Recombinant polypeptide
09862750 ยท 2018-01-09
Assignee
Inventors
Cpc classification
A61L15/60
HUMAN NECESSITIES
A61L27/227
HUMAN NECESSITIES
C12N15/70
CHEMISTRY; METALLURGY
A61L15/32
HUMAN NECESSITIES
C07K14/24
CHEMISTRY; METALLURGY
International classification
C07K14/00
CHEMISTRY; METALLURGY
A61L15/60
HUMAN NECESSITIES
A61L27/22
HUMAN NECESSITIES
C07K14/24
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
A61L15/32
HUMAN NECESSITIES
Abstract
The invention provides a chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer, wherein said at least one chaperone/usher family polypeptide monomer comprises an exogenous bioactive sequence.
Claims
1. A chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer, wherein said at least one chaperone/usher family polypeptide monomer comprises an exogenous bioactive sequence, and wherein said chaperone/usher family polymer is a polymeric pilus.
2. The chaperone/usher family polymer according to claim 1, wherein the bioactive sequence is: (a) substantially non-immunogenic; (b) selected from the group consisting of a cell adhesion recognition motif, a growth factor sequence motif and a protease site; or (c) comprised within said monomer at a site which is comprised within a loop structure upon folding of said polypeptide.
3. The chaperone/usher family polymer according to claim 1, wherein the monomer is: (a) a FG loop long family polypeptide monomer; or (b) a FG loop short family polypeptide monomer.
4. The chaperone/usher family polymer according to claim 1, wherein said polymer is a fraction 1 antigen polymer, and said at least one chaperone/usher family polypeptide monomer is a CAF1 polypeptide monomer.
5. The chaperone/usher family polymer according to claim 1, wherein the polymer comprises at least one further chaperone/usher family polypeptide monomer, wherein said further chaperone/usher family polypeptide monomer differs from said at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence by at least one amino acid.
6. The chaperone/usher family polymer according to claim 5, wherein the further chaperone/usher family polypeptide monomer: (a) is a chaperone/usher family polypeptide monomer without said exogenous bioactive sequence; (b) comprises an exogenous bioactive sequence that is distinct from said exogenous bioactive sequence of said at least one chaperone/usher family polypeptide monomer; or (c) comprises an exogenous bioactive sequence that is a cell adhesion recognition motif comprising the amino acid sequence PHSRN, wherein said exogenous bioactive sequence of said at least one chaperone/usher family polypeptide monomer is a cell adhesion recognition motif comprising the amino acid sequence RGD.
7. A hydrogel comprising the chaperone/usher family polymer according to claim 1.
8. The hydrogel according to claim 7, further comprising a cross linking agent.
9. A cell support scaffold comprising a hydrogel according to claim 7.
10. The cell support scaffold according to claim 9, wherein said scaffold is a 2D cell support scaffold or a 3D cell support scaffold.
11. A wound dressing or ocular implant comprising the hydrogel according to claim 7.
12. A method of treating damaged tissue in a subject in need thereof, comprising administering a hydrogel according to claim 7 to the subject, wherein the damaged tissue is a wound or an ocular injury.
13. The method according to claim 12, wherein said wound is a chronic wound or wherein said wound is an acute wound.
14. A method for producing a chaperone/usher family polymeric pilus comprising at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence, said method comprising: i) incorporating a nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence into an expression vector for expression in a host cell; and ii) transfecting a host cell with the expression vector; wherein said host cell is provided with a nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer and a nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer, and wherein the resulting transfected host cell produces a chaperone/usher family polymeric pilus including the monomer.
15. The method according to claim 14, wherein the bioactive sequence is: (a) substantially non-immunogenic; or (b) a cell adhesion recognition motif.
16. The method according to claim 14, wherein said chaperone/usher family polymeric pilus is a fraction 1 antigen polymer and said at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence is a CAF1 polypeptide monomer.
17. The method according to claim 16, wherein said nucleic acid molecule that encodes the CAF1 polypeptide monomer comprising an exogenous bioactive sequence has at least 70% identity to the nucleotide sequence of SEQ ID NO: 1.
18. The method according to claim 16, wherein said nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer encodes a periplasmic chaperone specific for CAF1 and wherein said nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer encodes an outer membrane usher protein specific for CAF1.
19. The method according to claim 18, wherein said nucleic acid molecule that encodes the periplasmic chaperone specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 2.
20. The method according to claim 18, wherein said nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 3.
21. The method according to claim 18, wherein said host cell is provided with the nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1 by: i) incorporating the nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1 into an expression vector for expression in the host cell; and ii) transfecting the host cell with the expression vector.
22. The method according to claim 21, wherein said expression vector further comprises the nucleic acid molecule that encodes a CAF1 polypeptide monomer comprising a cell adhesion recognition motif.
23. The method according to claim 18, wherein said host cell is provided with the nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 by: i) incorporating the nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 into an expression vector for expression in the host cell; and ii) transfecting the host cell with the expression vector.
24. The method according to claim 23, wherein said expression vector further comprises the nucleic acid molecule that encodes a CAF1 polypeptide monomer comprising a cell adhesion recognition motif and/or the nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1.
25. The method according to claim 14, wherein said host cell is further provided with a nucleic acid molecule that encodes an expression regulator specific for the chaperone/usher family polypeptide monomer.
26. The method according to claim 25, wherein said nucleic acid molecule that encodes an expression regulator specific for the chaperone/usher family polypeptide monomer encodes an expression regulator specific for CAF1.
27. The method according to claim 14, wherein said host cell is a bacterial cell.
28. An antifouling composition comprising a hydrogel including a fraction 1 antigen polymeric pilus.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) Embodiments of the invention are further described hereinafter with reference to the accompanying drawings, in which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
(65)
(66)
(67)
(68)
(69)
(70)
(71)
(72)
(73)
(74)
(75)
(76)
DETAILED DESCRIPTION
(77) The inventors have surprisingly identified that flexible protein nanofibres made from engineered chaperone/usher protein monomers can be used to create realistic cell microenvironments. The flexible protein nanofibres can be crosslinked with a non-toxic and non-immunogenic crosslinker to produce hydrogels in accordance with the invention. In one embodiment, the nanofibre hydrogel is composed of monomeric folding units which incorporate bioactive protein sequences. Preferably, the hydrogels are robust and protease resistant.
(78) Specifically, the inventors have identified that the chaperone/usher family of polymers, and in particular the FG loop long (FGL) family members, which comprise a single or mixed monomer subunit type(s), such as Yersinia pestis Caf1, Salmonella Saf1 and E coli Afa/Dr, show unexpected structural similarity to fibronectin, as illustrated in
(79) Using the Caf1 monomer fraction 1 antigen polymer as a model, the inventors have shown that the chaperone/usher family of polymers, and in particular the FG loop long (FGL) family members, exhibit cell attachment inhibition behaviour when formed into a hydrogel comprising naturally occurring chaperone/usher polymers such as fraction 1 antigen polymer (without any evidence of cell toxicity). This unexpected property of chaperone/usher polymers makes them particularly useful as antifouling agents, which can be used in antifouling compositions.
(80) However, unexpectedly, the inventors have found that incorporation of commonly used bioactive sequences, such as the cell adhesion motif RGDS (SEQ ID NO:39) from fibronectin, into chaperone/usher monomers such as CAF1, is enough to reverse the attachment inhibition which results in the production of chaperone/usher polymers, such as fraction 1 antigen polymer, which when formed into a hydrogel promote cell attachment, survival and proliferation (see
(81) The naturally occurring regions of the polymer of the invention therefore provide a surface into which specific bioactive sequences can be introduced, wherein the resultant polymer behaviour with regard to promoting cell attachment, survival and/or proliferation is determined by the specific bioactive sequence(s) incorporated therein. These properties provide significant advantages when the polymer of the invention is used, for example, in the fields of cell culture and regenerative medicine as there is complete freedom on which cell interactions may be promoted or inhibited (by way of incorporating different bioactive sequences into the polymer). Advantageously, the polymer of the invention can therefore be used to promote selective cell adhesion and/or selective interaction between the polymer and target components (e.g. peptides, proteins, crosslinking units, enzymes, antibodies, cells, reagents etc) with low or no background interaction between target components and the naturally occurring regions of the polymer.
(82) The inventors have surprisingly found that a chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence can retain its polymeric form. The inventors have exemplified this using mutated FG loop long family polypeptide monomers, specifically caf1 monomers (e.g. caf1 monomers comprising an exogenous (bioactive) sequence such as RGDS (SEQ ID NO:39), a FLAG tag, a His tag etc.). Chaperone/usher family polypeptide monomers were produced containing a range of different experimental exogenous sequences. In each case, these experimental monomers were shown to retain their ability to assume polymeric form and be surprisingly stable. This indicates that this feature of chaperone/usher family polypeptide monomers is not limited to a specific exogenous sequence but is more generally applicable.
(83) Advantageously, the chaperone/usher family polypeptide monomers of the invention can be used to generate a homogeneous or heterogeneous (i.e. mixed) polymer. By way for example, a mixed polymer may comprise naturally occurring and mutant monomers. Alternatively, a mixed polymer may comprise two distinct mutant monomers, optionally in the presence of naturally occurring monomers. The inventors have demonstrated the successful production of a mixed polymer comprising wildtype caf1 monomers and caf1 mutant forms (see for example
(84) The chaperone-usher (CU) proteins form long polymeric pili on the cell surface. The chaperone stabilizes monomers secreted into the periplasm and transfers them to the end of the growing polymeric pilus situated within the outer-membrane usher protein, which translocates the nascent polymers to the cell surface. The polymerization mechanism is termed donor strand exchange and was first described for the FimC-FimH chaperone-adhesin complex from uropathogenic Escherichia coli. The subunits are composed of a -sandwich immunoglobulin domain, in which, what would be the C-terminal -strand is displaced to the N terminus where it cannot complete the native fold. In vivo the subunit is first partially stabilized after secretion by insertion of a -strand from the chaperone. The final stable fold is achieved by the replacement of the chaperone parallel -strand by the spare anti-parallel -strand from the N terminus of the subsequent subunit, thus linking them to form a chain.
(85) Caf 1 (also known as fraction 1 antigen polymer) is a CU protein from the plague bacterium, Yersinia pestis, where it serves as a polymeric virulence factor and vaccine component. It is formed from monomers by a donor-strand exchange (DSE) mechanism as described above. Caf1 atypical polymers form a gelatinous capsule that is thought to protect the pathogen against phagocytosis.
(86) In vivo, expression, assembly and secretion of fraction 1 antigen polymer is performed via the classical chaperone-usher pathway (5) and is mediated by a group of four genes, which are organized in the caf operon. The fraction 1 antigen polymer (CAF1 monomer) is encoded by the caf1 gene which is temperature regulated by a transcriptional activator caf1R gene. A periplasmic chaperone, caf1M, is used for the assembly of F1 capsule produced by the plague pathogen Y. pestis and an outer membrane protein, the caf1A usher, works as an assembly platform/secretion machinery (see
(87) Caf1 was cloned and expressed by Miller and co-workers (8) from E. coli containing the recombinant low-copy plasmid pAH34L, which contains caf operon (
(88) Monomers
(89) In a first aspect the invention provides a chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence.
(90) Preferably the polypeptide is recombinant or synthetic, i.e. produced by recombinant or synthetic production techniques well known in the art.
