Single domain antibodies as inhibitors of PCSK9
09879093 · 2018-01-30
Assignee
Inventors
Cpc classification
A61P43/00
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/22
CHEMISTRY; METALLURGY
International classification
Abstract
Antibodies (e.g., sdAbs) binding to PCSK9 are described. Nucleic acids encoding such Abs, host cells expressing such Abs and pharmaceutical composition comprising same are described. The use of these PCSK9-binding Abs for lowering low-density lipoprotein-cholesterol (LDL-C) levels and for the treatment of cardiovascular disorders, is also described.
Claims
1. A single domain antibody specifically binding to human PCSK9, wherein the complementary determining region (CDR)1, CDR2 and CDR3 regions respectively comprise: (a) DYILG (SEQ ID NO: 4), AIRGSGAIRGREGSTFYVDSVKG (SEQ ID NO: 15) and DRFPTPEFSTQVGHYDY (SEQ ID NO: 29); (b) NYIVG (SEQ ID NO: 5), AIRGSGAIRGREGSTYYADSVKG (SEQ ID NO: 16) and DRFPTPEFTTQVGHYDV (SEQ ID NO: 30); (c) DYILG (SEQ ID NO: 4), AIRESGSSTYYADSVKG (SEQ ID NO: 17) and DQYPTPEFSTQVGHYDY (SEQ ID NO: 31); (d) HYILG (SEQ ID NO: 6), AIRESGSSTYYADSVKG (SEQ ID NO: 17) and DQYPTPEFSTQVGHYDY (SEQ ID NO: 31); (e) VYAMG (SEQ ID NO: 7), AITSPGDSIPYAHSVKG (SEQ ID NO: 18) and TKSGNYNYMGPDPKKYHY (SEQ ID NO: 32); (f) VYAMG (SEQ ID NO: 7), AITSSGDSIPYAHSVKG (SEQ ID NO: 19) and TTSGTYNYMGPDPKEYVY (SEQ ID NO: 33); (g) DYAMG (SEQ ID NO: 8), AAAQSGDSSAYARSVKG (SEQ ID NO: 20) and TTRGSYEYMGPDPKKYEY (SEQ ID NO: 34); (h) NYAMG (SEQ ID NO: 9), QISQVDGFTYYEDSVKG (SEQ ID NO: 21) and ALAFPTTSSNTYAY (SEQ ID NO: 35); (i) AYAMG (SEQ ID NO: 10), TIRDSDASIYYTDSVKG (SEQ ID NO: 22) and RQYYSGRVYSTFREEYDY (SEQ ID NO: 36); (j) IAYMA (SEQ ID NO: 11), SISSGGTTNYAVFAKG (SEQ ID NO: 23) and YAMSTETMVSQDY (SEQ ID NO: 37); (k) NYAMG (SEQ ID NO: 9), QISQVDGFTYYEDSVKG (SEQ ID NO: 21) and TYSGTYNYMGADPKEYVY (SEQ ID NO: 38); (l) SPTMA (SEQ ID NO: 12), AIRSRDDSTYYSNSVKG (SEQ ID NO: 24) and DPRTIDLSSRLLWGS (SEQ ID NO: 39); (m) HYILG (SEQ ID NO: 6), AIRESGSRTYYADSVRG (SEQ ID NO: 25) and DQYPTTEFSTQVGHYDY (SEQ ID NO: 40); (n) HYIVG (SEQ ID NO: 13), AVRESGSSTEYAENVKG (SEQ ID NO: 26) and DRFPTPEFSDRVGHYDL (SEQ ID NO: 41); (o) HYILG (SEQ ID NO: 6), AIRESGSRTYYADSVRG (SEQ ID NO: 25) and DQYPTPEFSTQVGHYDY (SEQ ID NO: 31); (p) HYILG (SEQ ID NO: 6), AVREPGSSTYYADSVKG (SEQ ID NO: 27) and DPYPTPEFTTHVGHYDY (SEQ ID NO: 42); or (q) HYVTS (SEQ ID NO: 14), GVTAHAGVTADVESTDYSDSVKG (SEQ ID NO: 28) and PSGFYRTIPHVHSNYDH (SEQ ID NO: 43).
2. The single domain antibody of claim 1, further comprising a framework region (FR) 1 comprising an amino acid sequence of formula IV: TABLE-US-00022 (SEQIDNO:44) Q-V-X6-L-X7-E-S-G-G-G-X8-V-Q-A-G-X9-S-X10-R-L-S-C- X11-X12-X13-X14-X15-X16-X17-X18(IV) wherein X6 is K or Q; X7 is E or V; X8 is L or P; X9 is G or D X10 is L or M; X11 is V, L, S, or A; X12 is A or P; X13 is S or P; X14 is G, D or R; X15 is R, L or S; X16 is T, F, I or G; X17 is I, V, P or F; and X18 is N, R, S or V.
3. The single domain antibody of claim 2, wherein X6 is K; X7 is E; X8 is L; X9 is G; X10 is L; X11 is A; X12 is A; X13 is S; X14 is G; X15 is R; X16 is T; X17 is F; and/or X18 is N.
4. The antibody of claim 2, wherein the FR1 comprises one of the following amino acid sequences: TABLE-US-00023 (SEQIDNO:45) QVKLEESGGGLVQAGGSLRLSCVASGRTIN, (SEQIDNO:46) QVQLVESGGGLVQAGGSLRLSCLASDRTVN, (SEQIDNO:47) QVQLVESGGGLVQAGGSLRLSCAASGRTPR, (SEQIDNO:48) QVQLVESGGGLVQAGGSLRLSCAASGRTFS, (SEQIDNO:49) QVKLEESGGGLVQAGGSLRLSCAASGRTFS, (SEQIDNO:50) QVKLEESGGGLVQAGGSLRLSCAASGRTFN, (SEQIDNO:51) QVKLEESGGGLVQAGGSLRLSCAASGLTFS, (SEQIDNO:52) QVKLEESGGGLVQAGGSLRLSCSPSDRTFS, (SEQIDNO:53) QVKLEESGGGLVQAGGSLRLSCAAPRSGVV, (SEQIDNO:54) QVKLEESGGGPVQAGGSLRLSCLASGRFVN, (SEQIDNO:55) QVQLVESGGGLVQAGGSMRLSCAASGRTPR, (SEQIDNO:56) QVKLEESGGGLVQAGGSLRLSCAASGRTPR, or (SEQIDNO:57) QVKLEESGGGLVQAGDSLRLSCAASGRIFN.
5. The single domain antibody of claim 1, further comprising an FR2 comprising an amino acid sequence of formula V: TABLE-US-00024 (SEQIDNO:58) X19-X20-R-Q-X21-P-X22-X23-X24-X25-X26-X27-V-X28 (V) wherein X19 is W or Y; X20 is F or Y; X21 is A or V; X22 is G, D or E; X23 is K, T, R, A, E or Q; X24 is K, E, Q or L; X25 is R or P; X26 is E or K; X27 is F or L; and X28 is A, T or G.
6. The single domain antibody of claim 5, wherein X19 is W; X20 is F; X21 is A; X22 is G; X23 is K; X24 is E; X25 is R; X26 is E; X27 is F; and/or X28 is A.
7. The single domain antibody of claim 5, wherein the FR2 comprises one of the following amino acid sequences: TABLE-US-00025 (SEQIDNO:59) WFRQAPGKKREFVA, (SEQIDNO:60) YFRQAPGKEREFVA, (SEQIDNO:61) WFRQAPGKQREFVA, (SEQIDNO:62) WFRQAPGKEREFVA, (SEQIDNO:63) WFRQAPGKEREFVT, (SEQIDNO:64) WFRQAPGTEREFVG, (SEQIDNO:65) WFRQVPGREREFVA, (SEQIDNO:66) WYRQAPEKQRELVA, (SEQIDNO:67) WFRQAPGAEREFVG, (SEQIDNO:68) WFRQAPGEERKFVA, (SEQIDNO:69) WFRQAPGKLPEFVA, or (SEQIDNO:70) WFRQAPDQEREFVA.
8. The single domain antibody of claim 1, further comprising an FR3 comprising an amino acid sequence of formula VI: TABLE-US-00026 (SEQIDNO:71) R-X29-X30-X31-S-X32-X33-X34-X35-K-X36-X37-X38-X39- L-X40-M-X41-S-L-X42-P-X43-D-X44-A-X45-Y-X46-C-X47- X48(VI) wherein X29 is Y, F or D; X30 is T, S or V; X31 is I or V; X32 is K, R, A or L; X33 is D or N; X34 is N, G, H or Y; X35 is A, T, V or S; X36 is N or S; X37 is T or A; X38 is V, I, L, A or G; X39 is Y, D or F; X40 is Q or R; X41 is N, D or S; X42 is K, I or Q; X43 is E or D; X44 is S or T; X45 is T, V or A; X46 is Y or I; X47 is A or N; and X48 is A, V, L or G.
9. The single domain antibody of claim 8, wherein X29 is F; X30 is T; X31 is I; X32 is R; X33 is D; X34 is N; X35 is A; X36 is N; X37 is T; X38 is V; X39 is Y; X40 is Q; X41 is N; X42 is K; X43 is E; X44 is T; X45 is V; X46 is Y; X47 is A; and/or X48 is A.
10. The single domain antibody of claim 8, wherein the FR3 comprises one of the following amino acid sequences: TABLE-US-00027 (SEQIDNO:72) RYTISKDNAKNTVDLQMNSLKPEDSATYYCAV, (SEQIDNO:73) RFSISKDNAKNTIYLQMNSLKPEDSAVYYCAL, (SEQIDNO:74) RYTISRNNTKNAVDLQMNSLKPEDSATYYCAV, (SEQIDNO:75) RYTISRDNTKNAVDLQMNSLKPEDSATYYCAV, (SEQIDNO:76) RFTISRDNAKNTLYLQMNSLKPEDTAAYYCAA, (SEQIDNO:77) RFTISRDNAKNTVYLQMNSLKPEDTAAYYCAA, (SEQIDNO:78) RFTISRDGAKNTAYLQMDSLKPEDTAAYYCAA, (SEQIDNO:79) RFTISRDNAKNTVYLQMNSLKPDDTAVYYCAA, (SEQIDNO:80) RFTISRDNAKNTVYLQMNSLIPDDTAVYYCAA, (SEQIDNO:81) RFTISADNAKNTVYLQMNSLKPEDTAVYICNA, (SEQIDNO:82) RFTISRDNAKNTVYLQMSSLKPDDTAVYYCAA, (SEQIDNO:83) RFTISLDNAKNTAYLRMDSLQPEDTAVYYCAG, (SEQIDNO:84) RDTISRDNTKNAGDLQMNSLKPEDSATYYCAV, (SEQIDNO:85) RFVISKDNVKSTVFLQMNSLKPEDSAVYYCAL, (SEQIDNO:86) RDTISKDHTKNAVDLQMNSLKPEDSATYYCAV, or (SEQIDNO:87) RFTVSRDYSKNTVYLQMNSLKPEDTAVYYCAA.
11. The single domain antibody of claim 1, further comprising an FR4 comprising an amino acid sequence of formula VII: TABLE-US-00028 (SEQIDNO:88) X49-G-X50-G-T-X51-V-T-X52-S-S(VII) wherein X49 is W or S; X50 is R or Q; X51 is Q or E; and X52 is V or I.
12. The single domain antibody of claim 11, wherein X49 is W; X50 is Q; X51 is Q; and/or X52 is V.
13. The single domain antibody of claim 11, wherein the FR4 comprises one of the following amino acid sequences: TABLE-US-00029 (SEQIDNO:89) WGQGTQVTVSS, (SEQIDNO:90) WGRGTQVTVSS, (SEQIDNO:91) SGQGTQVTVSS, or (SEQIDNO:92) WGQGTEVTISS.
