVARLFTKVQQIRRAEPNV LLLDAGDQYQGTIWFTVYKGAEVAHF MNALRYDAMALGNHEFDNGVEGLIEP LLKEAKFPILSANIKAKGPLASQISG LYLPYKVLPVGDEVVGIVGYTSKETP FLSNPGTNLVFEDEITALQPEVDKLK TLNVNKIIALGHSGFEMDKLIAQKVR VDVVVGGHSNTFLYTGNPPSKEVPAG KYPFIVTSDDGRKVPVVQAYAFGKYL GYLKIEFDERGNVISSHGNPILLNSS IPEDPSIKADINKWRIKLDNYSTQEL GKTIVYLDGSSQSCRFRECNMGNLIC DAMINNNLRHTDEMFWNHVSMCILNG GGIRSPIDERNNGTITWENLAAVLPF GGTFDLVQLKGSTLKKAFEHSVHRYG QSTGEFLQVGGIHVVYDLSRKPGDRV VKLDVLCTKCRVPSYDPLKMDEVYKV ILPNFLANGGDGFQMIKDELLRHDSG DQDINVVSTYISKMKVIYPAVEGRIK HHHHHH
[0278] Expression and Purification of the huCD73 Proteins
[0279] After validation of the sequence cloned, cells were nucleofected and the producing pool was then sub-cloned to obtain a cell clone producing the huCD73 protein. Supernatant from the huCD73 clone grown in roller was harvested and purified using Ni-NTA column and eluted using 250 mM imidazole. The purified proteins were then loaded onto a S200 size exclusion chromatography column. The purified protein corresponding to a dimer was formulated in a Tris 20 mM pH 7.5, NaCl 120 mM and CaCl2 4 mM buffer for enzyme activity assays, while formulation buffer is supplemented with 20% glycerol.
Example 2: Evaluation of Soluble CD73 Blockade
[0280] The ability of anti-CD73 antibodies to block enzymatic activity of CD73 was evaluated as described in Sachsenmeier et al. (J Biomol Screening, 2012). Briefly, 500 ng/ml of recombinant human CD73-his were incubated in white 96W flat bottom microplates in presence of dose-range of anti-CD73 or isotype control Abs. Plates were incubated for 1 h at 37 C. 12.5 M ATP and 125 M AMP were added to each well and plates are incubated at 37 C. for 30 supplemental minutes. Luciferase/luciferin-containing Cell Titer Glo (Promega) is added into wells, plates were incubated for 5 minutes at RT in the dark and emitted light is measured using an Enspire apparatus (Perkin Elmer).
[0281] Excess of AMP is known to block ATP-dependent luciferase activity. Addition of CD73 that cleaves AMP into adenosine+inorganic phosphate restores luciferase activity and light emission. Thus, antibodies that block enzymatic activity of CD73 will diminish light emission.
[0282] The percentage of enzyme inhibition is evaluated as described below: [0283] Conditions: [0284] ATP+AMP: maximal luciferase inhibition (100%) [0285] ATP+AMP+CD73: no luciferase inhibition (0%) [0286] Formula:
[0287] 35 antibodies obtained in Example 1, as well as reference mAbs 7G2, 4G4 and 1E9, were all found to inhibit CD73 activity using this experimental setting.
[0288] Considering the mixed results reported with reference antibodies, we considered whether CD73 blockade may arise from cross-linking of CD73 dimers by bivalent antibodies rather than true blockade of the enzymatic site. That is, antibodies may be causing oligomeric complexes of the CD73 dimers since bivalently binding mAbs may bind to two different CD73 homodimers, in turn leading to larger protein complexes). We then tested this possibility by performing blocking assays at high ratios of antibody:CD73 dimers. In this setting the mAbs are in large excess and induction of oligomeric complexes may occur, permitting true CD73 functional blockade to be observed. In this setting, practically all antibodies, including the reference mAbs 4G4 and 1E9, did not inhibit the enzymatic activity of CD73.
[0289] Antibodies 11E1, 8C7, 3C12 and 6E1 functionally blocked CD73 at all concentrations tested. Exemplary results are shown in
[0290] The EC.sub.50 values for CD73 blockade are shown in the table below.
TABLE-US-00008 Ab EC50 (g/ml) 1E11 0.41 6E1 0.33 8C7 1.29 3C12 0.41
Example 3: Ab Titration on Rec CD73 Protein by ELISA
[0291] Antibodies that functionally blocked soluble recombinant CD73 were more fully characterized for binding to soluble recombinant human CD73.