(91) As used herein, the phrase a chaperone/usher family polypeptide monomer refers to a polypeptide subunit, preferably a major subunit, of a long polymeric protein fibre typically found on the surface of gram-negative bacteria, the biogenesis of which is controlled by the chaperone/usher pathway.
(92) Chaperone/usher family polypeptides can be separated into two groups based upon their higher order structure. The chaperone/usher family polypeptides of the invention may be FG loop long family members (also known as the atypical adhesion family). The FG loop long (FGL) family members comprise a single monomer subunit type. Yersinia pestis Caf1, Salmonella Saf1 and E coli Afa/Dr adhesion are examples FGL or atypical adhesion family monomer subunits, which form thin, difficult-to-image polymeric fibres. The FG loop short (FGS) family members (also known as the typical adhesion family), named after a structural feature of their chaperones, can be made up of up to six different monomeric subunits. The E coli Fim (Type 1 pilus) and Pap (P pilli) proteins are examples of FGS or typical adhesion family monomer subunits, which present a rod-like linear structure based upon a tightly wound helix of subunits. The chaperone/usher family polypeptide monomer of the invention may be a FG loop long (FGL) family member or a FG loop short (FGS) family member.
(93) The chaperone usher protein families share a basic immunoglobulin domain fold and thus can be seen to have structural homology. This is also reflected in their sequence homology. The level of homology is high amongst similarly structured proteins eg Pap and Fim families but across the wider family this homology decreases to levels that may be considered insignificant unless the 3D structural homology is also considered. A good description of the similarities and differences within the disparate chaperone usher protein family is provided in FIG. 2 of reference (18).
(94) Preferably the chaperone/usher family polypeptide monomer subunit is a Caf1 polypeptide monomer, a Saf1 polypeptide monomer, an Afa/Dr polypeptide monomer, a Fim A, H, G or F polypeptide monomer, or a Pap A, G, F, E or K polypeptide monomer.
(95) The amino acid sequence of a naturally occurring Caf1 polypeptide monomer, from Yersinia pestis, is shown in SEQ ID NO: 5. The sequence is approximately 150 amino acid residues in length. The polypeptide monomer is encoded by a Caf1 nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 1. Caf1 is synthesised with a 21 amino acid cleavable signal peptide, which is cleaved during translocation of the monomer across the inner membrane.
(96) The amino acid sequence of a naturally occurring Saf1 polypeptide monomer, from Salmonella, is shown in SEQ ID NO: 9. The sequence is approximately 145 amino acids in length. The polypeptide monomer is encoded by a Saf1 nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 10.
(97) The amino acid sequence of a naturally occurring Afa/Dr polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 11. The sequence is approximately 140 amino acids in length. The polypeptide monomer is encoded by an Afa/Dr nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 12.
(98) The amino acid sequence of a naturally occurring Fim A polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 13. The sequence is approximately 150 amino acids in length. The polypeptide monomer is encoded by a Fim A nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 14.
(99) The amino acid sequence of a naturally occurring Fim H polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 25. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Fim H nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 26.
(100) The amino acid sequence of a naturally occurring Fim G polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 27. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Fim G nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 28.
(101) The amino acid sequence of a naturally occurring Fim F polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 29. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Fim F nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 30.
(102) The amino acid sequence of a naturally occurring Pap A polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 15. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Pap A nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 16.
(103) The amino acid sequence of a naturally occurring Pap G polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 31. The sequence is approximately 300 amino acids in length. The polypeptide monomer is encoded by a Pap G nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 32.
(104) The amino acid sequence of a naturally occurring Pap F polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 33. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Pap F nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 34.
(105) The amino acid sequence of a naturally occurring Pap E polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 35. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Pap E nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 36.
(106) The amino acid sequence of a naturally occurring Pap K polypeptide monomer, from Escherichia coli, is shown in SEQ ID NO: 37. The sequence is approximately between 150 and 200 amino acids in length. The polypeptide monomer is encoded by a Pap K nucleic acid molecule having the nucleotide sequence as shown in SEQ ID NO: 38.
(107) As used herein, the term nucleic acid molecule includes DNA molecules (e.g., a cDNA or genomic DNA) and RNA molecules (e.g., a mRNA) and analogs of the DNA or RNA generated, e.g., by the use of nucleotide analogs. The nucleic acid molecule can be single-stranded or double-stranded, but preferably is double-stranded DNA.
(108) As used herein, naturally-occurring refers to a polypeptide sequence that occurs in nature or to a nucleic acid molecule, e.g. a RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein). Said nucleic acid molecules include an open reading frame encoding protein, and can further include non-coding regulatory sequences and introns. The terms naturally-occurring and wildtype are used interchangeably herein.
(109) As used herein, the term exogenous refers to a heterologous polypeptide or nucleic acid sequence which is not present or naturally occurring within a chaperone/usher family polypeptide monomer sequence. It should be noted that the exogenous polypeptide or nucleic acid sequence may comprise a polypeptide or nucleic acid sequence which is identical or partially homologous to an endogenous polypeptide sequence or nucleic acid sequence of the cell. The term endogenous as used herein refers to any polypeptide or nucleic acid sequence which is present and/or naturally occurring in a chaperone/usher family polypeptide monomer sequence.
(110) Within one aspect of the invention, the chaperone/usher family polypeptide monomer comprises an exogenous sequence. The exogenous sequence may be a bioactive sequence or any other desired exogenous sequence.
(111) As used herein, bioactive sequence refers to a peptide sequence which has a specific biological function. Bioactive sequences are well known in the art and may be derived from any naturally occurring polypeptide including ECM components, cell adhesion molecules, cell surface receptors, growth factors, cytokines, chemokines, etc. For example, the bioactive sequence may mediate cell adhesion (or cell attachment), cell growth and/or cell differentiation (or induction of a cellular phenotype).
(112) In a preferred embodiment the bioactive sequence is a cell adhesion recognition motif, a growth factor sequence motif or a protease site.
(113) Preferably, the cell adhesion recognition motif is an extracellular matrix cell adhesion recognition motif, for example a motif derived from an extracellular matrix component such as collagen, elastin, fibronectin, laminin, osteopontin vitronectin or tenascin. Preferably, the cell adhesion recognition motif is derived from fibronenctin and comprises the amino acid sequence RGD (Arg-Gly-Asp), more preferably RGDS (Arg-Gly-Asp-Ser) (SEQ ID NO:39). Alternatively, the cell adhesion recognition motif is derived from fibronenctin and comprises the amino acid sequence PHSRN (Pro-His-Ser-Arg-Asn) (SEQ ID NO:40).
(114) Alternatively, the cell adhesion recognition motif is derived from Collagen I and comprises the amino acid sequence GTPGPQGIAGQRGVV (SEQ ID NO:41). Alternatively, the cell adhesion recognition motif is derived from Collagen IV and comprises the amino acid sequence MNYYSNS (SEQ ID NO:42). Alternatively, the cell adhesion recognition motif is derived from Laminin and comprises the amino acid sequence YIGSR (SEQ ID NO:43). Alternatively, the cell adhesion recognition motif is derived from Laminin and comprises the amino acid sequence IKVAV (SEQ ID NO:44). Alternatively, the cell adhesion recognition motif is derived from Fibronectin and comprises the amino acid sequence FHRRIKA (SEQ ID NO:45). Alternatively, the cell adhesion recognition motif is derived from Fibronectin and comprises the amino acid sequence LDVP (SEQ ID NO:46). Alternatively, the cell adhesion recognition motif is derived from Fibronectin and comprises the amino acid sequence IDAP (SEQ ID NO:47).
(115) Alternatively, the bioactive sequence is a growth factor sequence motif derived from Adrenomedullin (AM), Angiopoietin (Ang), Autocrine motility factor, Bone morphogenetic proteins (BMPs), Brain-derived neurotrophic factor (BDNF), Epidermal growth factor (EGF), Erythropoietin (EPO), Fibroblast growth factor (FGF), Glial cell line-derived neurotrophic factor (GDNF), Granulocyte colony-stimulating factor (G-CSF), Granulocyte macrophage colony-stimulating factor (GM-CSF), Growth differentiation factor-9 (GDF9), Hepatocyte growth factor (HGF), Hepatoma-derived growth factor (HDGF), Insulin-like growth factor (IGF), Migration-stimulating factor, Myostatin (GDF-8), Nerve growth factor (NGF) and other neurotrophins, Platelet-derived growth factor (PDGF), Thrombopoietin (TPO), Transforming growth factor alpha (TGF-), Transforming growth factor beta (TGF-), Tumor_necrosis_factor-alpha (TNF-), Vascular endothelial growth factor (VEGF), Wnt Signaling Pathway, placental growth factor (PIGF), Foetal Bovine Somatotrophin (FBS), IL-1Cofactor for IL-3 and IL-6 (activates T cells), IL-2T-cell growth factor (stimulates IL-1 synthesis, activates B-cells and NK cells), IL-3 (stimulates production of all non-lymphoid cells); IL-4Growth factor (for activated B cells, resting T cells, and mast cells), IL-5 (induces differentiation of activated B cells and eosinophils), IL-6 (stimulates Ig synthesis, growth factor for plasma cells), IL-7 (growth factor for pre-B cells), Neurone growth factor (NGF), Fibroblast growth factor (FGF) or Bone morphogenic protein 2 (BMP), e.g. a bioactive sequence comprising KIPKASSVPTELSAISTLYL (SEQ ID NO:48).
(116) Alternatively, the bioactive sequence is a protease site derived from known matrix metalloproteinase cleavage sites.
(117) In a preferred embodiment, the chaperone/usher family peptide monomer comprising the bioactive sequence is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of any one of SEQ ID NO's: 5, 9, 11, 13, 15, 25, 27, 29, 31, 33, 35 and 37.
(118) The chaperone/usher family peptide monomer comprising the bioactive sequence of the invention exhibits the biological activity of the bioactive sequence whilst retaining chaperone/usher family monomer activity, e.g. the ability to form a polymeric protein fibre.
(119) Calculations of sequence homology or identity (the terms are used interchangeably herein) between sequences are performed as follows.
(120) To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 75%, 80%, 82%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid identity is equivalent to amino acid or nucleic acid homology). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
(121) The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman et al. (1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a BLOSUM 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred set of parameters (and the one that should be used if the practitioner is uncertain about what parameters should be applied to determine if a molecule is within a sequence identity or homology limitation of the invention) are a BLOSUM 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
(122) The percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of Meyers et al. (1989) CABIOS 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
(123) Preferably, the bioactive sequence is comprised within the chaperone/usher family polypeptide at a site which is comprised within a loop structure upon folding of said polypeptide. Loop regions suitable for insertion of amino acids occur adjacent to amino acid residues 1, 15, 27-40, 51-58, 64-69, 77-82, 92-117, 127-135 of the naturally occurring Caf1 polypeptide. Examples of suitable insertion sites for Caf1 are shown in
(124) Preferably the chaperone/usher polypeptide monomer further comprises an affinity tag, inserted in any one of the aforementioned loop sites, but preferably at the N-terminus (or C-terminus) of the polypeptide.
(125) Preferably, the chaperone/usher family polypeptide monomer comprises two or more bioactive sequences, as hereinbefore described.
(126) Polymers
(127) In one aspect the invention relates to a chaperone/usher family polymer comprising at least one chaperone family polypeptide monomer according to the invention.
(128) As used herein chaperone/usher family polymer refers to a long polymeric protein fibre, typically found on the surface of gram-negative bacteria comprising monomeric polypeptide subunits, the biogenesis of which is controlled by the chaperone/usher pathway.