14. The single domain antibody of claim 1, comprising one of the following amino acid sequences: TABLE-US-00030 (SEQIDNO:93) QVKLEESGGGLVQAGGSLRLSCVASGRTINDYILGWFRQAPGKKREFVAA IRGSGAIRGREGSTFYVDSVKGRYTISKDNAKNTVDLQMNSLKPEDSATY YCAVDRFPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:94) QVQLVESGGGLVQAGGSLRLSCLASDRTVNNYIVGYFRQAPGKEREFVAA IRGSGAIRGREGSTYYADSVKGRFSISKDNAKNTIYLQMNSLKPEDSAVY YCALDRFPTPEFTTQVGHYDVWGRGTQVTVSS; (SEQIDNO:95) QVKLEESGGGLVQAGGSLRLSCVASGRTINDYILGWFRQAPGKKREFVAA IRESGSSTYYADSVKGRYTISRNNTKNAVDLQMNSLKPEDSATYYCAVDQ YPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:96) QVQLVESGGGLVQAGGSLRLSCAASGRTPRHYILGWFRQAPGKQREFVAA IRESGSSTYYADSVKGRYTISRDNTKNAVDLQMNSLKPEDSATYYCAVDQ YPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:97) QVQLVESGGGLVQAGGSLRLSCAASGRTFSVYAMGWFRQAPGKEREFVAA ITSPGDSIPYAHSVKGRFTISRDNAKNTLYLQMNSLKPEDTAAYYCAATK SGNYNYMGPDPKKYHYWGQGTQVTVSS; (SEQIDNO:98) QVKLEESGGGLVQAGGSLRLSCAASGRTFSVYAMGWFRQAPGKEREFVTA ITSSGDSIPYAHSVKGRFTISRDNAKNTVYLQMNSLKPEDTAAYYCAATT SGTYNYMGPDPKEYVYWGQGTQVTVSS; (SEQIDNO:99) QVKLEESGGGLVQAGGSLRLSCAASGRTFNDYAMGWFRQAPGKEREFVAA AAQSGDSSAYARSVKGRFTISRDGAKNTAYLQMDSLKPEDTAAYYCAATT RGSYEYMGPDPKKYEYWGQGTQVTVSS; (SEQIDNO:100) QVKLEESGGGLVQAGGSLRLSCAASGLTFSNYAMGWFRQAPGTEREFVGQ ISQVDGFTYYEDSVKGRFTISRDNAKNTVYLQMNSLKPDDTAVYYCAAAL AFPTTSSNTYAYSGQGTQVTVSS; (SEQIDNO:101) QVKLEESGGGLVQAGGSLRLSCSPSDRTFSAYAMGWFRQVPGREREFVAT IRDSDASIYYTDSVKGRFTISRDNAKNTVYLQMNSLIPDDTAVYYCAARQ YYSGRVYSTFREEYDYWGQGTQVTVSS; (SEQIDNO:102) QVKLEESGGGLVQAGGSLRLSCAAPRSGVVIAYMAWYRQAPEKQRELVAS ISSGGTTNYAVFAKGRFTISADNAKNTVYLQMNSLKPEDTAVYICNAYAM STETMVSQDYWGQGTQVTVSS; (SEQIDNO:103) QVKLEESGGGLVQAGGSLRLSCAASGLTFSNYAMGWFRQAPGAEREFVGQ ISQVDGFTYYEDSVKGRFTISRDNAKNTVYLQMSSLKPDDTAVYYCAATY SGTYNYMGADPKEYVYWGQGTQVTVSS; (SEQIDNO:104) QVKLEESGGGPVQAGGSLRLSCLASGRFVNSPTMAWFRQAPGEERKFVAA IRSRDDSTYYSNSVKGRFTISLDNAKNTAYLRMDSLQPEDTAVYYCAGDP RTIDLSSRLLWGSWGQGTQVTVSS; (SEQIDNO:105) QVQLVESGGGLVQAGGSMRLSCAASGRTPRHYILGWFRQAPGKQREFVAA IRESGSRTYYADSVRGRDTISRDNTKNAGDLQMNSLKPEDSATYYCAVDQ YPTTEFSTQVGHYDYWGQGTEVTISS; (SEQIDNO:106) QVKLEESGGGLVQAGGSLRLSCAASGRTPRHYIVGWFRQAPGKEREFVAA VRESGSSTEYAENVKGRFVISKDNVKSTVFLQMNSLKPEDSAVYYCALDR FPTPEFSDRVGHYDLWGQGTQVTVSS; (SEQIDNO:107) QVQLVESGGGLVQAGGSMRLSCAASGRTPRHYILGWFRQAPGKQREFVAA IRESGSRTYYADSVRGRYTISRDNTKNAVDLQMNSLKPEDSATYYCAVDQ YPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:108 QVKLEESGGGLVQAGGSLRLSCAASGRTPRHYILGWFRQAPGKLPEFVAA VREPGSSTYYADSVKGRDTISKDHTKNAVDLQMNSLKPEDSATYYCAVDP YPTPEFTTHVGHYDYWGQGTQVTVSS;or (SEQIDNO:109) QVKLEESGGGLVQAGDSLRLSCAASGRIFNHYVTSWFRQAPDQEREFVAG VTAHAGVTADVESTDYSDSVKGRFTVSRDYSKNTVYLQMNSLKPEDTAVY YCAAPSGFYRTIPHVHSNYDHWGQGTQVTVSS.
15. A pharmaceutical composition comprising at least one of the single domain antibodies as defined in claim 1.
16. The pharmaceutical composition of claim 15, further comprising at least one other single domain antibody as defined in claim 1.
17. The pharmaceutical composition of claim 15, further comprising a pharmaceutical carrier or excipient.
18. A method for treating a low-density lipid-cholesterol-related disease comprising administering to a subject in need thereof an effective amount of the single domain antibody as defined in claim 1 or a composition comprising at least the single domain antibody.
19. The method of claim 18, wherein the low-density lipid-cholesterol-related disease is hypercholesterolemia.
20. A nucleic acid molecule comprising a nucleotide sequence encoding the single domain antibody as defined in claim 1 or a vector comprising the nucleic acid molecule or a cell comprising the nucleic acid molecule or the vector.
21. A kit for (i) treating a low-density lipid-cholesterol-related disease in a subject; or (ii) detecting PCSK9 in a biological sample, comprising at least two of the single domain antibodies as defined in claim 1.
22. The kit of claim 21, wherein the low-density lipid-cholesterol-related disease is hypercholesterolemia.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1) In the appended drawings:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
DISCLOSURE OF INVENTION
(17) Proprotein convertase subtilisin-kexin type 9 (PCSK9) also known as neural apoptosis-regulated convertase 1 (NARC-1), is a proteinase K-Hke subtilase of 692 amino acids in human (NP_777596.2), and comprises a signal peptide (1-30) followed by a prosegment (residues 31-152), a catalytic domain (residues 153-454) and a C-terminal Cys-His-rich domain (CHRD; residues 455-692). PCSK9 is expressed in cells capable of proliferation and differentiation such as hepatocytes, kidney mesenchymal cells, intestinal ileum, colon epithelia and embryonic brain telencephalic neurons (Seidah et al., 2003, Proc. Natl. Acad. Sci. USA 100:928-933).
(18) Following translocation in the ER, the prosegment of PCSK9 is autocatalytically cleaved at the VFAQ.sub.152SIP site. In PCs, the prosegment (pro) is an intramolecular chaperone/inhibitor that is usually removed intracellularly to yield a fully active protease. Different from other PCs, PCSK9 is secreted as a stable non-covalent complex [pro PCSK9]. Accordingly, enhanced degradation of the LDLR induced by PCSK9 does not require the catalytic activity of the mature PCSK9 form. In human and mouse plasma, both full-length PCSK9 (153-692) and a truncated form PCSK9-N218 (219-692) can be detected. The latter, which has no activity on LDLR, is likely generated by Furin and/or PC5, since they cleave PCSK9 ex vivo at RFHR218.
(19) In the studies disclosed herein, the present inventors have generated single domain antibodies directed against human PCSK9 and shown that these antibodies inhibit PCSK9-induced LDLR degradation in the HuH7 hepatocarcinoma and HepG2 cell lines.
(20) Accordingly, in a first aspect, the present invention provides an antibody specifically binding to human PCSK9, said antibody comprising:
(21) (i) a complementary determining region (CDR) 1 region comprising an amino acid sequence of formula I:
(22) TABLE-US-00011 (SEQIDNO:1) X1-X2-X3-X4-X5(I)
(23) wherein X1 is D, N, H, V, A, I or S; X2 is Y, P or A; X3 is I, A, T, V or Y; X4 is L, V, T or M; and X5 is G, S or A; or a sequence substantially identical thereto;
(24) (ii) a CDR2 region comprising an amino acid sequence of formula II:
(25) TABLE-US-00012 (SEQIDNO:2) Z1-Z2-Z3-Z4-Z5-Z6-Z7-Z8-Z9-Z10-Z11-Z12-Z13-Z14- Z15-Z16-Y-Z17-Z18-Z19-Z20-Z21-G(II)
(26) wherein Z1 is A, Q, T, G or S; Z2 is I, V or A; Z3 is R, T, A or S; Z4 is G, E, S, Q, A or D; Z5 is S, P, V, R, H or G; Z6 is G, A or D; Z7 is A, S, D, G or T; Z8 is I, V or is absent; Z9 is R, T or is absent; Z10 is G, A or is absent; Z11 is R, D or is absent; Z12 is E, V or is absent; Z13 is G, E or is absent; Z14 is S, R, F or is absent; Z15 is T, I or S; Z16 is F, Y, E, D, P, A or N; Z17 is V, A, S, E or T; Z18 is D, H, N, E, R or V; Z19 is S, N or F; Z20 is V or A; and Z21 is K or R; or a sequence substantially identical thereto; and/or
(27) (iii) a CDR3 region comprising an amino acid sequence of formula III:
(28) TABLE-US-00013 (SEQIDNO:3) B1-B2-B3-B4-B5-B6-B7-B8-B9-B10-B11-B12-B13-B14- B14-B15-B16-B17-B18(III)
(29) wherein B1 is D, T, A, P, R or Y; B2 is R, Q, K, T, L, Y, P, A or S; B3 is F, Y, S, R, A, G or M; B4 is P, G, Y, S, F or is absent; B5 is T, N, S, Y or is absent; B6 is P, Y, T, I, G, R or is absent; B7 is E, N, R, D, T or is absent; B8 is F, Y, L, I, V or is absent; B9 is S, T, M, P, Y or is absent; B10 is T, G, D, H or S; B11 is Q, P, T, A, R, H, V or E; B12 is V, D, L, H, S, F or T; B13 is G, P, L, H, R, S or M, in a specific embodiment, B13 is G, P, L, R, S or M; B14 is K, N, E, W, V or is absent; B15 is H, K, E, T, G, N or S; B16 is Y, S or Q; B17 is D, H, V, E, A or is absent; and B18 is Y, L, H, V or is absent;
(30) or a sequence substantially identical thereto.
(31) In another embodiment, the above-mentioned CDR1 region comprises one of the following amino acid sequences: DYILG (SEQ ID NO: 4), NYIVG (SEQ ID NO: 5), HYILG (SEQ ID NO: 6), VYAMG (SEQ ID NO: 7), DYAMG (SEQ ID NO: 8), NYAMG (SEQ ID NO: 9), AYAMG (SEQ ID NO: 10), IAYMA (SEQ ID NO: 11), SPTMA (SEQ ID NO: 12), HYIVG (SEQ ID NO: 13), HYVTS (SEQ ID NO: 14) or a sequence substantially identical thereto.
(32) In an embodiment, the above-mentioned CDR2 region comprises one of the following amino acid sequences: AIRGSGAIRGREGSTFYVDSVKG (SEQ ID NO: 15), AIRGSGAIRGREGSTYYADSVKG (SEQ ID NO: 16), AIRESGSSTYYADSVKG (SEQ ID NO: 17), AITSPGDSIPYAHSVKG (SEQ ID NO: 18), AITSSGDSIPYAHSVKG (SEQ ID NO: 19), AAAQSGDSSAYARSVKG (SEQ ID NO: 20), QISQVDGFTYYEDSVKG (SEQ ID NO: 21), TIRDSDASIYYTDSVKG (SEQ ID NO: 22), SISSGGTTNYAVFAKG (SEQ ID NO: 23), AIRSRDDSTYYSNSVKG (SEQ ID NO: 24), AIRESGSRTYYADSVRG (SEQ ID NO: 25), AVRESGSSTEYAENVKG (SEQ ID NO: 26), AVREPGSSTYYADSVKG (SEQ ID NO: 27), GVTAHAGVTADVESTDYSDSVKG (SEQ ID NO: 28), or a sequence substantially identical thereto. In an embodiment, the above-mentioned CDR3 region comprises one of the following amino acid sequences: DRFPTPEFSTQVGHYDY (SEQ ID NO: 29), DRFPTPEFTTQVGHYDV (SEQ ID NO: 30), DQYPTPEFSTQVGHYDY (SEQ ID NO: 31), TKSGNYNYMGPDPKKYHY (SEQ ID NO: 32), TTSGTYNYMGPDPKEYVY (SEQ ID NO: 33), TTRGSYEYMGPDPKKYEY (SEQ ID NO: 34), ALAFPTTSSNTYAY (SEQ ID NO: 35), RQYYSGRVYSTFREEYDY (SEQ ID NO: 36), YAMSTETMVSQDY (SEQ ID NO: 37), TYSGTYNYMGADPKEYVY (SEQ ID NO: 38), DPRTIDLSSRLLWGS (SEQ ID NO: 39), DQYPTTEFSTQVGHYDY (SEQ ID NO: 40), DRFPTPEFSDRVGHYDL (SEQ ID NO: 41), DPYPTPEFTTHVGHYDY (SEQ ID NO: 42), PSGFYRTIPHVHSNYDH (SEQ ID NO: 43) or a sequence substantially identical thereto.
(33) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: DYILG (SEQ ID NO: 4), AIRGSGAIRGREGSTFYVDSVKG (SEQ ID NO: 15) and DRFPTPEFSTQVGHYDY (SEQ ID NO: 29), or sequences substantially identical thereto.
(34) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: NYIVG (SEQ ID NO: 5), AIRGSGAIRGREGSTYYADSVKG (SEQ ID NO: 16) and DRFPTPEFTTQVGHYDV (SEQ ID NO: 30), or sequences substantially identical thereto.
(35) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: DYILG (SEQ ID NO: 4), AIRESGSSTYYADSVKG (SEQ ID NO: 17) and DQYPTPEFSTQVGHYDY (SEQ ID NO: 31), or sequences substantially identical thereto.