[0292] 5 g/ml of recombinant human CD73 protein (IPH, isoform E6) was coated on MaxiSorp ELISA plates (Nunc) in PBS, overnight at 4 C. Plates were washed 5 times in washing buffer (PBS, 0.05% Tween20) and unspecific sites were saturated by adding 200 l/w TBS starting block buffer (Thermo Ficher). Dose-range of anti-CD73 antibodies were incubated for 2 h at 37 C. Plates were washed 5 times in washing buffer and HRP-coupled goat anti-human or goat anti-mouse IgG Fc fragment secondary antibody (Bethyl, 1/50000) was added for 1 hr at RT to detect bound anti-CD73 antibodies. Plates were washed 5 times in washing buffer and bound secondary antibody is revealed by adding TMB (HRP substrate) and incubating plates for 5 to 10 min at RT in the dark. The enzymatic reaction was stopped by adding HCl 1M and O.D. was measured at 450 nm. Optical density vs. anti-CD73 Ab concentration was plotted on graphs and EC50 is calculated using GraphPad Prism software.
[0293] Results are shown in
TABLE-US-00009 Antibody EC50 (g/ml) 11E1 0.012 6E1 0.014 8C7 0.009 3C12 0.014 7G2 0.037
Example 4: Flow Cytometry Titration
[0294] Human-, cynomolgus- and mouse-CD73-expressing recombinant host cell lines or human MDA-MB-231 breast adenocarcinoma that endogenously expresses CD73 were used to evaluate ability of anti-CD73 antibodies to bind human CD73 and to cross-react on cynomolgus and/or mouse CD73. MDA-MB-231 cells are available from ATCC (reference HTB-26). 10.sup.5 cells resuspended in PBS/0.2% BSA/0.02% NaN3 (named staining buffer) are distributed into round bottom 96W-microplates. Dose-range of anti-CD73 antibodies was added to the plates and cells are incubated for 45 min at 4 C. Cells were washed three times in staining buffer by spinning plates at 400 g for 3 min at 4 C. PE-coupled goat anti-mouse or goat anti-human IgG Fc fragment secondary antibodies (Beckman Coulter) diluted in staining buffer were added to the cells and plates are incubated for 30 additional minutes at 4 C. Cells were washed three times as described above and analyzed on an Accury C6 flow cytometer equipped with an HTFC plate reader.
[0295] Median of fluorescence vs. antibodies concentration was plotted on graphs and EC50 is calculated using Graph Pad Prism program.
[0296] Results are shown in
[0297] Experiments were repeated using human MDA-MB-231 breast adenocarcinoma cells that endogenously expresses CD73. Again mAbs 11E1, 8C7, 3C12 and 6E1 bind with excellent affinity while mAbs 7G2 and 1E9 show poor binding. Results on MDA-MB-231 cells are shown in
[0298] It is possible that 7G2 and 1E9 bind to an epitope on CD73 that is presented differently in recombinant CD73 and CD73 on the surface of the CD73-expressing cells, including notably human tumor cells that endogenously expresses CD73, resulting in mAbs that bind well to recombinant CD73 (e.g. used in immunization) but not to cell surface CD73. The epitopes bound by 11E1, 8C7, 3C12 and 6E1 on the other hand, remains present on cell surface CD73.
[0299] Experiments were then repeated using human MDA-MB-231 breast adenocarcinoma cells that endogenously expresses CD73. Cells were pre-incubated at 37 C. for 30 minutes in the presence or not of 200 M adenosine 5-(,-methylene)diphosphate (APCP), followed by addition of antibodies. APCP is an analog of ADP and binds irreversibly to the active site of CD73. When bound by APCP, CD73 changes conformation from an open conformation to a closed conformation. mAbs 11E1, 8C7, 3C12 and 6E1 bound MDA-MB-231 cells with good affinity both in the presence and absence of APCP. In the presence of APCP, the EC50 was similar to that observed in the absence of APCP. The plateau for maximal binding of 11E1, 8C7, 3C12 and 6E1 was higher in the absence of APCP than in the presence of APCP, while the inverse was true for AD2. EC50 figures are shown in the table below.
TABLE-US-00010 EC50 (ng/ml) Antibody Medium APCP 11E1 61.11 37.5 3C12 57.22 43.11 6E1 58.39 39.48 8C7 90.29 143.4 AD2 62.89 95.92
Example 5: Cellular CD73 Activity Blockade
[0300] Part A: Blockade in MDA-MB-231 Tumor Cells
[0301] The ability of anti-CD73 antibodies to neutralize the 5-ectonucletidase enzymatic activity of cell-surface expressed CD73 was evaluated. The MDA-MB-231 tumor cell line was used a model tumor cell line that expresses CD73.