(129) The polymer may be a mixed polymer (i.e. a polymer comprising two or more distinct monomer units; e.g. a naturally occurring Caf1 monomer and a caf1 monomer comprising an exogenous bioactive sequence).
(130) Preferably, the chaperone/usher family polymer according to the invention comprises at least one further chaperone/usher family polypeptide monomer, wherein said further chaperone/usher family polypeptide monomer differs from said at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence by at least one amino acid. More preferably, the further chaperone/usher family polypeptide monomer is the chaperone/usher family polypeptide monomer as described above without said exogenous bioactive sequence.
(131) Mixed polymers have a number of advantages. For example, a mixed polymer may only include a low density of active motifs (e.g. monomers comprising exogenous bioactive sequences), interspersed with inactive monomers (e.g. naturally occurring monomers or monomers lacking exogenous bioactive sequences). The low density of active motifs in the polymer may be sufficient to promote the desired biological activity (e.g. promote cell adhesion to the polymer). Using mixed monomer subunits to generate the polymer can improve expression levels of the polymer if the monomer comprising the active motif (e.g. the exaogenous bioactive sequence) is slow to assemble in the secretion pathway.
(132) In certain applications it may be preferred that the monomer and/or polymers of the invention are substantially non-immunogenic. Many of the uses to which polymers may be put, for example as scaffolds for cell growth in vivo, such as in wound healing or ocular implant applications, will benefit from employing polymers that do not elicit an immune response.
(133) The polymers of the invention may comprise substantially non-immunogenic chaperone/usher family polypeptide monomers. Alternatively, or additionally, the polymers of the invention may comprise exogenous bioactive sequences that are substantially non-immunogenic.
(134) In particular, polymers of the invention may comprise exogenous bioactive sequences that are derived from non-immunogenic sources. It will be appreciated that in this context a non-immunogenic source should be considered to be a source (such as a polypeptide from which the exogenous sequence is derived) that does not elicit an immune response in a subject to whom the polymer comprising the exogenous sequence may subsequently be administered. For example, in the case of a polymer to be administered to a human subject, a human polypeptide may be expected to provide a suitable non-immunogenic source of an exogenous polypeptide that is in turn substantially non-immunogenic. Accordingly, suitable examples of the polymers of the invention may comprise exogenous bioactive sequences that are derived from mammalian sources, such as human sources.
(135) Various assays by which immunogenicity (or otherwise) of polymers of the invention, or exogenous bioactive sequences or sources of such sequences, can be investigated will be well known to those skilled in the art, and it will be a simple matter for the skilled person to apply such assays.
(136) Suitable polymers of the invention may comprise chaperone/usher family polypeptide monomers that are free from, or substantially free from, naturally occurring adhesion motifs, such as cell adhesion motifs. In particular, such monomers may be free from, or substantially free from, sites that allow the adhesion of human cells.
(137) Alternatively polymers of the invention may comprise chaperone/usher family polypeptide monomers in which exogenous bioactive sequences provide the only cell adhesion (in particular human cell adhesion) motifs/sites. As discussed elsewhere in the present disclosure, the finding that certain chaperone/usher family polypeptides (such as Caf1) inhibit adhesion of human cells is both new and unexpected. It is also surprising that exogenous bioactive sequences comprising cell adhesion motifs can be incorporated in such otherwise non-adhesive monomers without adversely influencing the ability of these monomers to form polymers.
(138) Preferably, the chaperone/usher family polymer is a fraction 1 antigen polymer, comprising or consisting of naturally occurring CAF1 polypeptide monomers and/or a CAF1 polypeptide monomer comprising an exogenous (bioactive) sequence in accordance with the invention.
(139) As used herein fraction 1 antigen polymer or F1 polymer are used interchangeably to refer to a polymer of CAF1 monomer subunits. The polymer is typically expressed by Yersinia pestis. The polymers may be up to 1.5 micron in length and comprise in excess of 250 CAF1 monomers. Expression, assembly and secretion of the F1 polymer is performed via the classical chaperone usher pathway and is mediated by a group of four genes, which are organized in the caf operon. The F1 capsule structural subunit, the CAF1 monomer, is encoded by the caf1 gene, which is temperature regulated by a transcriptor activator caf1R gene. A periplasmic chaperone, caf1M, is used for the assembly of F1 capsule produced Y. Pestis and an outer membrane protein, the caf1A usher, serves as a assembly platform/secretion machinery, gene products (see
(140) Preferably, the fraction 1 antigen polymer of the invention contains at least one CAF1 polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention and at least one naturally occurring CAF1 polypeptide monomer (i.e. the polymer is a mixed polymer.)
(141) Alternatively, the chaperone/usher family polymer is a fraction 1 antigen polymer, comprising or consisting of naturally occurring CAF1 polypeptide monomers and/or a CAF1 polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention. Still more preferably the fraction 1 antigen polymer comprises or consists of a CAF1 polypeptide monomer comprising a cell adhesion recognition motif, such as RGD or PHSRN.
(142) Alternatively, the chaperone/usher family polymer is SAF1 polymer, comprising or consisting of naturally occurring SAF1 polypeptide monomers and/or a SAF1 polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention.
(143) Preferably, the SAF1 polymer of the invention contains at least one SAF1 polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention and at least one naturally occurring SAF1 polypeptide monomer.
(144) Alternatively, the chaperone/usher family polymer is a SAF1 polymer, comprising or consisting of naturally occurring SAF1 polypeptide monomers and/or a SAF1 polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention. Still more preferably the SAF1 comprises or consists of a SAF1 polypeptide monomer comprising cell adhesion recognition motif, such as RGD or PHSRN.
(145) Alternatively, the chaperone/usher family polymer is an Afa or Dr adhesion polymer, comprising or consisting of naturally occurring Afa/Dr polypeptide monomers and/or a Afa/Dr polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention.
(146) Preferably, the Afa/Dr polymer of the invention contains at least one Afa/Dr polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention and at least one naturally occurring Afa/Dr polypeptide monomer.
(147) Alternatively, the chaperone/usher family polymer is an Afa/Dr 1 polymer, comprising or consisting of naturally occurring Afa/Dr polypeptide monomers and/or an Afa/Dr polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention. Still more preferably the Afa/Dr comprises or consists of an Afa/Dr polypeptide monomer comprising cell adhesion recognition motif, such as RGD or PHSRN.
(148) Preferably the chaperone/usher family polymer comprises or consists of a chaperone/usher family polypeptide monomer comprising cell adhesion recognition motif, such as RGD or PHSRN. Alternatively said polymer comprises a polypeptide monomer comprising a growth factor sequence motif or a protease site.
(149) Still more preferably, the chaperone/usher family polymer comprises a first chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention and a second chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence in accordance with the invention, wherein said first and second monomers comprise distinct exogenous bioactive sequences. The bioactive sequence is preferably selected from a cell adhesion recognition motif, a growth factor sequence motif or a protease site. Still more preferably, the chaperone/usher family polymer further comprises a naturally occurring chaperone/usher family polypeptide monomer.
(150) Preferably, where the chaperone/usher family polymer has properties which affect cell growth, such as the Afa type polymer, then it may be useful to modify the wild type polymer to remove this activity prior to incorporation of the exogenous bioactive sequence.
(151) Hydrogels
(152) In one aspect the invention provides a hydrogel comprising or consisting of a chaperone/usher family polypeptide monomer according to the invention or a chaperone/usher family polymer according to the invention.
(153) As used herein, the term hydrogel refers to a water-swellable polymeric matrix, consisting of a network of macromolecules held together by covalent crosslinks. The matrix can absorb a substantial amount of water to form an elastic gel. The hydrogel swelling can be affected by conditions in which the hydrogel is placed, such as by pH, temperature, and the local ion concentration and type. Preferably, the hydrogel is insoluble.
(154) The swollen state of a hydrogel may be characterized by several parameters, including the swelling ratio under changing conditions, the permeability coefficient of certain solutes, and the mechanical behavior of the hydrogel under conditions of its intended use.
(155) Preferably, the monomers and/or polymers of the hydrogel are crosslinked so as to provide structure and physical integrity to the matrix. The cross linking may be due to chemical, physical, or radiation crosslinking.
(156) In the case of physical crosslinking, the linking may result from hydrogen bonding, Van der Waals interactions, ionic bonding, or combinations thereof. Physical cross linking may be initiated by mixing two precursors that are physically separated until combined in situ or as a consequence of a prevalent condition in the physiological environment, including temperature, pH, ionic strength, combinations thereof.
(157) Chemical (covalent) crosslinking may be accomplished by any of a number of mechanisms including, but not limited to, free radical polymerization, condensation polymerization, anionic or cationic polymerization, step growth polymerization, electrophile-nucleophile reactions or combinations thereof.
(158) Radiation crosslinking may be achieved by any number of mechanisms including, but not limited to, exposing the hydrogel article to at least one of visible light radiation, infrared radiation, ultraviolet radiation, electron beam radiation, gamma radiation, or x-ray radiation.
(159) Typically, the polymer constituents are cross-linked via chemical or physical processes such that they form a mesh-like insoluble polymer network.
(160) Preferably, the hydrogel comprises a cross linking agent. These crosslinking agents may comprise for example monoaldehydes, dialdehydes, sodium hypochlorite, diisocyanates, dicarboxylic acid halides and chlorinated epoxides.
(161) Preferably, the crosslinking agent comprises Poly(ethylene glycol) (PEG). PEG is a chemical compound composed of repeating ethylene glycol units and has been explored as a cell scaffold as well as in drug delivery devices and establishing therapeutic proteins. However, PEG by itself is non-reactive, non-toxic, non-immunogenic, soluble and highly flexible to create insoluble networks, it requires end-functionalization with cross-linking groups. A number of chemistries have been developed for the functionalization of PEG including the addition of acrylate, thiol, amine, maleimide or vinyl sulfone reactive groups. As cross-linked networks, these materials are non-degradable under physiological conditions. Polyethylene glycol spacer arms have a defined structure and molecular weight which ensures reproducible protein-modification effects. Moreover, it provides high stability, reduced tendency toward aggregation and immunogenicity even at high molecular weights.
(162) More preferably the crosslinking agent is a 4-arm PEG succinimidyl carboxy methyl ester, as illustrated in
(163) Other possible crosslinkers include but are not limited to: (i) the linear homobifunctional, short spacer arm, DTSSP (Sulfo-DSP) (3,3-Dithiobis[sulfosuccinimidylpropionate]) with molecular weight of 608.51 and a spacer arm with approximately of 12.0 . DTSSP is water-soluble and thiol-cleavable (see
(164) Preferably the crosslinking agent is a biodegradable crosslinking agent. Advantageously such crosslinking agents make the hydrogel biodegradable or absorbable. As used herein, the term biodegradable refers to material or polymer that can be degraded, preferably adsorbed and degraded in a patient's body. Alternatively, the cross linking agent is a non-degradable cross linking agent.
(165) The skilled person would readily identify crosslinker to monomer/polymer ratios that are suitable in accordance with the present invention. By way of example, but not by way of limitation, ratios of 1:120, 1:5, 1:3, or 1:2 (monomer:crosslinker (w/w)) may be used.
(166) Uses
(167) The hydrogels and/or polymers of the invention can be used in cell culture. The inventors have surprisingly found that the presence of a chaperone/usher family polypeptide monomer of the invention (or the polymer of the invention) in hydrogels increases cell viability and reduces cell cytotoxicity.