(36) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: HYILG (SEQ ID NO: 6), AIRESGSSTYYADSVKG (SEQ ID NO: 17) and DQYPTPEFSTQVGHYDY (SEQ ID NO: 31), or sequences substantially identical thereto.
(37) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: VYAMG (SEQ ID NO: 7), AITSPGDSIPYAHSVKG (SEQ ID NO: 18) and TKSGNYNYMGPDPKKYHY (SEQ ID NO: 32), or sequences substantially identical thereto.
(38) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: VYAMG (SEQ ID NO: 7), AITSSGDSIPYAHSVKG (SEQ ID NO: 19) and TTSGTYNYMGPDPKEYVY (SEQ ID NO: 33), or sequences substantially identical thereto.
(39) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: DYAMG (SEQ ID NO: 8), AAAQSGDSSAYARSVKG (SEQ ID NO: 20) and TTRGSYEYMGPDPKKYEY (SEQ ID NO: 34), or sequences substantially identical thereto.
(40) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: NYAMG (SEQ ID NO: 9), QISQVDGFTYYEDSVKG (SEQ ID NO: 21) and ALAFPTTSSNTYAY (SEQ ID NO: 35), or sequences substantially identical thereto.
(41) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: AYAMG (SEQ ID NO: 10), TIRDSDASIYYTDSVKG (SEQ ID NO: 22) and RQYYSGRVYSTFREEYDY (SEQ ID NO: 36), or sequences substantially identical thereto.
(42) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: IAYMA (SEQ ID NO: 11), SISSGGTTNYAVFAKG (SEQ ID NO: 23) and YAMSTETMVSQDY (SEQ ID NO: 37), or sequences substantially identical thereto.
(43) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: NYAMG (SEQ ID NO: 9), QISQVDGFTYYEDSVKG (SEQ ID NO: 21) and TYSGTYNYMGADPKEYVY (SEQ ID NO: 38), or sequences substantially identical thereto.
(44) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: SPTMA (SEQ ID NO: 12), AIRSRDDSTYYSNSVKG (SEQ ID NO: 24) and DPRTIDLSSRLLWGS (SEQ ID NO: 39), or sequences substantially identical thereto.
(45) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: HYILG (SEQ ID NO: 6), AIRESGSRTYYADSVRG (SEQ ID NO: 25) and DQYPTTEFSTQVGHYDY (SEQ ID NO: 40), or sequences substantially identical thereto.
(46) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: HYIVG (SEQ ID NO: 13), AVRESGSSTEYAENVKG (SEQ ID NO: 26) and DRFPTPEFSDRVGHYDL (SEQ ID NO: 41), or sequences substantially identical thereto.
(47) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: HYILG (SEQ ID NO: 6), AIRESGSRTYYADSVRG (SEQ ID NO: 25) and DQYPTPEFSTQVGHYDY (SEQ ID NO: 31), or sequences substantially identical thereto.
(48) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: HYILG (SEQ ID NO: 6), AVREPGSSTYYADSVKG (SEQ ID NO: 27) and DPYPTPEFTTHVGHYDY (SEQ ID NO: 42), or sequences substantially identical thereto.
(49) In an embodiment, the above-mentioned CDR1, CDR2 and CDR3 regions respectively comprise: HYVTS (SEQ ID NO: 14), GVTAHAGVTADVESTDYSDSVKG (SEQ ID NO: 28) and PSGFYRTIPHVHSNYDH (SEQ ID NO: 43), or sequences substantially identical thereto.
(50) In another embodiment, the above-mentioned antibody further comprises a framework region (FR) 1 comprising an amino acid sequence of formula IV:
(51) TABLE-US-00014 (SEQIDNO:44) Q-V-X6-L-X7-E-S-G-G-G-X8-V-Q-A-G-X9-S-X10-R-L-S-C- X11-X12-X13-X14-X15-X16-X17-X18(IV)
(52) wherein X6 is K or Q; X7 is E or V; X8 is L or P; X9 is G or D X10 is L or M; X11 is V, L, S, or A; X12 is A or P; X13 is S or P; X14 is G, D or R; X15 is R, L or S; X16 is T, F, I or G; X17 is I, V, P or F; and X18 is N, R, S or V or a sequence substantially identical thereto.
(53) In an embodiment, X6 is K; X7 is E; X8 is L; X9 is G; X10 is L; X11 is A; X12 is A; X13 is S; X14 is G; X15 is R; X16 is T; X17 is F; and/or X18 is N.
(54) In a further embodiment, the above-mentioned FR1 comprises one of the following amino acid sequences:
(55) TABLE-US-00015 (SEQIDNO:45) QVKLEESGGGLVQAGGSLRLSCVASGRTIN, (SEQIDNO:46) QVQLVESGGGLVQAGGSLRLSCLASDRTVN, (SEQIDNO:47) QVQLVESGGGLVQAGGSLRLSCAASGRTPR, (SEQIDNO:48) QVQLVESGGGLVQAGGSLRLSCAASGRTFS, (SEQIDNO:49) QVKLEESGGGLVQAGGSLRLSCAASGRTFS, (SEQIDNO:50) QVKLEESGGGLVQAGGSLRLSCAASGRTFN, (SEQIDNO:51) QVKLEESGGGLVQAGGSLRLSCAASGLTFS, (SEQIDNO:52) QVKLEESGGGLVQAGGSLRLSCSPSDRTFS, (SEQIDNO:53) QVKLEESGGGLVQAGGSLRLSCAAPRSGVV, (SEQIDNO:54) QVKLEESGGGPVQAGGSLRLSCLASGRFVN, (SEQIDNO:55) QVQLVESGGGLVQAGGSMRLSCAASGRTPR, (SEQIDNO:56) QVKLEESGGGLVQAGGSLRLSCAASGRTPR, (SEQIDNO:57) QVKLEESGGGLVQAGDSLRLSCAASGRIFN,
(56) or a sequence substantially identical thereto.
(57) In another embodiment, the above-mentioned antibody further comprises an FR2 comprising an amino acid sequence of formula V:
(58) TABLE-US-00016 (SEQIDNO:58) X19-X20-R-Q-X21-P-X22-X23-X24-X25-X26-X27-V-X28 (V)
(59) wherein X19 is W or Y; X20 is F or Y; X21 is A or V; X22 is G, D or E; X23 is K, T, R, A, E or Q; X24 is K, E, Q or L; X25 is R or P; X26 is E or K; X27 is F or L; and X28 is A, T or G, or a sequence substantially identical thereto.
(60) In an embodiment, X19 is W; X20 is F; X21 is A; X22 is G; X23 is K; X24 is E; X25 is R; X26 is E; X27 is F; and/or X28 is A.
(61) In an embodiment, the above-mentioned FR2 comprises one of the following amino acid sequences:
(62) TABLE-US-00017 (SEQIDNO:59) WFRQAPGKKREFVA, (SEQIDNO:60) YFRQAPGKEREFVA, (SEQIDNO:61) WFRQAPGKQREFVA, (SEQIDNO:62) WFRQAPGKEREFVA, (SEQIDNO:63) WFRQAPGKEREFVT, (SEQIDNO:64) WFRQAPGTEREFVG, (SEQIDNO:65) WFRQVPGREREFVA, (SEQIDNO:66) WYRQAPEKQRELVA, (SEQIDNO:67) WFRQAPGAEREFVG, (SEQIDNO:68) WFRQAPGEERKFVA, (SEQIDNO:69) WFRQAPGKLPEFVA, (SEQIDNO:70) WFRQAPDQEREFVA,
(63) or a sequence substantially identical thereto.
(64) In another embodiment, the above-mentioned antibody further comprises an FR3 comprising an amino acid sequence of formula VI:
(65) TABLE-US-00018 (SEQIDNO:71) R-X29-X30-X31-S-X32-X33-X34-X35-K-X36-X37-X38-X39- L-X40-M-X41-S-L-X42-P-X43-D-X44-A-X45-Y-X46-C-X47- X48(VI)
(66) wherein X29 is Y, F or D; X30 is T, S or V; X31 is I or V; X32 is K, R, A or L; X33 is D or N; X34 is N, G, H or Y; X35 is A, T, V or S; X36 is N or S; X37 is T or A; X38 is V, I, L, A or G; X39 is Y, D or F; X40 is Q or R; X41 is N, D or S; X42 is K, I or Q; X43 is E or D; X44 is S or T; X45 is T, V or A; X46 is Y or I; X47 is A or N; and X48 is A, V, L or G, or a sequence substantially identical thereto.
(67) In an embodiment, X29 is F; X30 is T; X31 is I; X32 is R; X33 is D; X34 is N; X35 is A; X36 is N; X37 is T; X38 is V; X39 is Y; X40 is Q; X41 is N; X42 is K; X43 is E; X44 is T; X45 is V; X46 is Y; X47 is A; and/or X48 is A.
(68) In an embodiment, the above-mentioned FR3 comprises one of the following amino acid sequences:
(69) TABLE-US-00019 (SEQIDNO:72) RYTISKDNAKNTVDLQMNSLKPEDSATYYCAV, (SEQIDNO:73) RFSISKDNAKNTIYLQMNSLKPEDSAVYYCAL, (SEQIDNO:74) RYTISRNNTKNAVDLQMNSLKPEDSATYYCAV, (SEQIDNO:75) RYTISRDNTKNAVDLQMNSLKPEDSATYYCAV, (SEQIDNO:76) RFTISRDNAKNTLYLQMNSLKPEDTAAYYCAA, (SEQIDNO:77) RFTISRDNAKNTVYLQMNSLKPEDTAAYYCAA, (SEQIDNO:78) RFTISRDGAKNTAYLQMDSLKPEDTAAYYCAA, (SEQIDNO:79) RFTISRDNAKNTVYLQMNSLKPDDTAVYYCAA, (SEQIDNO:80) RFTISRDNAKNTVYLQMNSLIPDDTAVYYCAA, (SEQIDNO:81) RFTISADNAKNTVYLQMNSLKPEDTAVYICNA, (SEQIDNO:82) RFTISRDNAKNTVYLQMSSLKPDDTAVYYCAA, (SEQIDNO:83) RFTISLDNAKNTAYLRMDSLQPEDTAVYYCAG, (SEQIDNO:84) RDTISRDNTKNAGDLQMNSLKPEDSATYYCAV, (SEQIDNO:85) RFVISKDNVKSTVFLQMNSLKPEDSAVYYCAL, (SEQIDNO:86) RDTISKDHTKNAVDLQMNSLKPEDSATYYCAV, (SEQIDNO:87) RFTVSRDYSKNTVYLQMNSLKPEDTAVYYCAA,
(70) or a sequence substantially identical thereto.
(71) In another embodiment, the above-mentioned antibody further comprises an FR4 comprising an amino acid sequence of formula VII:
(72) TABLE-US-00020 (SEQIDNO:88) X49-G-X50-G-T-X51-V-T-X52-S-S(VII)
(73) wherein X49 is W or S; X50 is R or Q; X51 is Q or E; and X52 is V or I, or a sequence substantially identical thereto.
(74) In an embodiment, X49 is W; X50 is Q; X51 is Q; and/or X52 is V, or a sequence substantially identical thereto.
(75) In an embodiment, the above-mentioned FR4 comprises one of the following amino acid sequences: WGQGTQVTVSS (SEQ ID NO: 89), WGRGTQVTVSS (SEQ ID NO: 90), SGQGTQVTVSS (SEQ ID NO: 91), WGQGTEVTISS (SEQ ID NO: 92), or a sequence substantially identical thereto.