[0302] All reagents used in the experiment detailed below were diluted in TBS pH7.5 (Tris 20 mM pH7.5, NaCl 150 mM). MDA-MB-231 cell line is recovered in PBS-EDTA and washed twice in TBS pH7.5. 0.5 to 110.sup.5 cells were plated in flat-bottom 96 well plates in presence of dose-range of anti-CD73 antibodies and incubated for 2 hours at 4 C. 200 mM AMP was added to the cells for a 30 minutes incubation period at 4 C. (to avoid CD73 down-modulation). Plates were then centrifuged and 50 l supernatant are transferred in flat bottom 96 well culture plate. Free phosphate produced by the hydrolysis of AMP into adenosine was quantified using the Malachite Green Phosphate Detection Kit (R&D Systems) and following TDS provided by the manufacturer. Phosphate concentration vs. anti-CD73 Ab concentration was plotted in graphs and EC50 is calculated using GraphPad Prism software.
[0303] Results are shown in
TABLE-US-00011 Ab EC50 (g/ml) 1E11 0.195 6E1 0.209 8C7 0.319 3C12 0.210
[0304] Each antibody achieved a decrease of more than 75%, or more than 80% of the enzymatic activity. Antibody 7G2, consistent with poor binding to cellular CD73 (see Example 4), did not neutralize enzymatic activity of cellular CD73. Antibody 7G2, consistent with its limited ability to bind cell surface CD73, did not neutralize CD73 enzymatic activity at any concentration, and only elicited a slight partial inhibition at the highest concentrations tested.
[0305] In each case, for the non-internalizing antibodies 1E11, 6E1, 8C7 and 3C12, the EC.sub.50 values required for neutralization of the enzymatic activity of cellular CD73 in MDA-MB-231 cell were several-fold higher than the EC.sub.50 values required for binding to cell surface CD73 in MDA-MB-231 cells.
[0306] Part B: Blockade in MDA-MB-231, H292 and A375 Tumor Cells
[0307] The ability of anti-CD73 antibodies to neutralize the 5-ectonucletidase enzymatic activity of cell-surface expressed CD73 was evaluated using the same assay as above, this time in multiple experiments using three tumor cell lines that express CD73 lines in parallel: the MDA-MB-231 breast adenocarcinoma tumor cell line, the H292 lung cancer cell line (see, e.g., ATCC reference CRL-1848), and the A375 melanoma cancer cell line (see, e.g., ATCC reference CRL-1619). The effective concentrations required for neutralization (ECs, e.g. EC50, EC70, EC100) shown in the table below were calculated as a mean from repeated experiments on the three different CD73-expressing cell types.
TABLE-US-00012 Antibody 1E11 3C12 6E1 8C7 N = 8 8 8 2 EC.sub.50 (g/ml) 0.10 0.14 0.13 0.21 EC.sub.70 (g/ml) 0.15 0.18 0.19 0.46 EC.sub.100 (g/ml) 0.52 0.30 0.68 0.72
Example 6: Flow Cytometry Competition Study
[0308] A human CD73-expressing recombinant host cell line was used to evaluate competition between our candidates and other commercial anti-CD73 antibodies. 10.sup.5 cells resuspended in staining buffer were distributed into round bottom 96W-microplates. A fixed dose of test antibodies (1 g/ml) is added to the cells in presence or not of a dose-range of reference mouse anti-human CD73 antibodies. Cells were incubated for 45 minutes at 4 C. then washed three times as described above. PE-coupled or goat anti-human IgG Fc fragment secondary antibodies (Beckman Coulter) diluted in staining buffer were added to the cells and plates are incubated for 30 additional minutes at 4 C. Cells were washed three times and analyzed on an Accury C6 flow cytometer equipped with an HTFC plate reader.
[0309] Median of fluorescence vs. antibodies concentration was plotted. To study epitopes of CD73-neutralizing antibodies, the ability of known antibodies to block the binding of new antibodies to the cell membrane CD73 was evaluated as competition between antibodies. Reference antibody 7G2, shown in Example 2 to have the ability to neutralize CD73 without dependence upon induction of oligomerization, but which does not bind or neutralize CD73 in cellular assays, was tested with new antibody candidates. Neither antibodies 11E1, 8C7, 3C12 nor 6E1 competed with 7G2 for binding to CD73, showing that 7G2 binds to an area on CD73 distinct from that of the new antibodies.