(168) In one aspect the invention provides use of a hydrogel of the invention as a cell support scaffold.
(169) The term scaffold, as used herein, refers to any material that allows attachment of cells and subsequent proliferation and differentiation. Attachment, attach or attaches as used herein, refers to cells that adhere directly or indirectly to a substrate as well as to cells that adhere to other cells.
(170) The scaffolds of the invention may be fibres (i.e. 1 dimensional), cell culture plates (i.e. 2 dimensional), or matrices (i.e. 3 dimensional). 2 dimensional cell culture systems can provide the base for investigating cell and tissue morphogenesis, can also be used to examine how epigenetic factors affect physiological phenomena and to investigate the dynamic relationship between cell function and interactions with cellular microenvironment outside of the organism. 3 dimensional scaffolds can be used to recreate the native 3 dimensional structure of a tissue.
(171) The scaffolds of the invention are of particular use in cell-based assays and tissue culture systems.
(172) The scaffold may be unseeded and otherwise free of cells. Alternatively, the scaffold may be seeded with cells.
(173) The polymers and/or hydrogels of the invention have numerous biomedical applications. For example, the polymers and/or hydrogels of the invention may be used as material for the treatment of wounds, as vehicles for the release of drugs, or as coatings on the surface of medical devices.
(174) Accordingly, the polymers and/or hydrogels of the invention are of particular use in various therapeutic settings. In particular, the hydrogels of the invention may be used to deliver cells to a tissue in need thereof. In one embodiment, the scaffolds are used to deliver cells to the eye of a mammalian subject. Alternatively, the scaffolds of the invention may be used to deliver cells to a wound bed of a mammalian subject in need thereof.
(175) Accordingly, the invention provides the use of a hydrogel of the invention as a medicament.
(176) The invention also provides the use of a polymer of the invention as a medicament. The polymer of the invention may be used in a method of treating a wound, for example in wound healing, in an equivalent manner as described below for the hydrogel of the invention. Accordingly, the invention provides a polymer of the invention for use in treating a wound, e.g. a skin wound.
(177) Also provided is a method of treating a skin wound comprising implanting a hydrogel of the invention into the skin, skin wound or skin wound bed of a mammalian subject in need thereof. The method is of particular use in re-epithelialisation and of particular use in skin re-epithelialisation. The term re-epithelialisation relates to the repair, replacement, functional recovery and ultimate regeneration of damaged epithelium inside the body (including skin), or outside the body.
(178) There is also provided hydrogel of the invention for use in treating a skin wound.
(179) As used herein the term wound relates to damaged tissues, preferably damaged skin, where the integrity of the skin or tissue is disrupted as a result from i.e. external force, bad health status, aging, exposure to sunlight, heat or chemical reaction or as a result from damage by internal physiological processes. Wounds where the epithelium such as the epidermis is damaged are considered to be an open wound. Wound healing is the process of regenerating the covering cell layers of a tissue, preferably by re-epithelialisation or reconstruction.
(180) The introduction of a hydrogel capable of supporting normal skin cell attachment and migration and proliferation will help to accelerate wound healing by providing an immediate alternative substrate for unaffected skin cells at the wound margins to migrate across.
(181) The invention provides a method of treating an ocular injury comprising implanting a hydrogel of the invention into the eye of a mammalian subject in need thereof.
(182) There is also provided a hydrogel of the invention for use in treating an ocular injury.
(183) As used herein, the term ocular injury refers to conditions resulting in an insufficient stromal micro-environment to support stem cell function, for example aniridia, keratitis, neurotrophic keratopathy, Keratoconus, Meesman's dystrophy, Epithelial Basement Membrane Dystrophy and chronic limbitis; or conditions that destroy limbal stem cells such as Partial limbal stem cell deficiency, Total stem cell deficiency, Ocular herpes, chemical or thermal injuries, Stevens-Johnson syndrome, ocular cicatricial pemphigoid, contact lens wear, or microbial infection.
(184) There is also provided an ocular implant comprising a hydrogel of the invention.
(185) In one embodiment the hydrogel is seeded with cells, such as corneal cells or stem cells prior to implantation. Alternatively, the hydrogels may be seeded with cells after implantation. Preferably, said cells are autologous, i.e. said cells are derived from the individual to be treated or alternatively the cells may be non-autologous.
(186) The invention also provides a pharmaceutical composition comprising a hydrogel in accordance with the invention together with a pharmaceutically acceptable excipient, dilutent or carrier. In one embodiment the composition further comprises one or more of the following: growth factors, lipids, genes, etc., or compounds for altering the acidity/alkalinity (pH) of the wound, or compounds for altering the growth and performance of the transplanted cells and those at the margins of the wound/injury.
(187) The term pharmaceutically-acceptable carrier as used herein means one or more compatible solid or liquid fillers, diluents or encapsulating substances that are suitable for administration into a human. When administered, the pharmaceutical compositions of the present invention are administered in pharmaceutically acceptable preparations. Such preparations may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, cytokines and optionally other therapeutic agents, preferably agents for use in wound healing such as growth factors, peptides, proteolytic inhibitors, extracellular matrix components, steroids and cytokines. The term carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application. The term pharmaceutically acceptable means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients. The term physiologically acceptable refers to a non-toxic material that is compatible with a biological system such as a cell, cell culture, tissue, or organism. As used herein, a pharmaceutically acceptable carrier includes any conventional carrier, such as those described in Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co, Easton, Pa., 15.sup.th Edition (1975).
(188) In a further aspect there is provided a pharmaceutical composition in accordance with the invention for use as a medicament, for example, for use in treating ocular injury, corneal replacement or wound healing.
(189) The compositions or hydrogels of the invention are administered/for administration in effective amounts. An effective amount is the amount of a composition or hydrogel that alone, or together with further doses, produces the desired response. The compositions or hydrogels used in the foregoing methods preferably are sterile and contain an effective amount of the active ingredient for producing the desired response in a unit of weight or volume suitable for administration to a patient. The response can, for example, be measured by measuring the physiological effects of the composition or micro-organ cell composites upon the rate of or extent of wound healing or corneal repair.
(190) In a further aspect, the monomer and/or polymer of the invention may be used in or on cell culture apparatus (for example to promote cell adhesion to a surface of the cell culture apparatus). Accordingly, in one aspect, the invention provides cell culture apparatus (e.g. a cell culture vessel such as a petri-dish, multi-well plate or cell culture flask; or a coverslip used for cell culture) comprising a monomer and/or polymer according to the invention. Preferably, the monomer and/or polymer is comprised within a hydrogel according to the invention.
(191) Vectors
(192) The invention includes expression vectors for producing a recombinant chaperone/usher family polypeptide monomer. Preferably the expression vector comprises those genetic elements which are necessary for expression of the recombinant chaperone/usher family polypeptide monomer in a bacterial cell. The elements required for transcription and translation in the bacterial cell include a promoter, a coding region for a chaperone/usher family polypeptide monomer, and a transcriptional terminator.
(193) As used herein, the term expression vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. The vector can be capable of autonomous replication or it can integrate into a host DNA. The vector may include restriction enzyme sites for insertion of recombinant DNA and may include one or more selectable markers. The vector can be a nucleic acid in the form of a plasmid, a bacteriophage or a cosmid.
(194) Operably linked as used herein, refers to a single or a combination of the below-described control sequences together with a coding sequence in a functional relationship with one another, for example, in a linked relationship so as to direct expression of the coding sequence.
(195) Control elements as used herein, refers to, DNA or RNA elements that are capable of controlling gene expression. Examples of expression control sequences include promoters, enhancers, silencers, Shine Dalgarno sequences, TATA-boxes, internal ribosomal entry sites (IRES), attachment sites for transcription factors, transcriptional terminators, polyadenylation sites, RNA transporting signals or sequences important for UV-light mediated gene response. Preferably the expression vector includes one or more control elements operatively linked to the nucleic acid sequence to be expressed. Preferably, the control element is a transcription promoter element.
(196) Promoter and transcription promoter element, are used herein interchangeably to refer to the nucleotide sequences in DNA or RNA to which RNA polymerase binds to begin transcription. The promoter may be inducible or constitutively expressed. Alternatively, the promoter is under the control of a repressor or stimulatory protein. Preferably the promoter is a T7, T3, lac, lac UV5, tac, trc, [lambda]PL, Sp6 or a UV-inducible promoter. More preferably the promoter is a T7 or T3 promoter, known to be functional in bacteria, for example E. coli. In the wild type Caf operon the promoter is temperature sensitive allowing inexpensive induction of protein production. Coupling this with extra plasmids with other promoters will allow the different combinations of monomers to be controlled.
(197) Transcriptional terminator as used herein, refers to a DNA element, which terminates the function of RNA polymerases responsible for transcribing DNA into RNA. Preferred transcriptional terminators are characterized by a run of T residues preceded by a GC rich dyad symmetrical region. More preferably transcriptional terminators are terminator sequences from the T7 phage.
(198) The design of the expression vector depends on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, and the like. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or polypeptides.
(199) Expression vectors of the invention can be bacterial expression vectors, for example recombinant bacteriophage DNA, plasmid DNA or cosmid DNA, yeast expression vectors e.g. recombinant yeast expression vectors, vectors for expression in insect cells, e.g., recombinant virus expression vectors, for example baculovirus, or vectors for expression in plant cells, e.g. recombinant virus expression vectors such as cauliflower mosaic virus, CaMV, tobacco mosaic virus, TMV, or recombinant plasmid expression vectors such as Ti plasmids.
(200) Most preferably the vector is suitable for bacterial expression, e.g. for expression in Escherichia coli, Bacillus subtilis, Salmonella, Staphylocoocus, Streptococcus, etc.
(201) Preferably the vector is capable of propagation in the bacterial cell and is stably transmitted to future generations.
(202) Preferably, the vector is a bacterial expression vector. Preferably, the expression vector is a high-copy-number expression vector; alternatively, the expression vector is a low-copy-number expression vector, for example, a Mini-F plasmid.
(203) Preferably, the vector is a bacterial expression vector comprising a T7 promoter system. Alternatively, the vector is bacterial expression vector comprising a tac promoter system.
(204) More preferably, the vector is a pGem expression vector.
(205) In a preferred embodiment an expression vector of the invention comprises a nucleic acid molecule that encodes a recombinant chaperone/usher family polypeptide monomer, wherein said chaperone/usher family polypeptide monomer is a CAF1 polypeptide monomer, preferably a recombinant polypeptide monomer of the invention comprising a exogenous bioactive sequence, as hereinbefore described. Most preferably, the vector comprises a nucleic acid molecule that encodes a recombinant CAF1 polypeptide monomer, wherein said exogenous bioactive sequence is a cell adhesion recognition motif, as hereinbefore described.
(206) Alternatively, the vector of the invention comprises a nucleic acid molecule that encodes a recombinant chaperone/usher family polypeptide monomer, wherein said chaperone/usher family polypeptide monomer is a SAF1 polypeptide monomer, preferably a recombinant polypeptide monomer of the invention comprising an exogenous bioactive sequence, as hereinbefore described. Most preferably, the vector comprises a nucleic acid molecule that encodes a recombinant SAF1 polypeptide monomer, wherein said exogenous bioactive sequence is a cell adhesion recognition motif, as hereinbefore described.