(76) In an embodiment, the above-mentioned antibody comprises, or consists of, one of the following amino acid sequences:
(77) TABLE-US-00021 (SEQIDNO:93) QVKLEESGGGLVQAGGSLRLSCVASGRTINDYILGWFRQAPGKKREFVAA IRGSGAIRGREGSTFYVDSVKGRYTISKDNAKNTVDLQMNSLKPEDSATY YCAVDRFPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:94) QVQLVESGGGLVQAGGSLRLSCLASDRTVNNYIVGYFRQAPGKEREFVAA IRGSGAIRGREGSTYYADSVKGRFSISKDNAKNTIYLQMNSLKPEDSAVY YCALDRFPTPEFTTQVGHYDVWGRGTQVTVSS; (SEQIDNO:95) QVKLEESGGGLVQAGGSLRLSCVASGRTINDYILGWFRQAPGKKREFVAA IRESGSSTYYADSVKGRYTISRNNTKNAVDLQMNSLKPEDSATYYCAVDQ YPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:96) QVQLVESGGGLVQAGGSLRLSCAASGRTPRHYILGWFRQAPGKQREFVAA IRESGSSTYYADSVKGRYTISRDNTKNAVDLQMNSLKPEDSATYYCAVDQ YPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:97) QVQLVESGGGLVQAGGSLRLSCAASGRTFSVYAMGWFRQAPGKEREFVAA ITSPGDSIPYAHSVKGRFTISRDNAKNTLYLQMNSLKPEDTAAYYCAATK SGNYNYMGPDPKKYHYWGQGTQVTVSS; (SEQIDNO:98) QVKLEESGGGLVQAGGSLRLSCAASGRTFSVYAMGWFRQAPGKEREFVTA ITSSGDSIPYAHSVKGRFTISRDNAKNTVYLQMNSLKPEDTAAYYCAATT SGTYNYMGPDPKEYVYWGQGTQVTVSS; (SEQIDNO:99) QVKLEESGGGLVQAGGSLRLSCAASGRTFNDYAMGWFRQAPGKEREFVAA AAQSGDSSAYARSVKGRFTISRDGAKNTAYLQMDSLKPEDTAAYYCAATT RGSYEYMGPDPKKYEYWGQGTQVTVSS; (SEQIDNO:100) QVKLEESGGGLVQAGGSLRLSCAASGLTFSNYAMGWFRQAPGTEREFVGQ ISQVDGFTYYEDSVKGRFTISRDNAKNTVYLQMNSLKPDDTAVYYCAAAL AFPTTSSNTYAYSGQGTQVTVSS; (SEQIDNO:101) QVKLEESGGGLVQAGGSLRLSCSPSDRTFSAYAMGWFRQVPGREREFVAT IRDSDASIYYTDSVKGRFTISRDNAKNTVYLQMNSLIPDDTAVYYCAARQ YYSGRVYSTFREEYDYWGQGTQVTVSS; (SEQIDNO:102) QVKLEESGGGLVQAGGSLRLSCAAPRSGVVIAYMAWYRQAPEKQRELVAS ISSGGTTNYAVFAKGRFTISADNAKNTVYLQMNSLKPEDTAVYICNAYAM STETMVSQDYWGQGTQVTVSS; (SEQIDNO:103) QVKLEESGGGLVQAGGSLRLSCAASGLTFSNYAMGWFRQAPGAEREFVGQ ISQVDGFTYYEDSVKGRFTISRDNAKNTVYLQMSSLKPDDTAVYYCAATY SGTYNYMGADPKEYVYWGQGTQVTVSS; (SEQIDNO:104) QVKLEESGGGPVQAGGSLRLSCLASGRFVNSPTMAWFRQAPGEERKFVAA IRSRDDSTYYSNSVKGRFTISLDNAKNTAYLRMDSLQPEDTAVYYCAGDP RTIDLSSRLLWGSWGQGTQVTVSS; (SEQIDNO:105) QVQLVESGGGLVQAGGSMRLSCAASGRTPRHYILGWFRQAPGKQREFVAA IRESGSRTYYADSVRGRDTISRDNTKNAGDLQMNSLKPEDSATYYCAVDQ YPTTEFSTQVGHYDYWGQGTEVTISS; (SEQIDNO:106) QVKLEESGGGLVQAGGSLRLSCAASGRTPRHYIVGWFRQAPGKEREFVAA VRESGSSTEYAENVKGRFVISKDNVKSTVFLQMNSLKPEDSAVYYCALDR FPTPEFSDRVGHYDLWGQGTQVTVSS; (SEQIDNO:107) QVQLVESGGGLVQAGGSMRLSCAASGRTPRHYILGWFRQAPGKQREFVAA IRESGSRTYYADSVRGRYTISRDNTKNAVDLQMNSLKPEDSATYYCAVDQ YPTPEFSTQVGHYDYWGQGTQVTVSS; (SEQIDNO:108) QVKLEESGGGLVQAGGSLRLSCAASGRTPRHYILGWFRQAPGKLPEFVAA VREPGSSTYYADSVKGRDTISKDHTKNAVDLQMNSLKPEDSATYYCAVDP YPTPEFTTHVGHYDYWGQGTQVTVSS; (SEQIDNO:109) QVKLEESGGGLVQAGDSLRLSCAASGRIFNHYVTSWFRQAPDQEREFVAG VTAHAGVTADVESTDYSDSVKGRFTVSRDYSKNTVYLQMNSLKPEDTAVY YCAAPSGFYRTIPHVHSNYDHWGQGTQVTVSS;
or a sequence substantially identical thereto.
(78) The term antibody as referred to herein includes whole antibodies and any antigen binding fragment (i.e., antigen-binding portion), single chains thereof, as well as single domain antibodies. Conventional antibodies typically comprise at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.I) and a light chain constant region. The light chain constant region is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
(79) The term antigen-binding portion of an antibody (or simply antibody portion), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., PCSK9). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term antigen-binding portion of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; (ii) a F(ab).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a F.sub.d fragment consisting of the V.sub.H and C.sub.H1 domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature 341:544-546 (1989)), which consists of a V.sub.H domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules (known as single chain Fv (scFv). Such single chain antibodies are also intended to be encompassed within the term antigen-binding portion of an antibody. These antibody fragments may be obtained using any suitable technique, including conventional techniques known to those with skill in the art, and the fragments may be screened for utility in the same manner as are intact antibodies.
(80) In an embodiment, the above-mentioned antibody is a single domain antibody. Single domain antibodies (sdAbs) as used herein, refer to antibodies whose complementary determining regions (CDR) are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, alpaca, guanaco, goat, rabbit, bovine. According to one aspect of the invention, a single domain antibody as used herein is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a V.sub.HH or nanobody to distinguish it from the conventional V.sub.H of four chain immunoglobulins. Such a V.sub.HH molecule or sdAb can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such V.sub.HHs are within the scope of the invention. They have also been observed in shark and are termed V.sub.NARs, and may be engineered based on human heavy chain sequences. As used herein, sdAbs include those directly isolated from VH, V.sub.HH or V.sub.NAR reservoir of any origin through phage display or other display technologies and those generated through further modification of such sdAbs by humanization, affinity maturation, stabilization and other way of antibody engineering. The term also includes homologues, derivatives, or fragments that are capable of functioning as a single-domain antibody domain and which exhibits biological activity (e.g., binding to PCSK9).
(81) As further described herein, the amino acid sequence and structure of sdAbs can be consideredwithout however being limited theretoto be comprised of four framework regions or FRs, which are referred to in the art and herein as Framework region 1 or FR1; Framework region 2 or FR2; Framework region 3 or FR3; and Framework region 4 or FR4, respectively; which framework regions are interrupted by three complementary determining regions or CDRs, which are referred to in the art as Complementarity Determining Region 1 or CDR1; Complementarity Determining Region 2 or CDR2; and Complementarity Determining Region 3 or CDR3, respectively. The total number of amino acid residues in a single domain antibody can be from about 110-140, or about 110-130. It should however be noted that parts, fragments or analogs of a single domain antibody are not particularly limited as to their length and/or size, as long as such parts, fragments or analogs meet the further requirements outlined herein and are also preferably suitable for the purposes described herein.
(82) The amino acid residues of a single domain antibody are numbered according to the general numbering for V.sub.H domains given by Kabat et al. (Sequence of proteins of immunological interest, US Public Health Services, NIH Bethesda, Md., Publication No. 91), as applied to V.sub.HH domains from Camelids in the article of Riechmann and Muyldermans (Riechmann and Muyldermans, J. Immunol. Methods 1999 Dec. 10; 231 (1-2): 25-38; see for example FIG. 2 of said reference). According to this numbering, the FR1 of a single domain antibody comprises the amino acid residues at about positions 1-30, the CDR1 comprises the amino acid residues at about positions 31-35, the FR2 comprises the amino acids at about positions 36-49, the CDR2 comprises the amino acid residues at about positions 50-65, the FR3 comprises the amino acid residues at about positions 66-94, the CDR3 comprises the amino acid residues at about positions 95-102, and the FR4 comprises the amino acid residues at about positions 103-113. It should be noted that, as is well known in the art for V.sub.H domains and for V.sub.HH domains, the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering). This means that, generally, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence. Generally, however, it can be said that, according to the numbering of Kabat and irrespective of the number of amino acid residues in the CDRs, position 1 according to the Kabat numbering corresponds to the start of FR1, position 36 according to the Kabat numbering corresponds to the start of FR2, position 66 according to the Kabat numbering corresponds to the start of FR3, and position 103 according to the Kabat numbering corresponds to the start of FR4. Software and online tools (e.g., Abnum, http://www.bioinf.org.uk/abs/abnum/) for numbering a given antibody sequence using the Kabat numbering scheme are available (see Abhinandan, K. R. and Martin, A. C. R. (2008) Analysis and improvements to Kabat and structurally correct numbering of antibody variable domains Molecular Immunology, 45, 3832-3839). The Kabat numbering of the sequence identified herein as PKE2, using the Abnum antibody amino acid numbering tool, is depicted in
(83) A substantially identical sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered substantially identical polypeptides. Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g., size, charge, or polarity).
(84) In a non-limiting example, a conservative mutation may be an amino acid substitution. Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group. By the term basic amino acid it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH. Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K). By the term neutral amino acid (also polar amino acid), it is meant hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms. Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gln or Q). The term hydrophobic amino acid (also non-polar amino acid) is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (He or I), phenylalanine (Phe or F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G). Acidic amino acid refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).
(85) Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2, BLAST-P, BLAST-N, COBALT or FASTA-N, or any other appropriate software/tool that is known in the art (Johnson M, et al. (2008) Nucleic Acids Res. 36:W5-W9; Papadopoulos J S and Agarwala R (2007) Bioinformatics 23:1073-79).
(86) The substantially identical sequences of the present invention may be at least 75% identical; in another example, the substantially identical sequences may be at least 80, 85, 90, 95, 96, 97, 98 or 99% identical at the amino acid level to sequences described herein. The substantially identical sequences retain substantially the activity and specificity of the reference sequence.
(87) The sdAb of the present invention may also comprise additional sequences to aid in expression, detection or purification of a recombinant antibody or fragment thereof. For example, and without wishing to be limiting, the antibody or fragment thereof may comprise a targeting or signal sequence (for example, but not limited to ompA or PCSK9), a detection and/or purification tag (for example, but not limited to c-Myc, His-tag or V5 tag), or a combination thereof.
(88) The sdAb of the present invention may also be in a multivalent display. Multimerization may be achieved by any suitable method of know in the art. For example, and without wishing to be limiting in any manner, multimerization may be achieved using self-assembly molecules (Zhang, J. et al. J Mol. Biol. 341, 161-169 (2004); Zhang, J. et al., J Mol Biol 335, 49-56 (2004)), as described in PCT publication No. WO 2003/046560. The described method produces pentabodies by expressing a fusion protein comprising the antibody or fragment thereof and a pentamerization domain, which assembles into a pentamer, through which a multivalent display of the antibody or fragment thereof is achieved. Each subunit of the pentamer may be the same or different. Other forms of multivalent display are also encompassed by the present invention. For example, and without wishing to be limiting, the antibody or fragment thereof may be presented as a dimer, a trimer, or any other suitable oligomer. This may be achieved by methods known in the art, for example direct linking connection (Nielsen et al. Cancer research 60, 6434-6440 (2000)), c-jun/Fos interaction (de Kruif, J. & Logtenberg, T. J Biol Chem 271, 7630-7634 (1996)), or Knob into holes interaction (Ridgway et al. Protein Eng 9, 617-621 (1996)).
(89) The sdAb of the present invention may also be conjugated to or fused with a particular moiety, for example to increase its stability/half-life and/or to facilitate its targeting to a particular cell, organ and/or tissue and/or to facilitate cell entry. In an embodiment, the single domain antibody is fused with an Fc region of an antibody, in a further embodiment to a human IgG4-Fc region.
(90) In an embodiment, the above-mentioned sdAb blocks or interferes with the interaction between PCSK9 and the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR. In an embodiment, the above-mentioned sdAb is directed to the catalytic domain of PCSK9, in a further embodiment to a region corresponding to residues 153-156 and/or 367-381 of PCSK9.
(91) In an embodiment, the above-mentioned single domain antibody has a dissociation constant (K.sub.D) of 110.sup.7 or less, or less, in further embodiments, the above-mentioned single domain antibody has a dissociation constant (K.sub.D) of 110.sup.8 M, 110.sup.8 M, 110.sup.10 M, 110.sup.11 M, or 110.sup.12 M or less.
(92) Functional Characterization of the sdAbs
(93) The functional characteristics of the sdAbs of the present invention can be tested in vitro and in vivo. For example, PCSK9-binding sdAbs can be tested for the ability to inhibit interaction of PCSK9 with LDLR, to trigger the entry of sdAbs into cell, could also be measured by inhibition of PCSK9-dependent effects on LDLR (e.g., LDLR mediated uptake of LDL-C), inhibition of PCSK9 proteolytic activity, inhibition of PCSK9-dependent LDLR degradation, and decrease LDL-C in vivo. PCSK9 binding to LDLR can be detected by surface plasmon resonance (SPR) (using BIAcore) by immobilizing LDLR to a solid support and detecting soluble PCSK9 binding to the LDLR. Alternatively, PCSK9 can be immobilized, and LDLR binding can be detected. PCSK-9/LDLR binding can also be analyzed by ELISA (e.g., by detecting PCSK9 binding to immobilized LDLR), by fluorescence resonance energy transfer (FRET), or phage display. To perform FRET, fluorophore-labeled PCSK9 binding to LDLR in solution can be detected (see, for example, U.S. Pat. No. 5,631,169). PCSK9 binding to LDL-R has been detected by coimmunoprecipitation (Lagace et al., 2006 J. Clin. Inv. 116(11):2995-3005). To examine PCSK9-LDLR binding in this manner, HepG2 cells are cultured in sterol-depleted medium for 18 hours. Purified PCSK9 is added to the medium in the presence of 0.1 mM chloroquine and the cells are incubated for one hour. Cells are lysed in mild detergent (1% digitonin w/vol). PCSK9 or LDLR is immunoprecipitated from cell lysates, separated by SDS-PAGE, and immunoblotted to detect the presence of coimmunoprecipitated LDLR or PCSK9, respectively (Lagace et al., 2006, supra).