Example 7: CD73 Down-Modulation
[0310] Human MDA-MB-231 breast adenocarcinoma cell line that endogenously expresses CD73 was used to evaluate the capacity of anti-CD73 antibodies to down regulate CD73 expression. 10.sup.5 cells resuspended in staining buffer were distributed into flat bottom 96W-microplates. 10 g/ml of anti-CD73 antibodies were added to the cells and plates are incubated at 4 C. or 37 C. for a time course. At T=10 min, 30 min, 1 h, 2 h, 3 h and 4 h, cells were recovered using PSB/2 mM EDTA, washed three times in staining buffer as prior described and incubated at 4 C. until end of the time course. 10 g/ml of a AlexaFLuor 647-coupled non-competing anti-CD73 antibody were added to the cells and plates are incubated for 30 min at 4 C. Cells were washed three times and analyzed on an Accury C6 flow cytometer equipped with an HTFC plate reader.
[0311] Percentage of Expression Vs. Incubation Time is Plotted on Graphs.
[0312] Antibodies were evaluated for their ability to cause down-modulation of CD73 expression on cells, and compared to reference mAbs AD2, 7G2 and 1E9. Each of AD2, 7G2 and 1E9 caused down-modulation of CD73, suggesting that these mAbs may be causing clustering and internalization of CD73. AD2 caused a decrease of well over 20% while 7G2 and 1E9 each caused a decrease in over 50% of receptor at the cell surface. Neither antibody 11E1, 8C7, 3C12 or 6E1 caused a decrease in CD73 at the cell surface. Results are shown in
Example 8: Epitope Mapping
[0313] In order to define the epitopes of anti-CD73 antibodies, we designed CD73 mutants defined by substitutions of amino acids exposed at the molecular surface over the surface of CD73. Mutants were transfected in Hek-293T cells, as shown in the table below. The targeted amino acid mutations in the table 1 below are shown using numbering of SEQ ID NO: 1.
TABLE-US-00013 TABLE 1 Mutant Substitutions 1 E46A S49A V52A N53A R56L M58V 2 Q70S R73A A74E A107I R109G 3 A99S E129A K133A E134N A135S 4 K145A K147A S152H S155A Y161S E203A K206A 5 P165S D168G N211A E296A R297A 6 K179A E196A I197S T198A E224A M225S Q231A 7 K262A F265S I266A K2740 I292A S302A H304Y 8 P318A S319A K321A N325A K3260 9 Y345A D347A S349A S352A D399A R401A 10 D460A L461S S462A R463A G466W D467N K471A 11 D473A K478A R480A S483A D485A K488E E491K 12 N503A Q509A K512S D513A 13 R354A R395A 0444A T446A 14 D332A N333A T336A E409A 15 H375A E378A R517A S520A D522A 16 A99S E129A K133A E134N A135S K136A L157S L159S K162A 17 A99S E129A K133A E134N A135S K136A 18 A99S E129A K133A E134N A135S K136A L157S L159S K162A A107S R109A 19 A99S E129A K133A E134N A135S K136A L157S L159S K162A S152A S155A 20 A107S R109A K136A K162A P165A D111A 21 A99S E129A K133A E134N A135S K97A E125A Q153A 22 A99S E129A K133A E134N A135S K97A E125A K330A
Generation of Mutants
[0314] CD73 mutants were generated by PCR. The sequences amplified were run on agarose gel and purified using the Macherey Nagel PCR Clean-Up Gel Extraction kit (reference 740609). The purified PCR products generated for each mutant were then ligated into an expression vector, with the ClonTech InFusion system. The vectors containing the mutated sequences were prepared as Miniprep and sequenced. After sequencing, the vectors containing the mutated sequences were prepared as Midiprep using the Promega PureYield Plasmid Midiprep System. HEK293T cells were grown in DMEM medium (Invitrogen), transfected with vectors using Invitrogen's Lipofectamine 2000 and incubated at 37 C. in a CO2 incubator for 24 hours prior to testing for transgene expression.