(207) Alternatively, the vector of the invention comprises a nucleic acid molecule that encodes a recombinant chaperone/usher family polypeptide monomer, wherein said chaperone/usher family polypeptide monomer is an Afa/Dr polypeptide monomer, preferably a recombinant polypeptide monomer of the invention comprising an exogenous bioactive sequence, as hereinbefore described. Most preferably, the vector comprises a nucleic acid molecule that encodes a recombinant Afa/Dr polypeptide monomer, wherein said exogenous bioactive sequence is a cell adhesion recognition motif, as hereinbefore described.
(208) In a further embodiment, the expression vector further comprises a nucleic acid molecule that encodes a periplasmic chaperone specific for the recombinant chaperone/usher family polypeptide monomer.
(209) As used herein periplasmic chaperone specific for the recombinant chaperone/usher family polypeptide monomer refers to a periplasmic chaperone which is specific for the secretion of the recombinant chaperone/usher family polypeptide monomer. Preferably, within a cell, the periplasmic chaperone interacts with the recombinant chaperone/usher family polypeptide monomer, forming a stable chaperone-monomer complex, and facilitating release of the monomer from the cytoplasmic membrane. More preferably, the periplasmic chaperone interacts with the monomer by blocking an active site thereby preventing premature monomer-monomer interactions.
(210) Preferably, the vector comprises a nucleic acid molecule that encodes a recombinant CAF1 polypeptide monomer and a nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1, e.g. CAF1M.
(211) Preferably said nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1 encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:6.
(212) Alternatively, said nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1 comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:2.
(213) Alternatively, the vector comprises a nucleic acid molecule that encodes a recombinant SAF1 polypeptide monomer and a nucleic acid molecule that encodes a periplasmic chaperone specific for SAF1, e.g. SAFB.
(214) Preferably said nucleic acid molecule that encodes a periplasmic chaperone specific for SAF1 encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:17.
(215) Alternatively, said nucleic acid molecule that encodes a periplasmic chaperone specific for SAF1 comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:18.
(216) Alternatively, the vector comprises a nucleic acid molecule that encodes a recombinant Afa/Dr polypeptide monomer and a nucleic acid molecule that encodes a periplasmic chaperone specific for Afa/Dr, e.g. DraB.
(217) Preferably said nucleic acid molecule that encodes a periplasmic chaperone specific for Afa/Dr encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:19.
(218) Alternatively, said nucleic acid molecule that encodes a periplasmic chaperone specific for Afa/Dr comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:20.
(219) In a further embodiment, the expression vector further comprises a nucleic acid molecule that encodes an outer membrane usher protein specific for the recombinant chaperone/usher family polypeptide monomer.
(220) As used herein outer membrane usher protein specific for the recombinant chaperone/usher family polypeptide monomer refers to an outer membrane usher protein which is specific for the secretion of the recombinant chaperone/usher family polypeptide monomer. Preferably, the usher protein is capable of binding to a chaperone/monomer complex and initiating polymer assembly. Upon binding of the chaperone/monomer complex, the usher facilitates the dissociation of the monomer from the chaperone, thereby exposing an active site for monomer-monomer interaction. In this way the monomer grows through the usher as a linear fibre which is translocated to the cell surface.
(221) Preferably, the vector comprises a nucleic acid molecule that encodes a recombinant CAF1 polypeptide monomer and a nucleic acid molecule that encodes an outer membrane usher protein specific for CAF1, e.g. CAF1A.
(222) Preferably said nucleic acid molecule that encodes an outer membrane usher protein specific for CAF1 encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:7.
(223) Alternatively, said nucleic acid molecule that encodes an outer membrane usher protein specific for CAF1 comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:3.
(224) Preferably, the vector comprises a nucleic acid molecule that encodes a recombinant SAF1 polypeptide monomer and a nucleic acid molecule that encodes an outer membrane usher protein specific for SAF1, e.g. SAFC.
(225) Preferably said nucleic acid molecule that encodes an outer membrane usher protein specific for SAF1 encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:21.
(226) Alternatively, said nucleic acid molecule that encodes an outer membrane usher protein specific for SAF1 comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:22.
(227) Preferably, the vector comprises a nucleic acid molecule that encodes a recombinant Afa/Dr polypeptide monomer and a nucleic acid molecule that encodes an outer membrane usher protein specific for Afa/Dr e.g. DraC.
(228) Preferably said nucleic acid molecule that encodes an outer membrane usher protein specific for Afa/Dr encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:23. Alternatively, said nucleic acid molecule that encodes an outer membrane usher protein specific for Afa/Dr comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:24.
(229) In a further embodiment, the expression vector further comprises a nucleic acid molecule that encodes an expression regulator protein specific for the recombinant chaperone/usher family polypeptide monomer.
(230) As used herein an expression regulator protein specific for the recombinant chaperone/usher family polypeptide monomer refers to an expression regulator protein which is specific for the transcriptional regulation of the recombinant chaperone/usher family polypeptide monomer.
(231) Preferably, the vector comprises a nucleic acid molecule that encodes a recombinant CAF1 polypeptide monomer and a nucleic acid molecule that encodes an expression regulator protein specific for CAF1, e.g. CAF1R.
(232) Preferably said nucleic acid molecule that encodes an expression regulator protein specific for CAF1 encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:8.
(233) Alternatively, said nucleic acid molecule that encodes an expression regulator protein specific for CAF1 comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:4.
(234) Preferably, the vector comprises a nucleic acid molecule that encodes a recombinant SAF1 polypeptide monomer and a nucleic acid molecule that encodes an expression regulator protein specific for SAF1.
(235) Still more preferably, the vector comprises two or more nucleic acid molecules selected from the group consisting of: i) a nucleic acid molecule that encodes a periplasmic chaperone specific for the recombinant chaperone/usher family polypeptide monomer; ii) a nucleic acid molecule that encodes an outer membrane usher protein specific for the recombinant chaperone/usher family polypeptide monomer; and iii) a nucleic acid molecule that encodes an expression regulator protein specific for the recombinant chaperone/usher family polypeptide monomer.
(236) More preferably said nucleic acid molecule that encodes a recombinant CAF1 polypeptide monomer encodes a polypeptide comprising or consisting of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the polypeptide of SEQ ID NO:5. Alternatively, said nucleic acid molecule that encodes a recombinant CAF1 polypeptide monomer comprises or consists of a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical (e.g., identical to the entire length) to the nucleic acid molecule of SEQ ID NO:1.
(237) In another embodiment the expression vector comprises a nucleic acid molecule as described previously, comprising specific changes in the nucleotide sequence so as to optimize codons and mRNA secondary structure for translation in the host cell. Preferably, the codon usage of the nucleic acid is adapted for expression in the host cell, for example codon optimisation can be achieved using Calcgene, Hale, R S and Thomas G. Protein Exper. Purif. 12, 185-188 (1998), UpGene, Gao, W et al. Biotechnol. Prog. 20, 443-448 (2004), or Codon Optimizer, Fuglsang, A. Protein Exper. Purif. 31, 247-249 (2003). Amending the nucleic acid according to the preferred codon optimization can be achieved by a number of different experimental protocols, including, modification of a small number of codons, Vervoort et al. Nucleic Acids Res. 25: 2069-2074 (2000), or rewriting a large section of the nucleic acid sequence, for example, up to 1000 bp of DNA, Hale, R S and Thomas G. Protein Exper. Purif. 12, 185-188 (1998). Rewriting of the nucleic acid sequence can be achieved by recursive PCR, where the desired sequence is produced by the extension of overlapping oligonucleotide primers, Prodromou and Pearl, Protein Eng. 5: 827-829 (1992). Rewriting of larger stretches of DNA may require up to three consecutive rounds of recursive PCR, Hale, R S and Thomas G. Protein Exper. Purif. 12, 185-188 (1998), Te'o et al, FEMS Microbiol. Lett. 190: 13-19, (2000).
(238) Alternatively, the level of cognate tRNA can be elevated in the host cell. This elevation can be achieved by increasing the copy number of the respective tRNA gene, for example by inserting into the host cell the relevant tRNA gene on a compatible multiple copy plasmid, or alternatively inserting the tRNA gene into the expression vector itself. When using an E. coli expression system, E. coli host cells having enhanced expression of argU expression (for recognition of AGG/AGA) may be employed. In addition, host cells comprising tRNA genes for ilex (for recognition of AUA), leuW (for recognition of CUA), proL (for recognition of CCC) or glyT (for recognition of GGA) may also be employed, Brinkmann et al. Genes, 85, 109-114, (1989), Kane F J. Curr. Opin. Biotechnol. 6:494-500 (1995), Rosenburg et al, J. Bacteriol. 175, 716-722, (1993), Siedel et al, Biochemistry, 31, 2598-2608, (1992).
(239) Molecular techniques are well known for the preparation of expression vectors.
(240) The nucleic acid molecule for incorporation into the expression vector of the invention, as described above, can be prepared by synthesizing nucleic acid molecules using mutually priming oligonucleotides and the nucleic acid sequences described herein.
(241) A number of molecular techniques have been developed to operably link DNA to vectors via complementary cohesive termini. In one embodiment, complementary homopolymer tracts can be added to the nucleic acid molecule to be inserted into the vector DNA. The vector and nucleic acid molecule are then joined by hydrogen bonding between the complementary homopolymeric tails to form recombinant DNA molecules.
(242) In an alternative embodiment, synthetic linkers containing one or more restriction sites provide are used to operably link the nucleic acid molecule to the expression vector. In one embodiment, the nucleic acid molecule is generated by restriction endonuclease digestion as described earlier.
(243) Alternatively, a vector comprising ligation-independent cloning (LIC) sites can be employed. The required PCR amplified nucleic acid molecule can then be cloned into the LIC vector without restriction digest or ligation (Aslanidis and de Jong, Nucl. Acid. Res. 18, 6069-6074, (1990), Haun, et al, Biotechniques 13, 515-518 (1992).
(244) In order to isolate and/or modify the nucleic acid molecule of interest for insertion into the chosen plasmid, it is preferable to use PCR. Appropriate primers for use in PCR preparation of the sequence can be designed to isolate the required coding region of the nucleic acid molecule, add restriction endonuclease or LIC sites, place the coding region in the desired reading frame.
(245) In a preferred embodiment a nucleic acid molecule for incorporation into an expression vector of the invention is prepared by the use of the polymerase chain reaction as disclosed by Saiki et al (1988) Science 239, 487-491, using appropriate oligonucleotide primers. The coding region is amplified, whilst the primers themselves become incorporated into the amplified sequence product. In a preferred embodiment the amplification primers contain restriction endonuclease recognition sites which allow the amplified sequence product to be cloned into an appropriate vector.
(246) The expression vectors of the invention can contain a single copy of the nucleic acid molecule described previously, or multiple copies of the nucleic acid molecule described previously.
(247) Host Cells
(248) In one aspect the invention provides a host cell transformed or transfected with an expression vector of the invention.
(249) Host cell as used herein, refers to the particular subject cell and also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
(250) The host cell for use in the expression system of the present invention may be an aerobic cell or alternatively a facultative anaerobic cell. Preferably, the cell is a bacterial cell. Alternatively, the cell may be a yeast cell (e.g. Saccharomyces, Pichia), an algae cell, an insect cell, or a plant cell.