(94) These assays may be conducted with a mutant form of PCSK9 that binds to LDLR with a higher avidity (e.g., hPCSK9 D374Y, Lagace et al., 2006, supra). Hepatocytes express LDLR on the cell surface. Addition of purified PCSK9 to cultured hepatocyte cells (e.g., HepG2 cells, ATCC HB-8065, HuH7 cells, primary human or mouse hepatocytes) produces a decrease in LDLR expression in a dose- and time-dependent manner (Lagace et al., 2006 supra). PCSK9-binding sdAbs can be tested for the ability to increase LDLR levels in hepatocytes. For example, HepG2 cells are cultured in sterol-depleted medium (DMEM supplemented with 100 U/ml penicillin, 100 g/ml streptomycin sulfate, and 1 g/l glucose, 5% (vol/vol) newborn calf lipoprotein-deficient serum (NCLPDS), 10 M sodium compactin, and 50 M sodium mevalonate) for 18 hours to induce LDLR expression. Purified PCSK9 (5 g/ml) is added to the medium. LDLR levels in cells harvested at 0, 0.5, 1, 2, and 4 hours after addition of PCSK9 are determined (Lagace et al., 2006, supra). LDLR levels can be determined by flow cytometry, FRET, immunoblotting, or other means. LDL-C uptake by cells (e.g., HepG2 cells, HuH7 cells) can be measured using fluorescently-labeled LDL-C, Dil-LDL (3,3-dioctadecylindocarbocyanine-low density lipoprotein) as described by Stephan and Yurachek (1993, J. Lipid Res. 34: 325-330). Briefly, cells are incubated in culture with Dil-LDL (20-100 g protein/ml) at 37 C. for 2 hours. Cells are washed, lysed, and the concentration of internalized Dil-LDL is quantitated using a spectrofluorometer. LDL-C uptake can be measured in cells contacted with a PCSK9 binding agent (prior to, and/or during the period in which Dil-LDL is present in the cell culture).
(95) Transgenic mice overexpressing human PCSK9 in liver have increased levels of plasma LDL-C relative to non-transgenic mice (Lagace et al., 2006 supra). See also Maxwell and Breslow, 2004 Proc. Natl. Acad. Sci. USA, 101:7100, describing overexpression of PCSK9 using an adenovirus vector in mice. PCSK9.sup./ mice have been produced (Rashid et al., 2005 Proc. Natl. Acad. Sci. 102(5):5374-5379). These mice can be genetically modified to express a hPCSK9 transgene. PCSK9 binding molecules can be tested in any of these models, or in animals which are not genetically modified, for the ability to clear or reduce total cholesterol and/or LDL-C.
(96) The kinetics of LDL clearance from plasma can be determined by injecting animals with [.sup.125I]-labelled LDL, obtaining blood samples at 0, 5, 10, 15, and 30 minutes after injection, and quantitating [.sup.125I]-LDL in the samples (Rashid et al., 2005 supra). The rate of LDL clearance is increased in PCSK9.sup./ mice relative to wild type mice (Rashid et al., 2005 supra). Increased LDL clearance in animals administered a PCSK9-binding sdAb indicates that the agent inhibits PCSK9 activity in vivo.
(97) Decreases in total plasma cholesterol, plasma triglycerides, and/or LDL-C in response to treatment with a PCSK9-binding sdAb are indicative of therapeutic efficacy of the PCKS9 binding molecule. Cholesterol and lipid profiles can be determined by colorimetric, gas-liquid chromatographic, or enzymatic means using commercially available kits.
(98) Methods/assays to determine PCSK9 activity are described below.
(99) In Vitro Analysis of PCSk9-Dependant LDLR Degradation.
(100) Compound is tested for its ability to inhibit the LDLR enhanced degradation by PCSK9 on human hepatocyte cell lines HepG2 or HuH7. The assay consists in the addition of wild type (WT), mutants or chimeric PCSK9, either transfected or purified, directly to the culture supernatants in the presence or absence of the tested compound. Each dose-responses experiment is done in triplicate for 4 to 6 different dosages. The inhibition of the PCSK9 activity is evidence by an increase of the LDLR protein expression and/or at the cell surface, as evidenced by: Western blot analysis of cell lysates for the total LDLR; FACS analysis for cell surface for LDLR; Fluorescent Dil-LDL incorporation monitoring the cell surface activity of LDLR.
(101) The Dil-LDL fluorescent uptake assay consists in the fluorescence measurement of the Dil-LDL cellular incorporation via LDLR internalization (a measurement of cell surface LDLR activity). The cells are incubated in a 96-well format in the presence or absence of different doses of tested compound for 2 h, and then Dil-LDL was added for an additional 2 h. The inhibition of the PCSK9 activity is detected by an increase in the Dil-LDL fluorescence.
(102) a. WT PCSK9.
(103) The assay consists in the addition of wild type (WT) PCSK9, either as conditioned media from transfected cells or purified, and added to the culture supernatants, in the presence or absence of the tested compound. The dose routinely chosen for PCSK9 added extracellularly is 1 ug/ml.
(104) b. Mutants PCSK9 (Gain of Function).
(105) In order to further characterize whether the tested compound can inhibit the function of a gain of function mutation, the cells are incubated with purified mutant proteins, in the presence or absence of different doses of tested compound. Purified PCSK9 mutants are PCSK9-D374Y, for example (exhibiting a 25-fold higher affinity towards LDLR) or S127R (showing an increase stability of PCSK9). The dose routinely chosen for PCSK9 and its gain-of-function natural mutant D374Y, added extracellularly are 1 g/ml and 0.2 g/ml. Others PCSK9 mutants are similarly used. The assay could also be conducted using culture medium harvested from cells transfected with gain of function PCSK9 mutants.
(106) c. sdAbs.
(107) The assays are conducted using purified sdAbs (6His) added directly to the culture supernatants, or pre-incubated with PCSK9. These assays are also conducted using culture medium collected from cells transfected with the secretable form of sdAbs (e.g., a chimeric construct containing a signal peptide at the amino terminal end of sdAbs) that is V5-tagged.
(108) D. Description of the AssayChimeric PCSK9.
(109) Chimeric protein fusing the PCSK9 with the transmembrane and cytosolic domains of the cell surface angiotensin converting enzyme 2 (PCSK9-ACE2) is tested for measuring the activity of the tested compound on the PCSK9 extracellular pathway activity. Alternatively, chimeric protein fusing PCSK9 with the transmembrane and cytosolic domains of the Lamp-1 which directly traffic the protein to the endosomes/lysosomes (PCSK9-Lamp1) is tested for measuring the activity of the tested compound on the PCSK9 intracellular pathway activity. The stable cells expressing the chimeric PCSK9-ACE2 or PCSK9-Lamp1 are available and are be incubated in the presence or absence of different doses of tested compound.
(110) E. Description of the AssayPrimary Human Hepatocytes.
(111) The PCSK9 inhibitory compounds are tested on mouse and human primary hepatocytes in order to measure their effect on cell surface LDLR. The advantage of using the mouse primary hepatocytes, is that it also measure the specificity of the compound in the context of a wild type or knockout mouse expressing or lacking PCSK9, respectively. HepG2 and HuH7 cells that no longer express PCSK9 endogenously (e.g., under a shRNA knockdown) are also used for similar drug specificity purpose.
(112) In Vitro Analysis of PCSK9 Processing and Secretion.
(113) The propCSK9 to PCSK9 processing and secretion are tested using a biosynthetic approach and/or Western blot of PCSK9 in cells and media. Compound(s) are incubated with HEK293 (stably expressing PCSK9) and HuH7 (expressing endogenously PCSK9). For statistical significance each experiment is performed in triplicate. Dose-dependent responses of compound(s) are performed.
(114) Protocols
(115) PCSK9 Contained in Media Culture of Transfected Cells.
(116) Human wild type PCSK9 (PCSK9-WT) and gain-of-function (PCSK9-D374Y) proteins are produced by over-expression in HEK293 cells or Huh7 cells. Briefly, HEK 293 or Huh7 cell lines are grown in Dulbecco's modified Eagle's medium with 10% fetal bovine serum (Invitrogen) and maintained at 37 C. under 5% CO2. HEK293 cells are transfected with jetPRIME (Polyplus transfection), and Huh7 cells are transfected with Lipofectamine 2000 (Invitrogen), according to the manufacturer's protocol. Twenty-four hours post-transfection, cells are washed and incubated in serum-free medium. Conditioned media containing secreted human PCSK9-D374Y or PCSK9-WT proteins are collected 24 hours later. The level of PCSK9 proteins in conditioned media is quantified by enzyme-linked immunosorbent assay (ELISA), as described previously (Dubuc G, Tremblay M, Par G, Jacques H, Hamelin J, Benjannet S, Boulet L, Genest J, Bernier L, Seidah N G, Davignon J. 2010. A new method for measurement of total plasma PCSK9: clinical applications. J Lipid Res. 51:140-149.).
(117) SdAbs Secreted in Media Culture of Transfected Cells.
(118) The sdAb cDNAs containing a hexahistidine (6His) tag at the 3 end, or a 6H is tag and a c-Myc tag, are cloned into the pIRES2-EGFP backbone vector (Clonetech). In order to ensure secretion of the sdAbs from transfected cells, the signal peptide (SP) of human PCSK9 is introduced at the amino-terminal end of the sdAb sequence (
(119) Detection by Western Blot.
(120) Cells are washed 3 in phosphate-buffered saline (PBS) and lysed in complete RIPA buffer (50 mM Tris/HCl, pH 8.0, 1% (v/v) Nonidet P40, 0.5% sodium deoxycholate, 150 mM NaCl and 0.1% (v/v) SDS) supplemented with 1 Complete Protease Inhibitor Mixture (Roche Applied Science). Proteins are separated by 8% SDS-polyacrylamide gel electrophoresis and blotted on polyvinylidene difluoride (PVDF, Perkin Elmer) membranes (GE Healthcare), which were blocked for 1 h in TBS-T (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.1% Tween-20) containing 5% nonfat dry milk. Membranes are then incubated 3 h in 1% nonfat milk with a polyclonal hPCSK9 antibody (1:2500) and human LDLR antibody (1:1000, R&D Systems). Appropriate horseradish peroxidase-conjugated secondary antibody (1:10,000, Sigma) is used for detection with enhanced chemiluminescence using the ECL plus kit (GE Healthcare).
(121) Fluorescence-Activated Cell Sorting (FACS) Quantification of Cell Surface LDLR Levels.
(122) HuH7 cells are incubated for 1-4 h at 37 C. with various PCSK9 constructs in the presence or absence of the added compound(s), and then washed 3 with calcium/magnesium free Dulbecco's phosphate-buffered saline (DPBS) containing 0.5% bovine serum albumin (Sigma) and 1 g/l glucose (solution A). Cells are then incubated 5 min at 37 C. with 500 l of 1 Versene solution (Invitrogen) and layered on 5 ml of solution A. Cells are then centrifuged for 5 min at 1000 rpm and re-suspended in 1 ml of solution A containing 1:100 of monoclonal LDLR antibody C7 directed against human LDLR (mAb-C7, Santa Cruz Biotechnology) for 40 min. Cells are washed once with 5 ml of solution A, centrifuged and re-suspended for 20 min in 1 ml of PBS containing 1:250 of Alexa Fluor 647 donkey anti-mouse (Molecular Probes). Cells are washed and re-suspended in 300 l of PBS 0.2% of propidium iodide (PI). Viable cells (PI-negative) are then analyzed by FACS for both PI and Alexa Fluor 647 using the FACS BD LSR (BD Biosciences). Immunofluorescence of LDLR in human Huh7 cells. Huh7 cells are plated on Poly-L-Lysine-coated (50 ug/ml) round microscope cover slips 1.12 mm thickness (Fisherbrand 12CIR #1) that are placed in a 24-well cell culture plate. Seeding is performed in DMEM complete media and 6 hours later the media is swapped for the serum-free incubation mixtures (300 ul/well). Cells are then incubated for 18 hours with the mixtures lacking or containing 0.5 ug/ml (6 nM) of PCSK9 protein (WT or variant e.g., D374Y) either alone or with 50 ug/ml (3 uM) of purified llama sdAbs. The PCSK9 is used as purified protein or as conditioned medium collected from transfected cells. Prior to addition to the Huh7 cells, the mixture containing PCSK9 and sdAb is pre-incubated for 2 hours at 37 C. At the end of the 18 hours incubation, the Huh7 cells are washed 3 with PBS and then fixed for 10 min with 3.7% paraformaldehyde. For intracellular staining, the cells are permeabilized for 5 min with 0.7% Triton X-100. After an additional 3 washes with PBS, permeabilized or non-permeabilized cells are blocked for 30 min with 1% BSA, followed by overnight incubation at 4 C. with primary antibody (1:200 goat polyclonal anti-hLDLR in 1% BSA, R&D Systems). Following a final 3 washes with PBS, antigen-antibody complexes are revealed by 1-hour incubation at room temperature with Alexa fluor-tagged secondary antibody (green labelling) and mounted in ProLong Gold Antifade Reagent containing DAPI (blue labeling) (Molecular Probes, Invitrogen). Immunofluorescence analyses are performed with a confocal microscope (Zeiss LSM-710).