Flow Cytometry Analysis of Anti-CD73 Binding to the HEK293T Transfected Cells
[0315] Anti-CD73 antibodies were tested for their binding to each of mutants 1-15 by flow cytometry. A first experiment was performed to determine antibodies that lose their binding to one or several mutants at one concentration. To confirm a loss of binding, titration of antibodies was done on antibodies for which binding seemed to be affected by the CD73 mutations (1-0.1-0.01-0.001 g/ml). Antibodies 11E1, 8C7, 3C12 and 6E1 all lost binding to mutant 3 of CD73, but not to any other mutant. Mutant 3 contains amino acid substitutions at residues A99, E129, K133, E134, and A135, indicating that one or more, or all of, the residues of the mutant are important to the core epitope of these antibodies. Antibody AD2 that causes clustering and internalization of CD73 did not lose binding to mutant 3; AD2 instead lost binding to mutant 2 having substitutions at residues Q70, R73, A74, A107 and R109. Exemplary results for antibody 3C12 and AD2 are shown in
[0316] When bound by active site ligands as illustrated by the irreversibly ADP analog binder APCP, CD73 changes conformation from an open conformation to a closed conformation. As shown in Example 4, mAbs 11E1, 8C7, 3C12 and 6E1 bound cellular CD73 both in the presence and absence of APCP, indicating that the epitope of these antibodies remains present on CD73 when the active site is occupied.
[0317] Several additional mutants were constructed with substitutions in the area adjacent to residues mutated in mutant 3. The mutants included notably mutated residues K136, A97, E125, Q153, and K330. A second series of binding assays was then conducted using the same methods as above for mutants 1-15, to assess binding of the antibodies 11E1, 3C12 and 6E1 to mutants 16-22 (see Table 1 above). Each antibody lost binding to mutants 16-22. While mutant 3 had a strong decrease in binding for the antibodies, when K136 was additionally mutated (in mutants 16-20), the resulting mutants had complete loss of binding. Thus, residue K136 is important to the core epitope of the antibodies. Furthermore, mutants 21 and 22 combined the mutations of mutant 3 with additional mutations at A97, E125, Q153, and K330. Mutants 21 and 22 had substitutions at residues A97 and E125, together with substitutions as Q153 or K330, which resulted in complete loss of binding to the antibodies, indicating that these residues are also within or proximal to epitope of these antibodies.
Example 9: CD73 Binding Affinity by Surface Plasmon Resonance (SPR)
Biacore T100 General Procedure and Reagents
[0318] SPR measurements were performed on a Biacore T100 apparatus (Biacore GE Healthcare) at 25 C. In all Biacore experiments HBS-EP+(Biacore GE Healthcare) and NaOH 10 mM served as running buffer and regeneration buffer respectively. Sensorgrams were analyzed with Biacore T100 Evaluation software. Protein-A was purchase from (GE Healthcare). Human soluble dimeric CD73 proteins were cloned, produced and purified at Innate Pharma.
Immobilization of Protein-A
[0319] Protein-A proteins were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CMS. The chip surface was activated with EDC/NHS (N-ethyl-N-(3-dimethylaminopropyl) carbodiimide hydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare). Protein-A was diluted to 10 g/ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2000 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
Affinity Study
[0320] Affinity study was carried out according to a standard Capture-Kinetic protocol recommended by the manufacturer (Biacore GE Healthcare kinetic wizard). Serial dilutions of human recombinant soluble dimeric CD73 proteins, ranging from 1.23 to 300 nM were sequentially injected over the captured anti-CD73 antibodies and allowed to dissociate for 10 min before regeneration. The entire sensorgram sets were fitted using the 1:1 kinetic binding model. Bivalent affinities and kinetic association and dissociation rate constants are shown below in Table 2 below.
TABLE-US-00014 TABLE 2 CD73 Ab KD (nM) 1E11 0.822 3C12 0.682 6E1 0.819
[0321] All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference in their entirety and to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein (to the maximum extent permitted by law), regardless of any separately provided incorporation of particular documents made elsewhere herein.
[0322] The use of the terms a and an and the and similar references are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context.
[0323] Unless otherwise stated, all exact values provided herein are representative of corresponding approximate values (e.g., all exact exemplary values provided with respect to a particular factor or measurement can be considered to also provide a corresponding approximate measurement, modified by about, where appropriate).
[0324] The description herein of any aspect or embodiment herein using terms such as comprising, having, including, or containing with reference to an element or elements is intended to provide support for a similar aspect or embodiment herein that consists of, consists essentially of, or substantially comprises that particular element or elements, unless otherwise stated or clearly contradicted by context (e.g., a composition described herein as comprising a particular element should be understood as also describing a composition consisting of that element, unless otherwise stated or clearly contradicted by context).
[0325] The use of any and all examples, or exemplary language (e.g., such as) provided herein, is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the invention.