(251) Bacterial host cells include Gram-positive and Gram-negative bacteria. Suitable bacterial host cells include, but are not limited to the Gram-negative bacteria, for example a bacterium of the family Enterobacteria, most preferably Escherichia coli. E. Coli is the most preferred bacterial host cells for the present invention. Expression in E. Coli offers numerous advantages over other expression systems, particularly low development costs and high production yields. Cells suitable for high protein expression include, for example, E. coli W3110, the B strains of E. coli. E. coli BL21, BL21 (DE3), and BL21 (DE3) pLysS, pLysE, DH1, DH41, DH5, DH5I, DH5IF, DH5IMCR, DH10B, DhIOB/p3, DH1 IS, C600, HB101, JM101, JM105, JM109, JM110, K38, RR1, Y1088, Y1089, CSH18, ER1451, ER1647 are particularly suitable for expression. E. Coli K12 strains are also preferred as such strains are standard laboratory strains, which are non-pathogenic, and include NovaBlue, JM109 and DH5 (Novogen), E. Coli K12 RV308, E. Coli K12 C600, E. Coli HB101, see, for example, Brown, Molecular Biology Labfax (Academic Press (1991)).
(252) Standard techniques for propagating vectors in prokaryotic hosts are well-known to those of skill in the art (see, for example, Ausubel et al. Short Protocols in Molecular Biology 3.sup.rd Edition (John Wiley & Sons 1995)).
(253) To maximize recombinant protein expression in E. coli, the expression vectors of the invention may express the nucleic acid molecule incorporated therein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein (Gottesman, S., (1990) Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif., 119-128). Alternatively, the nucleic acid molecule incorporated into an expression vector of the invention, can be attenuated so that the individual codons for each amino acid are those preferentially utilized in E. coli (Wada et al., (1992) Nucleic Acids Res. 20:2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
(254) A host cell of the invention may be used in an expression system for producing a chaperone/usher family polymer.
(255) The expression vector of the present invention can be introduced into host cells by conventional transformation or transfection techniques.
(256) Transformation and transfection, as used herein, refer to a variety of techniques known in the art for introducing foreign nucleic acids into a host cell. Transformation of appropriate host cells with an expression vector of the present invention is accomplished by methods known in the art and typically depends on both the type of vector and host cell. Said techniques include, but are not limited to calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, chemoporation or electroporation.
(257) Techniques known in the art for the transformation of bacterial host cells are disclosed in for example, Sambrook et al (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.; Ausubel et al (1987) Current Protocols in Molecular Biology, John Wiley and Sons, Inc., NY; Cohen et al (1972) Proc. Natl. Acad. Sci. USA 69, 2110; Luchansky et al (1988) Mol. Microbiol. 2, 637-646. All such methods are incorporated herein by reference.
(258) Successfully transformed cells, that is, those cells containing the expression vector of the present invention, can be identified by techniques well known in the art. For example, cells transfected with the expression vector of the present invention can be cultured to produce a chaperone/usher family member. Cells can be examined for the presence of the expression vector DNA by techniques well known in the art. Alternatively, the presence of a chaperone/usher family member, or portion and fragments thereof can be detected using antibodies which hybridize thereto.
(259) In a preferred embodiment the invention comprises a culture of transformed host cells. Preferably the culture is clonally homogeneous.
(260) The host cell can contain a single copy of expression vectors of the invention described previously, or alternatively, multiple copies of expression vectors, i.e multiple copies of identical or non-identical expression vectors.
(261) Polymer Production
(262) A host cell transformed with an expression vector, comprising a nucleic acid molecule as hereinbefore described, can be used to produce (i.e., express) a chaperone/usher family polymer.
(263) In one aspect the invention provides a method for producing a chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence, said method comprising: i) incorporating a nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence into an expression vector for expression in a host cell; and ii) transfecting a host cell with the expression vector; wherein said host cell is provided with a nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer and a nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer and wherein the resulting transfected host cell produces a chaperone/usher family polymer.
(264) Preferably, the chaperone/usher family polymer is a fraction 1 antigen polymer, a SAF1 polymer or an Afa/Dr polymer, as hereinbefore described.
(265) Preferably, the nucleic acid molecule that encodes a recombinant chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence encodes a CAF1 polypeptide monomer, comprising an exogenous bioactive sequence, a SAF1 polypeptide monomer comprising an exogenous bioactive sequence or an Afa/Dr polypeptide monomer comprising an exogenous bioactive sequence, as hereinbefore described.
(266) Preferably, said bioactive sequence is a cell adhesion recognition motif, a growth factor sequence motif or a protease site, as hereinbefore described.
(267) Preferably, said periplasmic chaperone specific for the recombinant chaperone/usher family polypeptide monomer is a periplasmic chaperone specific for CAF1, SAF1 or Afa/Dr, as hereinbefore described.
(268) Preferably, said outer membrane usher protein specific for the recombinant chaperone/usher family polypeptide monomer is an outer membrane usher protein specific for CAF1, SAF1 or Afa/Dr, as hereinbefore described.
(269) Preferably the host cell is provided with the nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer by incorporating the nucleic acid molecule that encodes the periplasmic chaperone specific for the chaperone/usher family polypeptide monomer into an expression vector for expression in the host cell; and transfecting the host cell with the expression vector. The expression vector can be the same vector incorporating a nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer or a different expression vector.
(270) Preferably the host cell is provided with the nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer by incorporating the nucleic acid molecule that encodes the outer membrane usher protein specific for the chaperone/usher family polypeptide monomer into an expression vector for expression in the host cell; and transfecting the host cell with the expression vector. The expression vector can be the same vector incorporating the nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer and/or the nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer, or a different expression vector.
(271) Preferably, the host cell is further provided with a nucleic acid molecule that encodes an expression regulator specific for the chaperone/usher family polypeptide monomer. Preferably, said expression regulator specific for the recombinant chaperone/usher family polypeptide monomer is a periplasmic chaperone specific for CAF1, SAF1 or Afa/Dr, as hereinbefore described.
(272) Preferably the host cell is provided with the nucleic acid molecule that encodes an expression regulator specific for the chaperone/usher family polypeptide monomer by incorporating the nucleic acid molecule that encodes the expression regulator specific for the chaperone/usher family polypeptide monomer into an expression vector for expression in the host cell; and transfecting the host cell with the expression vector. The expression vector can be the same vector incorporating the nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer and/or the nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer and/or the nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer, or a different expression vector.
(273) The host cell can be any host cell. Preferably the host cell is a gram negative bacteria, as hereinbefore described.
(274) The present invention comprises an expression system for the large scale production of chaperone/usher family polymer, utilizing expression vectors of the invention as hereinbefore described. Preferably the expression system is an E. coli expression system.
(275) Transformed host cells of the invention or transformed host cells comprising the expression vectors of the invention are grown or cultured in the manner with which the skilled worker is familiar, depending on the host organism. As a rule, host cells are grown in a liquid medium comprising a carbon source, usually in the form of sugars, a nitrogen source, usually in the form of organic nitrogen sources such as yeast extract or salts such as ammonium sulfate, trace elements such as salts of iron, manganese and magnesium and, if appropriate, vitamins, at temperatures of between 0 C. and 100 C., preferably between 10 C. and 60 C., while gassing in oxygen.
(276) The pH of the liquid medium can either be kept constant, that is to say regulated during the culturing period, or not. The cultures can be grown batchwise, semi-batchwise or continuously. Nutrients can be provided at the beginning of the fermentation or fed in semi-continuously or continuously. The products produced can be isolated from the organisms by processes known to the skilled worker, for example by extraction, distillation, crystallization, if appropriate precipitation with salt, and/or chromatography.
(277) An overview of known cultivation methods can be found in the textbook by Chmiel (Bioprozetechnik 1. Einfhrung in die Bioverfahrenstechnik [Bioprocess technology 1. Introduction to Bioprocess technology] (Gustav Fischer Verlag, Stuttgart, 1991)) or in the textbook by Storhas (Bioreaktoren and periphere Einrichtungen [Bioreactors and peripheral equipment] (Vieweg Verlag, Brunswick/Wiesbaden, 1994)).
(278) The culture medium to be used must suitably meet the requirements of the strains in question. Descriptions of culture media for various microorganisms can be found in the textbook Manual of Methods for General Bacteriology of the American Society for Bacteriology (Washington D.C., USA, 1981).
(279) As described above, these media which can be employed in accordance with the invention usually comprise one or more carbon sources, nitrogen sources, inorganic salts, vitamins and/or trace elements.
(280) Transformed host cells can be cultured in aerobic or anaerobic conditions. In aerobic conditions, preferably, oxygen is continuously removed from the culture medium, by for example, the addition of reductants or oxygen scavengers, or, by purging the reaction medium with neutral gases.
(281) Techniques known in the art for the large scale culture of host cells are disclosed in for example, Bailey and Ollis (1986) Biochemical Engineering Fundamentals, McGraw-Hill, Singapore; or Shuler (2001) Bioprocess Engineering: Basic Concepts, Prentice Hall. All such techniques are incorporated herein by reference.
(282) The host cells of the invention can be cultured in a vessel, for example a bioreactor. Bioreactors, for example fermentors, are vessels that comprise cells or enzymes and typically are used for the production of molecules on an industrial scale. The molecules can be recombinant proteins (e.g. a chaperone/usher family polymer of the invention). Typically, cell based bioreactors comprise the cells of interest and include all the nutrients and/or co-factors necessary to carry out the reactions.
(283) Accordingly, the invention provides a method for producing a chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence comprising: i) providing a vessel comprising a host cell of the invention; as hereinbefore described; and ii) providing cell culture conditions which facilitate recombinant chaperone/usher family polypeptide monomer expression by a cell culture contained in the vessel; and optionally iii) collecting chaperone/usher family polymer from the vessel.
Examples
1. Experimental Overview
(284) 1.1 Subcloning of Caf1, Expression and Purification.