(123) The sdAbs internalization is tested by immunofluorescence in human Huh7 cells. Huh7 cells are incubated for 18 hours with i) conditioned media containing or not different constructs of PCSK9, ii) conditioned media containing or not the various V5-tagged sdAbs, or iii) with mixtures of both PCSK9-conditioned media and sdAbs(V5)-conditioned media. The presence of V5-tagged sdAbs is revealed by immunofluorescence analysis (described above) under non-permeabilized (cell-surface localization of the sdAb) or permeabilized (intra-cellular localization of the sdAb) conditions using the mAb-V5 (Invitrogen) (1:200, in 1% BSA incubated overnight at 4 C.).
(124) Pull-Down Experiments.
(125) Culture medium harvested from PCSK9 transfected cells (e.g., Huh7, HEK239 cells) alone or mixed with purified sdAbs(6His) are pre-incubated for 2 h at 37 C., followed by immunoprecipitation overnight, at 4 C., using 6.6 ug of anti-His Ab-agarose beads. Supernatants and material eluted from the beads are subjected to PAGE-SDS (6%) and Western blot analysis with anti-h PCSK9 Ab.
(126) Dil-LDL Uptake Cell-Based Assay for PCSK9 Activity.
(127) A cell culture method to assay PCSK9 functional activity on the LDLR was developed measuring cellular LDLR activity as the uptake of fluorescent labeled LDL. HepG2 cells are plated at 20,000 cells/well in 96-well format in RPMI+10% FBS, and on the second day the media is changed to RPMI+10% LPDS with 100 nM statin for 16 h. Cells were then preincubated with recombinant human PCSK9 protein at the levels indicated for 2 h, followed by the addition of 5 g/mL Dil-LDL for a further 2 h incubation at 37 C. Uptake is stopped by the addition of 4% formaldehyde in 10 M Hoechst-33342 for 20 min at 20 C. Cells are then washed twice with PBS, and fluorescence was measured for Hoeschst (DNA content) at ex/em 360/460 nm, (dichroic mirror=400 nm) is read. After DNA reading, the cells are lysed in 0.1 N NaOH, 0.1% SDS and shaken for 10 min followed by fluorescence reading for Dil-LDL excitation/emission at 530/580 nm (dichroic mirror=561 nm) on an LJL Analyst instrument. For data analysis, the fluorescence ratio of Dil-LDL/Hoechst 33342 is used to normalize Dil-LDL uptake value to cell count.
(128) Transfections, Biosynthetic Analyses, Immunoprecipitations of PCSK9.
(129) Transfections are done with 310.sup.5 HEK293 cells using Effectene (Qiagen) and a total of 0.5 g of cDNAs. Alternatively, 510.sup.5 HuH7 or 610.sup.5 HepG2 cells are transfected with a total of 4 g of cDNAs in Lipofectamine 2000 (Invitrogen). Two days post-transfection, HEK293 cells are washed and then incubated for various times with either 250 Ci/ml [35S]Met/Cys (PerkinElmer Life Sciences). The cells are lysed in modified RIPA buffer (150 mM NaCl, 50 mM Tris-HCl, pH 7.5), 1% Nonidet P-40, 0.5% sodium deoxycholate, 0.1% SDS, and a protease inhibitor mixture (Roche Applied Science), after which the lysates and media are prepared for immunoprecipitation. The antibodies used are the anti-V5 mAb (Invitrogen, 1:500), and proprietary rabbit anti-PCSK9 31-454 (A-03). Immunoprecipitates are resolved by SDS-PAGE on 8% Tricine gels and autoradiographed. These experiments are repeated at least three times. Quantitation are performed on a Storm Imager (Amersham Biosciences) by using the ImageQuant version 5.2 software. This sensitive method is testing whether the compound affect propCSK9 to PCSK9 activation in the endoplasmic reticulum and the secretion of active PCSK9 complexed with its prosegment from the cells into the medium.
(130) Cells engineered to express endogenously and stably PCSK9 or its natural mutants are be incubated with the compound(s) and the different PCSK9 forms present in the media and cell lysates are analysed for by Western blot using sensitive human PCSK9 antibodies.
(131) Nucleic Acids, Host Cells
(132) The present invention also relates to nucleic acids comprising nucleotide sequences encoding the above-mentioned PCSK9-binding sdAb. The nucleic acid may be codon-optimized. The nucleic acid can be a DNA or an RNA. The nucleic acid sequence can be deduced by the skilled artisan on the basis of the disclosed amino acid sequences.
(133) The present invention also encompasses vectors (plasmids) comprising the above-mentioned nucleic acids. The vectors can be of any type suitable, e.g., for expression of said polypeptides or propagation of genes encoding said polypeptides in a particular organism. The organism may be of eukaryotic or prokaryotic origin. The specific choice of vector depends on the host organism and is known to a person skilled in the art. In an embodiment, the vector comprises transcriptional regulatory sequences or a promoter operably-linked to a nucleic acid comprising a sequence encoding a PCSK9-binding sdAb of the invention. A first nucleic acid sequence is operably-linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably-linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably-linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in reading frame. However, since for example enhancers generally function when separated from the promoters by several kilobases and intronic sequences may be of variable lengths, some polynucleotide elements may be operably-linked but not contiguous. Transcriptional regulatory sequences or transcriptional regulatory elements are generic terms that refer to DNA sequences, such as initiation and termination signals, enhancers, and promoters, splicing signals, polyadenylation signals, etc., which induce or control transcription of protein coding sequences with which they are operably-linked.
(134) A recombinant expression vector comprising a nucleic acid sequence of the present invention may be introduced into a cell, e.g., a host cell, which may include a living cell capable of expressing the protein coding region from the defined recombinant expression vector. Accordingly, the present invention also relates to cells (host cells) comprising the nucleic acid and/or vector as described above. The suitable host cell may be any cell of eukaryotic or prokaryotic (bacterial) origin that is suitable, e.g., for expression of the sdAbs or propagation of genes/nucleic acids encoding said sdAbs. The eukaryotic cell line may be of mammalian, of yeast, or invertebrate origin. The specific choice of cell line is known to a person skilled in the art. Choice of bacterial strain will depend on the task at hand and is known to a person skilled in the art. The terms host cell and recombinant host cell are used interchangeably herein. Such terms refer not only to the particular subject cell, but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein. Vectors can be introduced into cells via conventional transformation or transfection techniques. The terms transformation and transfection refer to techniques for introducing foreign nucleic acid into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection and viral-mediated transfection. Suitable methods for transforming or transfecting host cells can for example be found in Sambrook et al. (supra), Sambrook and Russell (supra) and other laboratory manuals. Methods for introducing nucleic acids into mammalian cells in vivo are also known, and may be used to deliver the vector DNA of the invention to a subject for gene therapy.
(135) The above-mentioned nucleic acid or vector may be delivered to cells in vivo (to induce the expression of the single domain antibody) using methods well known in the art such as direct injection of DNA, receptor-mediated DNA uptake, viral-mediated transfection or non-viral transfection and lipid based transfection, all of which may involve the use of gene therapy vectors. Direct injection has been used to introduce naked DNA into cells in vivo. A delivery apparatus (e.g., a gene gun) for injecting DNA into cells in vivo may be used. Such an apparatus may be commercially available (e.g., from BioRad). Naked DNA may also be introduced into cells by complexing the DNA to a cation, such as polylysine, which is coupled to a ligand for a cell-surface receptor. Binding of the DNA-ligand complex to the receptor may facilitate uptake of the DNA by receptor-mediated endocytosis. A DNA-ligand complex linked to adenovirus capsids which disrupt endosomes, thereby releasing material into the cytoplasm, may be used to avoid degradation of the complex by intracellular lysosomes.
(136) Defective retroviruses are well characterized for use as gene therapy vectors (for a review see Miller, A. D. (1990) Blood 76:271). Protocols for producing recombinant retroviruses and for infecting cells in vitro or in vivo with such viruses can be found in Current Protocols in Molecular Biology, Ausubel, F. M. et al. (eds.) Greene Publishing Associates, (1989), Sections 9.10-9.14 and other standard laboratory manuals. Examples of suitable retroviruses include pLJ, pZIP, pWE and pEM which are well known to those skilled in the art. Examples of suitable packaging virus lines include psiCrip, psiCre, psi2 and psiAm. Retroviruses have been used to introduce a variety of genes into many different cell types, including epithelial cells, endothelial cells, lymphocytes, myoblasts, hepatocytes, bone marrow cells, in vitro and/or in vivo.
(137) For use as a gene therapy vector, the genome of an adenovirus may be manipulated so that it encodes and expresses a nucleic acid of the invention (e.g., a nucleic acid encoding a PCSK9-binding sdAb), but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle. Suitable adenoviral vectors derived from the adenovirus strain Ad type 5 d1324 or other strains of adenovirus (e.g., Ad2, Ad3, Ad7 etc.) are well known to those skilled in the art. Recombinant adenoviruses are advantageous in that they do not require dividing cells to be effective gene delivery vehicles and can be used to infect a wide variety of cell types, including airway epithelium, endothelial cells, hepatocytes, and muscle cells.
(138) Adeno-associated virus (AAV) may be used as a gene therapy vector for delivery of DNA for gene therapy purposes. AAV is a naturally occurring defective virus that requires another virus, such as an adenovirus or a herpes virus, as a helper virus for efficient replication and a productive life cycle. AAV may be used to integrate DNA into non-dividing cells. Lentiviral gene therapy vectors may also be adapted for use in the invention.
(139) The present invention also relates to a method of producing the PCSK9-binding sdAbs of the present invention, comprising cultivating the above-mentioned host cells under conditions permitting expression of the sdAbs, and collecting (e.g., in the culture medium) the sdAbs expressed from the cell population. In an embodiment, the method further comprises submitting the collected sdAbs to one or more steps of enrichment/purification.
(140) Pharmaceutical Compositions
(141) In another aspect, the present invention provides a composition, e.g., a pharmaceutical composition, containing one or a combination of PCSK9-binding sdAbs of the present invention, formulated together with a pharmaceutically acceptable carrier and/or excipient.
(142) Such compositions may include one or a combination of (e.g., two or more different) sdAbs. For example, a pharmaceutical composition of the invention can comprise a combination of PCSK9-binding sdAbs that bind to different epitopes on the target antigen and/or that have complementary activities.
(143) Pharmaceutical compositions of the invention also can be administered in combination therapy, i.e., combined with other agents. For example, the combination therapy can include a PCSK9-binding sdAb combined with at least one other cholesterol-reducing agent. Examples of therapeutic agents that can be used in combination therapy are described in greater detail below.
(144) As used herein, pharmaceutically acceptable carrier or pharmaceutically acceptable excipient includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. The carrier should be suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active sdAb may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
(145) The pharmaceutical compounds of the invention may include one or more pharmaceutically acceptable salts. A pharmaceutically acceptable salt refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M. et al., 1977 J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and di-carboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
(146) A pharmaceutical composition of the invention also may include a pharmaceutically acceptable antioxidant. Examples of pharmaceutically acceptable antioxidants include: water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
(147) Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
(148) These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as, aluminum monostearate and gelatin.
(149) Pharmaceutically acceptable carriers or excipients include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
(150) Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, one can include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
(151) Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption for example, monostearate salts and gelatin.
(152) Sterile injectable solutions can be prepared by incorporating the active compound (e.g., PCSK9-binding sdAb) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
(153) The amount of active ingredient (e.g., PCSK9-binding sdAb) which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 percent to about ninety-nine percent of active ingredient, from about 0.1 percent to about 70 percent, or from about 1 percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier.
(154) Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
(155) For administration of the PCSK9-binding sdAb, the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight. For example dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months. Dosage regimens for PCSK9-binding sdAbs of the invention include 1 mg/kg body weight or 3 mg/kg body weight by intravenous administration, with the antibody being given using one of the following dosing schedules: every four weeks for six dosages, then every three months; every three weeks; 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
(156) In some methods, two or more sdAbs with different binding affinities and/or specificities are administered simultaneously, in which case the dosage of each sdAbs administered falls within the ranges indicated. The sdAb is usually administered on multiple occasions. Intervals between single dosages can be, for example, weekly, monthly, every three months or yearly. Intervals can also be irregular as indicated by measuring blood levels of sdAb in the patient. In some methods, dosage is adjusted to achieve a plasma concentration of the sdAb of about 1-1000 g/ml and in some methods about 25-300 g/ml.
(157) Alternatively, a PCSK9-binding sdAb can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the sdAb in the patient. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated or until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
(158) Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response (e.g., decreased plasma LDL/cholesterol levels) for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
(159) A therapeutically effective amount or effective amount or therapeutically effective dosage of PCSK9-binding sdAbs of the invention can result in a lowering of LDL-C level in a subject, a decrease in severity of at least one disease symptom (e.g., a decrease in plasma LDL-cholesterol, or a decrease in a symptom of a LDL-cholesterol-related disorder), an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction in the subject.
(160) A composition of the present invention can be administered by one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Routes of administration for sdAb of the invention include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase parenteral administration as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion. Alternatively, a PCSK9-binding sdAb of the invention can be administered by a nonparenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
(161) The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978. Therapeutic compositions can be administered with medical devices known in the art. For example, in one embodiment, a therapeutic composition of the invention can be administered with a needleless hypodermic injection device.
(162) In certain embodiments, the sdAb of the invention can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds of the invention cross the BBB (if desired), they can be formulated, for example, in liposomes. The liposomes may comprise one or more moieties which are selectively transported into specific cells, tissues or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade, 1989 J. Clin. Pharmacol. 29:685). In an embodiment, the sdAb of the invention can be formulated to be delivered to the liver (i.e., to hepatocytes).
(163) Uses of the sdAbs
(164) PCSK9 has been implicated in cholesterol homeostasis, as it appears to have a specific role in cholesterol biosynthesis or uptake. In a study of cholesterol-fed rats, it was reported that PCSK9 was downregulated in a similar manner to other genes involved in cholesterol biosynthesis, (Maxwell et al., 2003 J Lipid Res. 44:2109-2119). PCSK9 expression has been found to be upregulated by statins in a manner attributed to the cholesterol-lowering effects of the drugs (Dubuc et al., 2004, Arterioscler Thromb Vasc Biol. 24: 1454-1459). Adenoviral expression of PCSK9 results in a time-dependent increase in circulating low density lipoprotein (LDL) cholesterol (LDL-C) (Benjannet et al., 2004 J. Biol. Chem. 279:48865-48875), and mice with PCSK9 gene deletions have increased levels of hepatic LDL receptors (LDLR) and clear LDL-C from the plasma more rapidly (Rashid et al., 2005 supra). Medium from HepG2 cells which are transiently transfected with PCSK9 is found to reduce the amount of cell surface LDLRs and internalization of LDL-C when transferred to untransfected HepG2 cells (Cameron et al., 2006 Human Mol. Genet. 15:1551-1558). Additionally, purified PCSK9 added to the medium of HepG2 cells reduced the number of cell-surface LDLRs in a dose- and time-dependent manner (Lagace et al., 2006, supra).
(165) A number of mutations in the gene PCSK9 have been associated with autosomal dominant hypercholesterolemia (ADH), an inherited metabolism disorder which is characterized by marked elevations of LDL-C particles in the plasma that can lead to premature cardiovascular failure (e.g., Abifadel et al, 2003 Nat. Genetics 34:154-156; Tirnms et al, 2004 Hum. Genetics 114:349-353; Leren, 2004 Clin. Genet. 65:419-422).
(166) Expression or upregulation of PCSK9 is associated with increased plasma levels of LDL-C, and inhibition or the lack of expression of PCSK9 is associated with low LDL-C plasma levels and lower levels of LDL-C associated with sequence variations in PCSK9 confer protection against coronary heart disease (Cohen, et al, 2006 N. Engl. J. Med. 354:1264-1272).
(167) The PCSK9-binding sdAbs described herein have in vitro and in vivo diagnostic and therapeutic utilities. For example, these molecules can be administered to cells in culture, e.g., in vitro or ex vivo, or in a subject in need thereof, e.g., in vivo, to treat, prevent or diagnose a variety of disorders associated with PCSK9 activity/function.
(168) PCSK9-binding sdAbs are particularly suitable for treating human patients having, or at risk for, elevated cholesterol or a condition associated with elevated cholesterol (e.g., LDL cholesterol), including a lipid disorder (e.g., hyperlipidemia, hypercholesterolemia, xanthomatosis).
(169) PCSK9-binding sdAbs may also be suitable for treating human patients having ateriosclerotic conditions (e.g., atherosclerosis), coronary artery disease, cardiovascular disease, stroke, ischemia, peripheral vascular diseases, and prophylactically for patients at risk for these disorders, e.g., due to the presence of one or more risk factors (e.g., hypertension, cigarette smoking, diabetes, obesity, or hyperhomocysteinemia).
(170) As used herein the terms LDL-cholesterol-related diseases or disorders refer to diseases or conditions resulting in part from a high level of circulating LDL-cholesterol in the blood stream. Without being so limited, LDL-cholesterol-related diseases or disorders include hyperlipidemia, hypercholesterolemia, xanthomatosis and cardiovascular diseases such as ateriosclerotic conditions (e.g., atherosclerosis), coronary artery disease, cardiovascular disease, stroke, ischemia, peripheral vascular diseases.
(171) When PCSK9-binding sdAbs are administered together with another agent, the two can be administered sequentially in either order or simultaneously (in the same composition or in different compositions). In some embodiments, a PCSK9-binding sdAb is administered to a subject who is also receiving therapy with a second agent useful for treating the disease/condition (e.g., a second cholesterol-reducing agent). Cholesterol reducing agents include statins, bile acid sequestrants, niacin, fibric acid derivatives, and long chain alpha, omego-dicarboxylic acids. Statins inhibit cholesterol synthesis by blocking HMGCoA, a key enzyme in cholesterol biosynthesis. Bile acid sequestrants interrupt the recycling of bile acids from the intestine to the liver. Examples of active ingredients that may be administered in combination with of the present invention include, but are not limited to, other compounds which improve a patient's lipid profile, such as (a) HMG-CoA reductase inhibitors, (e.g., statins, including lovastatin, simvastatin, fluvastatin, rosuvastatin, pravastatin, rivastatin, atorvastatin, itavastatin, pitavastatin, cerivastatin and other statins), (b) cholesterol absorption inhibitors, such as stenol esters, beta-sitosterol, sterol glycosides such as tiqueside; and azetidinones, such as ezetimibe, (c) inhibitors of cholesterol ester transport protein (CETP) (e.g., anacetrapib or dalcetrapib) which are now in clinical trials to increase HDL and decrease LDL cholesterol, (d) niacin and related compounds, such as nicotinyl alcohol, nicotinamide, and nicotinic acid or a salt thereof, (e) bile acid sequestrants (cholestyramine, colestipol (e.g., colestipol hydrochloride), dialkylaminoalkyl derivatives of a cross-linked dextran, Colestid, LoCholest, (f) acyl CoA:cholesterol acyltransferase (ACAT) inhibitors, such as avasimibe and melinamide, and including selective ACAT-1 and ACAT-2 inhibitors and dual inhibitors, (g) PPARy agonists, such as gemfibrozil and fenofibric acid derivatives (fibrates), including clofibrate, fenofibrate, bezafibrate, ciprofibrate, and etofibrate, (h) microsomal triglyceride transfer protein (MTP)/ApoB secretion inhibitors, (i) anti-oxidant vitamins, such as vitamins C and E and beta carotene, (k) thyromimetics, (l) LDL receptor inducers, (m) platelet aggregation inhibitors, for example glycoprotein IIb/IIIa fibrinogen receptor antagonists and aspirin, (n) vitamin B 12 (also known as cyanocobalamin), (o) folic acid or a pharmaceutically acceptable salt or ester thereof, such as the sodium salt and the methylglucamine salt, (p) FXR and LXR ligands, including both inhibitors and agonists, (q) agents that enhance ABCA1 gene expression, and (r) ileal bile acid transporters.
(172) A combination therapy regimen may be additive, or it may produce synergistic results (e.g., reductions in cholesterol greater than expected for the combined use of the two agents). In some embodiments, combination therapy with a PCSK9-binding sdAb and a cholesterol-reducing agent (e.g., a statin, fibrates, ezetimibe or a combination thereof) produces synergistic results (e.g., synergistic reductions in cholesterol). In some subjects, this can allow reduction in the dosage of the cholesterol-reducing agent to achieve the desired cholesterol levels. PCSK9-binding sdAbs may be useful for subjects who are intolerant to therapy with another cholesterol-reducing agent, or for whom therapy with another cholesterol-reducing agent has produced inadequate results (e.g., subjects who experience insufficient LDL-C reduction on statin therapy).
(173) A PCSK9-binding sdAb described herein can be administered to a subject with elevated cholesterol (e.g., LDL-cholesterol) (e.g., a human subject with total plasma cholesterol levels of 200 mg/dl or greater, a human subject with LDL-C levels of 160 mg/dl or greater).
(174) In an embodiment, the PCSK9-binding sdAb of the invention can be used to detect levels of PCSK9. This can be achieved, for example, by contacting a sample (e.g., a biological sample such as blood, serum, plasma, or a cell sample) with the PCSK9-binding sdAb under conditions that allow for the formation of a complex between the PCSK9-binding sdAb and PCSK9. Any complexes formed between the molecule and PCSK9 are detected and compared in the sample and in a control sample. For example, standard detection methods, well known in the art, such as ELISA and flow cytometric assays, can be performed using the PCSK9-binding sdAb of the invention.
(175) Accordingly, in one aspect, the invention further provides methods for detecting the presence of PCSK9 (e.g., hPCSK9) in a sample, or measuring the amount of PCSK9 (e.g., active form of PCSK9), comprising contacting the sample with a PCSK9-binding sdAb of the invention, under conditions that allow for formation of a complex between the sdAb and PCSK9. The formation of a complex is then detected, wherein a difference in complex formation between the sample compared to a control sample is indicative of the presence of PCSK9 in the sample.
(176) Also within the scope of the invention are kits comprising a sdAb of the invention, or the compositions of the invention and instructions for use. The kit can further contain a least one additional reagent, or one or more additional sdAbs of the invention. Kits typically include a label indicating the intended use of the contents of the kit. The term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit. The kit may further comprise one or more container(s), reagent(s), administration device(s) (e.g., a syringe).
(177) The invention having been fully described, it is further illustrated by the following examples and claims, which are illustrative and are not meant to be further limiting. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are within the scope of the present invention and claims. The contents of all references, including issued patents and published patent applications, cited throughout this application are hereby incorporated by reference.
MODE(S) FOR CARRYING OUT THE INVENTION
(178) The present invention is illustrated in further details by the following non-limiting examples.
Example 1: Production and Purification of Recombinant PCSK9 Protein
(179) PCSK9-(His).sub.6 was produced in large quantities from 35 L baculovirus High Five cells and subjected to multiple steps of purification including Ni.sup.2+-affinity followed by mono-Q anion exchange and finally gel filtration chromatography. Coomassie blue staining of 18 g total proteins from each preparation separated on a 4-12% gradient in MES buffer SDS-PAGE under non-reducing conditions are shown in
Example 2: Immunization of Llama with Purified PCSK9 Proteins
(180) Isolation from immune phage display library is the easiest way to generate high affinity sdAbs. This involves immunization of a llama with the antigen; monitor the immune response; construction of phage display library and subsequent phage display panning. Several injections of human purified PCSK9 heterodimer complexes formed of the prosegment (amino acids 31 to 152) and the catalytic subunit (amino acids 153 to 692) were used to immunize llama. Immunization response was monitored and characterized using reactivity against PCSK9.
Example 3: Screening for VHH Domains (sdAbs) Specific for PSCK9
(181) Using primers specific for both V.sub.H/V.sub.HH and the hinge regions of camelid IgGs, DNA encoding V.sub.H as well V.sub.HH was amplified. The V.sub.HH fragments were separated from V.sub.H based on their sizes. The V.sub.HH genes were amplified using primers specific for V.sub.HH and cloned into a phagemid-based phage display vector. More specifically, three different sense primers (called J and corresponding to the 5-end of IgG) including MJ1 (GCCCAGCCGGCCATGGCCSMKGTGCAGCTGGTGGAKTCTGGGGGA (SEQ ID NO: 144)), MJ2 (CAGCCGGCCATGGCCCAGGTAAAGCTGGAGGAGTCTGGGGGA (SEQ ID NO: 145)) and MJ3 (GCCCAGCCGGCCATGGCCCAGGCTCAGGTACAGCTGGTGGAGTCT (SEQ ID NO: 146)) and two anti-sense primers, corresponding to the CH2 domain DNA sequence, CH2 (CGCCATCAAGGTACCAGTTGA (SEQ ID NO: 147)) and CH2b3 (GGGGTACCTGTCATCCACGGACCAGCTGA (SEQ ID NO: 148)) were used to amplify the VH-CH1-Hinge-CH2 region of conventional IgG or V.sub.HH-Hinge-CH2. Amplified V.sub.HH products of approximately 600 bp from the primer combination J-CH2 were extracted from a 1% agarose gel and purified with a QIAquick Gel Extraction Kit (Qiagen) and the amplified products from primers J-CH2b3 were PCR purified. In a second PCR reaction, two primers, MJ7BACK (CATGTGTAGACTCGCGGCCCAGCCGGCCATGGCC (SEQ ID NO: 149)) and MJ8FOR (CATGTGTAGATTCCTGGCCGGCCTGGCCTGAGGAGACGGTGACCTGG (SEQ ID NO: 150)), were used to introduce SfiI restriction sites and to amplify the final sdAb fragments from the combined J-CH2 and J-CH2b3 amplified products. The final PCR product was digested with SfiI and ligated into pMED1 (A. Bell, et al. Cancer Letters 289:81-90) and transformed into E. coli TG1 (New England Biolabs, Ipswich, Mass.) by electroporation. A large number of transformations were performed to make a high diversity library. The actual size of the library was measured as 210.sup.8 independent transformants, exceeding the number of lymphocytes used for library construction. Helper phages M13KO7 (NEB) were added to exponentially grow a phagemid library to rescue the phage, meaning enabling the E. coli cells to produce all necessary proteins for phage particle auto-assembly by providing most required components missing in the phagemid constructs. Over a total of 2.310.sup.8 candidate llama sdAbs screened, 50 sdAbs that specifically bind PCSK9 were selected and further characterized.