(285) The caf operon (about 5.2 Kb in size) was amplified by PCR (30 amplification cycles; 95 C. for 20 s, 55 C. for 10 s, 70 C. for 5 min) (PCR Express, Hybaid, UK) using oligonucleotide primer pair F1 Forward (5-ATA AAT CGG TTC AGT GGC CTC AAC GCT GTG-3) (SEQ ID NO:49) and F1 Reverse (5-GGT TAG GCT CAA AGT AGG ATA ATT C-3) (SEQ ID NO:50), the plasmid pAH34L (9) encoding caf operon ((GenBank, accession number AY450847) as a template and the KOD HOT START DNA polymerase (Novagen, UK) which generates blunt-ended fragments. The PCR product obtained was loaded on a 0.7% agarose gel stained with ethidium bromide (0.5 ug/MI). DNA was visualised on the trans-illuminator (UV light of wavelength 254 nm) (Gel-Doc Bio-RAD, UK). The PCR product of oligonucleotides which corresponds to the caf operon was excised from the agarose gel using a sterile scalpel blade. The extracted DNA band was purified with QIAquick gel extraction kit and QIAquick PCR purification kit (Qiagen, UK). After that DNA purified was loaded on a 0.7% agarose gel containing ethidium bromide (0.5 g/MI), visualised on the trans-illuminator and quantified using Quantity one software (Gel-Doc Bio-RAD, UK). Before subcloning the PCR product into a new vector, restriction analyses were performed to confirm the identity of the PCR product. Then, the purified PCR product was subcloned into a new vector. Initially, the inventors attempted to subclone caf operon into Psmart-HC-Amp and Psmart-LC-Kan vectors (Lucigen, USA). The copy number of Psmart-HC is similar to Puc19, about 300-500 copies per cell. The copy number of Psmart-LC is similar to Pbr322, about 15-30 copies per cell. The Psmart vectors are pre-digested, with blunt, dephosphorylated ends. The small size of the Psmart vectors (1.7-2.0 Kb) could facilitate subcloning and mutagenesis experiments of the large insert DNA. After DNA purification the PCR product must be treated with T4 polynucleotide kinase (10 U) (NEB, UK) to add 5-phosphates to oligonucleotides in order to allow subsequent ligation. In the cloneSmart ligation reaction, the pre-processed Psmart vector is ligated with blunt, phosphorylated insert (200 ng of insert). The positive control used was the lambda/HcII insert (500 ng) and the negative control without insert was also performed following the manufacturer's instructions and recommendations for the ligation (Lucigen, US). Transformants of E. coli 10 G chemically competent cells [F-mcrA D(mrr-hsdRMS-mcrBC) 80dlacZM15 lacX74 endA1 recA1araD139 (ara, leu)7697 galU galK rpsL nupG tonA] (Lucigen, USA) containing the new recombinant plasmid, were selected on LB agar plates containing the appropriate antibiotic for either Psmart HC-Amp and LC-Kan. The plates were incubated overnight at 37 C. Afterwards, improvements to subclone the caf operon were made such as increasing the incubation time to 24 hours at 4 C. A second attempt to subclone caf operon was conducted using pGem-T Easy (Promega, UK). The high copy number pGem-T Easy Vectors were prepared by cutting it with EcoR V and adding a 3 terminal thymidine to both ends. These single 3-T overhangs at the insertion site greatly improve the efficiency of ligation of a PCR product into the small size plasmids (3 Kb) by preventing re-circularization of the vector and providing a compatible overhang for PCR products (Promega, UK). The purified PCR product was modified using the A-tailing procedure, which adds a 3 terminal A overhang onto the PCR product that was amplified using a blunt-ended enzyme following the manufacturer's instructions and recommendations for A-tailing procedure (pGem-T EASY kit from Promega, UK). The ligations reactions were prepared including standard reaction, positive control (control insert DNA) and background control (no insert DNA) following the manufacturer's instructions and recommendations for the ligation reaction (pGem-T EASY kit from Promega, UK) with the exception of the incubation time and temperature for the reactions, which was 24 hours at 4 C. After that, the ligation reactions were heat-denatured at 65 C. for 10 minutes. Transformants of E. coli DH5 cells [F-80lacZM15 (lacZYA-argF)U169 deoR recA1 endA1 hsdR17(rk, mk+) phoA supE44 thi-1 gyrA96 relA1.sup.] (Invitrogen, UK) containing the new recombinant plasmid, designated E. Coli (pGem-TF1) were selected on LB agar plates containing 100 L of ampicillin and 20 L of X-Gal (50 mg/Ml) was spread on the LB agar plates. The plates were incubated overnight at 37 C. On the following day, a single colony was picked from each successful transformation and introduced into a tube containing agar in order to be sent for sequencing (Beckman Coulter GenomicsFormerly Agencourt Bioscience and Cogenics, UK). In parallel restriction analysis of pGem-TF1 plasmid from plasmid miniprep were performed.
(286) For protein expression and purification, E. Coli BL21(DE3) cells (Invitrogen, UK) were transformed with pGem-TF1. Cells were prepared and harvested, and protein isolation was performed as described previously (8). Briefly, cells were grown at 37 C. for 19 hours with shaking (170 rpm). The cells were centrifuged at 14 000g for 45 min at 4 C. and the cell pellet and flocculant layer (mainly Caf1) resuspended in 100 Ml phosphate-buffered saline (PBS) pH 7.6. After 30 minutes incubation, the resuspension was centrifuged at 14 000g for 30 min and the supernatant was adjusted to 40% ammonium sulphate saturation. After centrifuged at 14 000g for 30 min at 4 C., the ammonium sulphate pellet was resuspended in PBS was centrifuged at 27 000g to remove insoluble material, followed by filter sterilisation using 0.22 m disposable filter (Millex, Millipore, UK). Aliquots of 100 L of the caf1 sample were applied to an FPLC Superdex 200 column (GE Healthcare) that had been previously equilibrated with PBS. The caf1 was eluted with the same buffer at a flow rate of 0.5 Ml/min. Peak fractions were collected and analysed for caf1 by 12% SDS-PAGE gel and western blotting (using a monoclonal antibody raised to F1). Protein samples were sent to PinnacleProteomics and Biological Mass spectrometry service at Newcastle University to confirm the identity of the protein studied using Peptide Mass Fingerprinting (PMF) procedure.
(287) 1.2 Construction of Caf1-RGDS Mutants by Site Directed Mutagenesis, Expression and Purification.
(288) Mutations within the caf1 gene were created in pGem-TF1 by PCR using Pfu polymerase (Stratagene), (18 amplification cycles; 95 C. for 1 min, 95 C. for 50 sec, 60 C. for 50 s, 68 C. for 8.5 min) (PCR Express, Hybaid, UK) as described (XL Quickchange kit, Stratagene) used for large plasmids. Coding primers (mutations in lower case) were as shown in table 1:
(289) TABLE-US-00001 TABLE1 codingprimersusedtocreatemutationsinthecaf1gene. Oligonucleotide 5-3 Sequence Caf1G94insD;S95insF forward 5-ATTGGCAAGGATTCTAGAggtGATttcTTTGATATCTCTCCTAAG-3 (SEQIDNO:51) Caf1G94insD;S95insF reverse 5-CTTAGGAGAGATATCAAAggaATCaccTCTAGAATCCTTGCCAAT-3 (SEQIDNO:52) Caf1A66R;S69P forward 5-TAACTTTACAGATGCCaggGGTGATagcCCCATGTACTTAACAT-3 (SEQIDNO:53) Caf1A66R;S69P reverse 5-ATGTTAAGTACATGGGgctATCACCcctGGCATCTGTAAAGTTA-3 (SEQIDNO:54) Caf1V106R;D109S forward 5-ACGGTGAGAACCTTcgtGGGGAttcCGTCGTCTTGGCTAC-3 (SEQIDNO:55) Caf1V106R;D109S reverse 5-GTAGCCAAGACGAcggAATCCCCacgAAGGTTCTCACCGT-3 (SEQIDNO:56) Caf1MDN31GRG;DS34GN forward 5-CTCCAATTACAATTggtagaggagactctGGAAACATCGATAC-3 (SEQIDNO:57) Caf1MDN31GRG;DS34GN reverse 5-GTATCGATGTTTCCagagtctcctctaccAATTGTAATTGGAG-3 (SEQIDNO:58) Caf1QDGN76RGDS forward 5-ACTTAACATTTACTTCTcgaggagattcaAACCACCAATTCACTAC-3 (SEQIDNO:59) Caf1QDGN76RGDS reverse 5-GTAGTGAATTGGTGGTTtgaatctcctcgAGAAGTAAATGTTAAGT-3 (SEQIDNO:60)
(290) The 8.2 Kb amplified product was treated with DpnI. E. Coli DH5 was transformed with the DpnI-treated 8.2 Kb amplified product. For one transformant from each construct, the complete sequence of the mutated caf1 was confirmed ((Beckman Coulter GenomicsFormerly Agencourt Bioscience and Cogenics, UK).
(291) 1.3 Transmission Electron Microscopy (TEM).
(292) Protein samples and the negatively stained specimens were prepared as described previously (10). Briefly caf1 WT and caf1 RGDS mutant protein samples were prepared in distilled water to a final concentration of 50 g/ml. An electron microscope grid with thin carbon support film was applied to a 10 l sample droplet, held for 10-20 s and drained using a filter paper. Buffer and salts were then washed away using three 20 l droplets of water and the remaining carbon-adsorbed protein/adjuvant was negatively stained by adding a 20 l droplet of 2% uranyl acetate solution. The negative stain was drained with a filter paper and the grid was allowed to air dry. Negatively stained specimens were studied in a Philips CM100 transmission electron microscope operated at 100 Kv. Electron micrographs were recorded in a tagged image file format (TIFF), routinely at image magnifications of 130 000.
(293) 1.4 Cell Adhesion Assay.
(294) 3T3 fibroblasts and PC12 were purchased from American Type Culture Collection (ATCC; http://www.lgcpromochematcc.com) and maintained as previously described (4). For Caf1 Protein coating 100 L of proteins of interest (caf1 WT and caf1 RGDS mutant) and controls were added into a 96-well plate. BSA, OmpA-RGDS, were used as controls. Non-coating wells were also used as control. Proteins were diluted in 10 mM PBS, pH 7.6 to obtain the desired concentration, 100 g/Ml. All the protein solutions were filtered using a 0.2 m filter. Each solution was pipetted into a culture plate using a multi-channel pipette for a 96-well plate. The plate was sealed with parafilm and incubated overnight at 4 C. The proteins solutions were aspirated from the plate wells and wash once the wells with 10 Mm PBS pH 7.6. The PBS was removed from the wells and the plate reserved for cell culture. Then, 3T3 Fibroblasts cells were harvested at 1000g for 5 min. The cell pellet was resuspended in 10 Mm PBS pH7.4 with calcium and magnesium at a concentration of 2.510.sup.6 cells/Ml. The cells were washed twice in 10 mM PBS pH 7.4 with calcium and magnesium at a concentration of 110.sup.6 cell/Ml. 100 L of prepared cells suspension was added to each well. The plate was placed in the incubator at 37 C. for 2 hours. After 2 hours of incubation the cells which did not attach were removed inverting the plate. Cells were washed twice with 10 mM PBS pH 7.4 with calcium and magnesium for 5 minutes and fixed with 4% paraformaldehyde in PBS pH 7.4 (Sigma-Aldrich, UK) for 30 minutes. The paraformaldehyde solution was removed and the cells were washed three times with PBS pH 7.4 for 5 minutes each wash and then stained with 10 g/Ml of DAPI (Sigma-Aldrich, UK) in PBS pH 7.4 for 25 minutes. The DAPI solution was removed and the cells were washed three times with PBS pH 7.4 for 5 minutes each wash. After that the cells were stained with rhodamine-phalloidin conjugated (200 ng/Ml) (Sigma-aldrich) for 15 minutes. Then the phalloidin solution was removed and the cells were washed three times with PBS pH 7.4 for 5 minutes each wash. The wells were filled in with PBS pH 7.4 and measurements were effectuated using Fluorimeter. For cell adhesion assay using the fluorescence microscope, glass coverslips were coated with caf1 WT and caf1 RGDS mutant following the same protocol mentioned above. After that 110.sup.5 of PC12 cells were added in RPMI 1640 medium without serum per well of a 6-well culture plate containing the glass coverslips coated with proteins. The cells were maintained at 37 C., 5% CO.sub.2 in an incubator for 3 hours. After 3 hours cultures were washed once with 2 Ml sterile phosphate buffered saline (PBS) (Cambrex), fixed and staining as mentioned above.
2. Results
(295) 2.1. Subcloning Caf Operon
(296) 2.1.1. PCR Amplification of Caf Operon Using Pah34L Vector as a Template and Restriction Digest of PCR Product
(297) The amplification of E. Coli plasmid pAH34L (12) (about 11 Kbp in size), which includes the Yersinia pestis caf operon, by PCR using the F1 pair of primers and PCR cycle conditions has shown a band of 5.2 Kb (
(298) The PCR product obtained was confirmed by restriction analysis to be the caf operon.