Example 4: Expression and Purification of sdAbs Specific for PCSK9
(182) Following their selection, DNAs from the 47 sdAbs were subcloned into an expression vector, and recombinant proteins (r-proteins) were purified. Even though transfection of mammalian cells is a well-known technique that is widely used on a small scale for the production of microgram quantities of r-proteins, only recently this technique has been made possible at large-scale. Large-scale transfection of Human Embryonic Kidney 293 (HEK293), and to a lesser extent of Chinese Hamster Ovary (CHO) cells, is becoming a well established enabling technology allowing the production of milligram to grams quantities of r-proteins within a few days after cDNA cloning into an appropriate expression vector (Atkinson, A., Jack, G. W. (1973). Biochimica et Biophysica Acta, 308(7):41-52; Baldi, L., et al. (2007). Biotechnology Letters, 29(5): 677-684; Wurm, F., Bernard, A. (1999). Current Opinion in Biotechnology, 10(2):156-159). Combined with the use of expression vectors bearing the Epstein-Barr virus origin of replication (oriP), a 3-fold improvement in r-protein yield is generally obtained over a similar non-oriP vector (Berntzen, G. et al. (2005). Journal of Immunological Methods, 298(1-2): 93-104; Durocher, Y., Perret, S., Kamen, A. (2002). Nucleic Acids Research, 30(2):E9). When using a HEK293-EBNA1 cell line adapted to suspension culture in serum-free medium in combination with a highly potent expression plasmid vector, high level expression of recombinant proteins is usually obtained.
Example 5: Selection and Characterization of sdAbs Inhibiting the PCSK9-Dependent LDLR Degradation
(183) The 6His tagged sdAbs were overexpressed and purified from HEK293 cells in amounts of about 1 mg/L. In some experiments, culture medium collected from sdAb-V5 transfected HEK293 cells were used as source of sdAbs. Each sdAb was tested for its ability to inhibit the LDLR enhanced degradation of 1 g/ml of wild type PCSK9 added to the extracellular milieu of the human hepatocyte cell lines HepG2 and HuH7. As exemplified in HepG2 (
(184) As exemplified in Huh7 cells, the presence of selected sdAbs was also shown to prevent the activity of PCSK9 on LDLR at the cell surface by using flow cytometry analyses as described in Benjannet S. et al., 2010, supra. The inhibition of the PCSK9 function in these assays is detected by an increased number of positive cells which correlated with an increased expression of LDLR at the cell surface. The analyses were performed either using a purified form of PCSK9-WT protein (
(185) In
(186) Naive HuH7 cells were also incubated for 18 h in the absence [Cnt()] or presence of 0.5 ug/ml (6 nM) of PCSK9-D374Y (conditioned media from transfected HEK293 cells) alone [Cnt(+)] or mixed with 50 ug/ml (3 uM) of various purified llama sdAb (
(187) Conditioned media from HEK293 cells containing 30 ng (6 nM) of PCSK9-D374Y, alone or mixed with 3.5 ug (3 uM) of purified sdAbs(6His) was pre-incubated for 2 h at 37 C., followed by immunoprecipitation with 6.6 ug anti-His Ab-agarose beads overnight, at 4 C. Supernatants and material eluted from the beads were subjected to PAGE-SDS (6%) and Western blot analysis with anti-hPCSK9 Ab. Pull-down analyses show that an approximately 500 fold molar excess of PKF8 and P1.40 sdAbs over PCSK9-D374Y is able to bind approximately 90% of the PCSK9-D374Y protein (
(188) Huh7 cells were incubated in the absence or presence of 0.5 ug/ml (6 nM) of PCSK9-D374Y protein (conditioned media from transfected HEK293 cells), followed by the addition of 50 ug/ml (3 uM) of various purified llama sdAbs. Prior to addition to the cells, the mixtures were pre-incubated for 2 h at 37 C. Permeabilized or non-permeabilized HuH7 cells were analyzed by immunofluorescence. Cell nuclei were stained with DAPI (blue labeling), LDLR was stained with anti-LDLR Abs (green labeling). As shown in
(189) The sdAbs internalisation analysis is also performed by immunofluorescence. Huh7 cells were incubated for 18 hours with conditioned media collected from HEK293 cells either transfected with i) a control V5-CTL+6His vector, ii) with PCSK9 (D374Y or WT) devoid of V5 tag, or iii) with V5-tagged sdAbs. Huh7 cells were also incubated for 18 hours with various 2 h-preincubated mixtures of ii) and iii). The internalization of the V5-tagged sdAbs is followed by immunofluorescence analysis of the V5 tag under non-permeabilized (cell-surface localization of the sdAb) or permeabilized (intra-cellular localization of the sdAb) conditions using a mAb-V5 (Invitrogen)
(190) The sdAbs were also characterized using a Dil-LDL fluorescent uptake assay, as described in Poirier et al., J. Biol. Chem. 284: 28856-28864, 2009. The method consists of fluorescence measurement of the Dil-LDL cellular incorporation via LDLR internalization (a measurement of cell surface LDLR activity) into human hepatocyte derived HuH7 or HepG2 cell lines, in the presence or in the absence of PCSK9 purified proteins. The cells were incubated in a 96-well format with or without 10 g/ml of sdAbs for 2 h, and then Dil-LDL was added for an additional 2 h. Cellular uptake of Dil-LDL is measured using a fluorescence plate reader. The inhibition of the PCSK9 LDLR functional interaction is detected by an increase in the Dil-LDL fluorescence.
(191) In order to further test whether these sdAbs can also inhibit the function of a gain of function mutant D374Y of PCSK9, the cells were incubated with purified PCSK9-D374Y proteins and the antibodies activity was analyzed by using a Dil-LDL fluorescent uptake assay. The P1.40 sdAb was able to completely block the activity of PCSK9-D374Y on LDLR in HepG2 cells (
(192) Finally, the sdAbs are also tested on primary human hepatocytes in order to measure their effect on cell surface LDLR.
(193) The sdAb DNAs were sequenced.
Example 6: Characterisation of the sdAbs PCSK9 Interaction and sdAb Properties
(194) The PCSK9 domain which interacts with each sdAb, including P1.40, is determined by performing deletions and mutation analyses. This may be achieved, for example, by co-expressing 1) the cDNAs coding for each sdAb with 2) that of a construction allowing the expression of a specific PCSK9 domain (e.g., prosegment-V5, catalytic subunit-V5, CHRD-V5, etc.), sub fragment thereof, or PCSK9 mutant carrying a V5 tag sequence. The PCSK9 sdAb complex is pulled down with magnetic beads carrying a monoclonal antibody specific for the V5 sequence (mAb-V5). The sdAb is pulled down through its interaction with the PCSK9 domain, sub-fragment or mutant. The biochemical and biophysical properties of sdAbs selected are analyzed. Surface plasmon resonance (SPR) measures the affinities of the sdAbs to PCSK9. Different PCSK9 domains (e.g., prosegment, catalytic and CHRD domains) are used as antigens to assess domain specificity.
(195) Biophysical properties are other important features of drug candidates. Properties of sdAbs are assessed for 1) formation of aggregation; and 2) resistance to proteolytic degradation. Formation of aggregation is assessed by performing size exclusion chromatography of the samples. The aggregation's molecular weight is estimated based on protein standard run under the same conditions. Comparison of such masses with their calculated molecular weight would indicate whether they exist as monomer, oligomers or mixtures of multiple formats. Monomeric sdAbs are preferentially chosen for further development.
(196) The proteolytic stability of the isolated sdAbs may be assessed by treating the sdAbs with cathepsin B, thrombin or trypsin-like proteases, the three major proteases of human plasma.
Example 7: Possible Modifications of Selected PCSK9-Specific sdAbs
(197) A new protein screening approach, FAst Screening of Expression, biological-properties and Affinities (FASEBA) has recently been established (U.S. Provisional Patent Application No. 61/272,119, the priority of which is claimed in WO/2011/020183). This method employs a protein anchor to attach the to-be-screened protein candidates to a carrier protein, allows estimation of multiple properties of the proteins without any protein purification and enables screening a very large number of protein candidates. This new approach may be employed to further improve the properties of sdAbs.
(198) Affinity Maturation of sdAbs:
(199) The solved structures of sdAb-antibody complexes revealed that the CDR3 is dominantly involved in antigen binding. Improvement of sdAb affinities is achieved by mutating both CDR3 and other CDRs (CDR1 and CDR2). For CDR3, mutations are introduced so that at each position 50% of the residues are the original ones. For CDR1 and CDR2, this percentage is reduced to 25%. Differential treatment of these regions is based on the importance of the CDRs in antigen binding. Whereas a large number of residues are preserved in CDR3 to generate a library with a high percentage of binders, more randomness is introduced in CDR1 and CDR2 to enhance the binding mainly mediated by CDR3. Given the huge theoretical library size when all CDRs are engineered simultaneously, a better strategy is to engineer CDR3 and CDR1/CDR2 in succession. Such mutation libraries are first screened using the FASEBA method to exclude a high percentage of sdAbs with unsatisfactory features. The remaining sdAbs are analyzed for their affinity directly by SPR without protein purification. Those with improved affinities are purified and assessed for their biophysical properties.
(200) Humanization of sdAbs:
(201) Humanization is performed similarly as in affinity maturation but with a different library construction strategy. Sequences of sdAbs with satisfactory affinities are compared with consensus sequences of human V.sub.H, and key residues differing in camelid and human sdAbs are selected. A humanization library is constructed by replacing the camelid residues with human ones and screened using the FASEBA method to remove sdAbs with unsatisfactory properties. Affinity screening is not required as the CDRs remain the same.
(202) Fusion of the Engineered sdAbs to IgG4-Fc and Production of Fusion Proteins:
(203) The in vivo serum half lives of the sdAbs is extended by fusing them to human IgG4-Fc to generate IgG4 type. A large amount of such fusion protein (HCAbs-Fc) is produced in a transient mammalian expression system. The HCAbs-Fc is compared with its sdAb counterpart in functional affinities, biophysical features and ability/efficacy in inhibiting PCSK9 function.
Example 8: Characterisation of the Inhibition of PCSK9-Induced LDLR Degradation in Animal Models
(204) Drug candidates are then used in mice models expressing human PCSK9 to assess their ability in lowering plasma cholesterol levels in vivo.
(205) The PCSK9 sdAbs inhibitors are tested in mice overexpressing human PCSK9. Transgenic lines (Herbert, B., et al. (2010). Arteriosclerosis, Thrombosis, and Vascular Biology, 30 (7):1333-1339) that carry a 190 kb of human genomic DNA expressing human PCSK9 (WT, D374Y low or D374Y high) from its own promoter are constructed. Further crosses generate a mouse strain expressing the human PCSK9 transgene in a Pcsk9.sup./ Ldlr.sup.+/ background (Ldlr heterozygote). This eliminates interference through the endogenous expression of the mouse PCSK9 genes and increases their LDLc levels (
(206) Mouse Injections:
(207) The inhibitors (10 mg/Kg sdAb and 0.1-1 mg/Kg peptide) are injected intravenously to WT, Pcsk9.sup./, Ldlr.sup./ and Pcsk9-Tg mice, in 6 mice/genotype (
(208) Effect of Statin+sdAb:
(209) The combination of atorvastatin and the best sdAb is evaluated, as statins increase PCSK9 expression while lowering that of the LDLR (Dubuc, G., et al. (2004). Arteriosclerosis, Thrombosis, and Vascular Biology, 24(8): 1454-1459; Lakoski, S. G., et al. (2009). The Journal of Clinical Endocrinology and Metabolism, 94(7): 2537-2543), and it was shown that statins decrease even further LDLc of Pcsk9.sup./ mice (Rashid, S., et al. (2005). Proc Natl Acad Sci USA 102(15):5374-5379).
(210) Liver Steatosis:
(211) Pcsk9.sup./ mice are protected against liver steatosis following a high cholesterol diet (Zaid, A., et al. (2008). Hepatology, 48(2): 646-65). Therefore mice fed for 2 weeks with a diet containing 0.2% cholesterol, are then injected with the sdAb or saline, and at the optimal post-injection time when LDLc is at its lowest, their livers are analyzed for the accumulation (or lack of) of neutral lipids using Oil-Red-0 (Zaid, A., et al. (2008). Hepatology, 48(2): 646-65).
(212) Although the present invention has been described hereinabove by way of specific embodiments thereof, it can be modified, without departing from the spirit and nature of the subject invention as defined in the appended claims. In the claims, the word comprising is used as an open-ended term, substantially equivalent to the phrase including, but not limited to. The singular forms a, an and the include corresponding plural references unless the context clearly dictates otherwise.