(299) 2.1.2. Caf Operon Purification and Quantification and Restriction Digest
(300) After confirming that the PCR product obtained was the caf operon, a DNA fragment of the expected size (5.2 Kb) was purified using QIAGEN Gel Extraction kit and quantified using Quantity One software (Bio-Rad) (
(301) The PCR product was purified, a single band of 5.2 Kb was shown on the electrophoresis gel and restriction analyses have shown that band was the caf operon. From this purification 64 ng/L of purified PCR product was obtained.
(302) 2.1.3. Sequencing of pGem-TF1
(303) Subcloning experiments from pAH34L plasmid allowed the inventors to construct plasmid pGem-T Easy carrying the caf operon. Results provided by gene sequencing has shown that the amino acid sequence of the caf operon cloned into pGem-T Easy (
(304) Sequencing results showed the complete and correct sequence for Caf1 and caf1R genes from the caf operon.
(305) 2.1.4. Restriction Digests of pGem-TF1
(306) The restrictions analysis gel using EcoRI restriction enzyme, which has two restriction sites in the pGem-T EASY plasmid and is able to release the insert, has shown two bands: one band with 3 Kb which might correspond to the vector and the second band above 5 Kb which might correspond to the insert (
(307) Restrictions analysis using EcoRI which releases the insert has also confirmed that the insert cloned has the right size (expected size of 5.2 Kb).
(308) 2.1.5. SDS PAGE Gel and Western Blotting
(309) Results from SDS page and western blotting using anti-F1 antibody (Avecia, UK) (
(310) Expression of caf1 was shown by SDS PAGE and Western blotting using anti-F1 antibody.
(311) 2.1.6. Mass Spectrometry of Caf1 Protein
(312) In order to confirm the identity of the band of 15.5 kDa on the 12% SDS-page gel, the band was sent to mass spectrometry. Results obtained confirmed that the band of 15.5 kDa is caf1 (
(313) 2.2. Caf1 Protein Expression and Purification
(314) The centrifugation of E. Coli BL21(DE3) (pGem-TF1) cultures resulted in the sedimentation of bacterial cells above which a layer of flocculated material was visible. In preliminary experiments, this flocculated material was shown to be mainly Caf1. Additional caf1 could be removed from the surface of the bacterial cells by gentle washing in PBS. The caf1 was purified by ammonium sulphate fractionation followed by FPLC Superdex 200 gel filtration chromatography, yielding approximately 10 mg of Caf1 per liter of culture.
(315) 2.2.1. Size Exclusion Chromatography Using Superdex 200 and Calibration Curve
(316) FPLC Superdex 200 gel filtration chromatography column (maximum pressure: 3 Mpa; flow rate: 2 Ml/min; mobile phase: PBS buffer pH 7.6; volume of sample injected: up to 5 Ml) were used in this study to purify caf1. Caf1 eluted in the void volume (V.sub.0) (50.5 ml) of the gel filtration column and total volume (V.sub.T) was 18 ml. The standard protein markers for the gel filtration chromatography are presented in the table 2. The results are shown in
(317) TABLE-US-00002 TABLE 2 The standard protein markers for the gel filtration chromatography Molecular Distribution weight Log.sub.10 V.sub.e coefficient (K.sub.D) Protein (MW) (kDa) MW (Ml) K.sub.D = (V.sub.e V.sub.0)/(V.sub.T V.sub.0) Carbonic 29 1.46 105 0.872 Anhydrase Albumin 66 1.82 98 0.760 Alchol 150 2.18 94 0.696 Dehydrogenase Beta Amylase 200 2.30 92 0.664 Apoferritin 443 2.65 88 0.600 Thryroglobulin 669 2.82 82 0.504
2.2.2. Chromatogram and SDS PAGE Gel
(318) Samples were injected in the Superdex 200 gel filtration column at 2 ml/min using PBS buffer pH 7.6 as mobile phase. Each fraction was collected in a Falcon tube. Chromatogram (
(319) 2.2.3. Determination of the Protein Concentration by UV Spectrophotometer
(320) Purified protein was quantified using a spectrophotometer, as illustrated in
(321) 2.3. Formation of Caf1 Oligomers
(322) After protein purification, the inventors prepared caf1 oligomers. Caf1 samples were incubated at 95 C. for 45 seconds (
(323) 2.4. Construction of Caf1-RGDS Mutants Using Site Directed Mutagenesis. Expression and Purification
(324) 2.4.1. CafM:Caf1 Complex and Caf1-RGDS Mutants Construction
(325) Using PyMOL and the access number (GenBank, accession number AY450847) RGDS peptides were inserted into the loops of the F1 fibre model structure (
(326) 2.4.2. Sequencing
(327) After site directed mutagenesis, colonies of each successful transformation were sent for sequencing. Results obtained from gene sequencing of Caf1MDN31GRG; DS34GN are shown below (
(328) 2.4.3. SDS PAGE Gel
(329) Fractions of purified Caf1QDGN76RGDS mutant protein were loaded on 12% SDS-PAGE (
(330) 2.5. Transmission Electron Microscopy
(331) Images from pGem-TF1 and pGem-TF1 Caf1QDGN76RGDS were captured using a transmission electron microscope (
3. Cell Biology
(332) 3.1. Measurement of Cell Adhesion on 96-Well Plates Coated with caf1 WT or RGDS Mutant Using Fluorimeter.
(333) TABLE-US-00003 TABLE 3 Preliminary results using caf1 as a scaffold for cell culture presenting RGDS peptides has shown some effects on 3T3 Fibroblasts cells. Orla 1 is a control protein conisting of the transmembrane domain of E coli protein OmpA without cell attachment motifs inserted Cooke, M. J., Zahir, T., Phillips, S. R., Shah, D. S. H., Athey, D., Lakey, J. H., Shoichet, M. S. and Przyborski, S. A. (2010) Neural differentiation regulated by biomimetic surfaces presenting motifs of extracellular matrix proteins, Journal of Biomedical Materials Research Part A, 93A(3), pp. 824-832. Caf1 Caf1 Non WT RGDS Orla 1 coating BSA 0.168 1.314 1.319 0.737 0.338 0.296 1.013 1.523 0.489 1.653 0.282 0.386 1.344 1.091 0.197 0.169 0.361 0.383 0.471 1.006 0.196 1.577 1.525 1.162 0.841 0.205 0.365 1.448 1.02 0.734 0.326 0.358 1.379 1.201 1.944 0.216 0.811 1.667 1.028 1.534 0.322 0.432 1.431 1.059 0.322 0.488 1.449 0.94 1.306 0.322 0.216 2.772 0.747 1.444 1.499 0.416 3.174 0.397 1.293 1.395 SUM 3.3 14.012 14.103 12.301 11.785 AVER- 0.507692 2.155692 2.169692 1.892461538 1.813077 AGE
3.2 PC12 Cell Adhesion Assay on Glass Coverslips Coated with caf1 WT or RGDS Mutant by Fluorescence Microscopy
(334)
4. Formation of Mixed Caf1 Polymers from Different Types of Monomer
(335) The following data demonstrates that by adding an additional plasmid expressing mutant Caf1 it is possible incorporate two different monomer types into the resultant caf1 polymer. Thus complex mixed polymers (i.e. heterogenous polymers) are possible.
(336) 4.1 Co-Expression of Caf1 WT Using Two Compatible Plasmids, the pAH34L and pBAD33
(337) The design and synthesis of a second generation of scaffolds for cell culture is described, in which the same scaffold contains several different ECM motifs to enhance cell adhesion, (for example the PHSRN from fibronectin (and not only one cell adhesive motif as in Caf1-RGDS)) or to promote other biological processes such as differentiation with the inclusion of growth factors. Specific protease cleavable sites which can be recognised and cleaved by, for example, metalloproteinases secreted by the cells at specific time points of the cellular development including migration may also be incorporated.
(338) Generation of a scaffold comprising a mixed polymer may have a number of advantages. Scaffolds will often only require a low density of active motifs, which can be diluted by inactive monomers. This can improve expression levels of the polymer if the motif bearing monomer is slow to assemble in the secretion pathway.
(339) The inventors have demonstrated that it is possible to successfully secrete Caf1 mutants (e.g. with additional motifs or bioactive sequences) interspersed with the Caf1 wild type through the chaperone/usher system. The simultaneous expression of two different genes is designated co-expression and is generally achieved with two or more plasmids, each carrying the gene of one subunit (e.g. mutant caf1 or wildtype caf1) and a different selection marker. The plasmids should have different compatible replicons (19).
(340) The two plasmids used in this study are pAH34L and pBAD33, however, any suitable plasmids may be used. The pAH34L plasmid (8) encodes the caf operon and the compatible pBAD33 plasmid encodes only the caf1 gene. The pAH34L caf1 gene expression is temperature-regulated which is maximally expressed at 37 C. Below this temperature the levels of caf1 gene expression decrease. The plasmid pBAD33 (20) is a low copy plasmid, coding for chloramphenicol resistance, containing the P.sub.BAD promoter of the araBAD (arabinose) operon and the gene encoding the positive and negative regulator of this promoter (araC).
(341) The cloning of the caf1 gene into the pBAD33 plasmid was conducted by GeneArt. The inventors then introduced the ribosomal binding siteShine-Dalgarno sequence (AGGAGG), 8 basepairs upstream of the start codon AUG. The plasmid pAH34L contains the ColE 1 origin of replication and the plasmid pBAD33 contains the pACYC184 origin of replication.
(342) This system has several advantages; including (1) the modulation of caf1 gene expression and protein production by controlling either the temperature or the concentration of arabinose. The expression of caf1 encoded by pAH34L can be induced by performing the cell culture growth at 37 C. or above and repressed by decreasing the temperature to below 37 C. At 23 C. the expression levels of the caf1 gene are very low. The expression levels of caf1 encoded by pBAD33 can be modulated over a varied range of L-arabinose concentrations, usually from 0.002-2% and reduced to extremely low levels by the presence of glucose, which represses the gene expression. A further advantage of the system is that (2) it results in the production of hybrid Caf1 polymers (Caf1 mutants+Caf1 WT).
(343) Two groups of three glass test tubes, each containing 5 mL of LB broth media supplemented with 20 g/mL of chloramphenicol, 0.2% L-arabinose, 100 g/mL of ampicillin and both 100 g/mL of ampicillin and 20 g/mL of chloramphenicol antibiotics were inoculated with a single colony of E. coli TOP10 transformed with either pBAD33_SD_Caf1, pAH34L or both pBAD33_SD_Caf1+pAH34L, respectively. 0.2% of glucose was added to one group of tubes whereas no glucose was added to the other group of tubes. All the glass test tubes were incubated at 37 C. in a rotation wheel at 180 rpm. When cultures reached the mid-log phase of growth (optical density of 0.5-0.6 at 600 nm), three different concentrations of L-arabinose were added to separate glass test tubes within each group: 0.02, 0.2 and 2%. After 16 h of incubation the bacterial cell culture was transferred to a 15 ml Falcon tube and these were centrifuged at 3000 rpm for 15 minutes at 4 C. Photographs of all Falcon tubes were taken. The sizes of the pellet and flocculent layer were immediately measured on the Falcon tube using a ruler (
(344)
(345) Equivalent experiments were carried out using different concentrations (0, 0.02, 0.2 and 2%) of L-arabinose in the presence or absence of D-glucose. Excess LB media, approximately 4 ml was carefully taken out of each Falcon tube using a pipette. The flocculent layer, with the remaining LB, was carefully separated from the cell pellet using the pipette. Samples of this layer were added to SDS-sample buffer and heated at 100 C. for 5 minutes and loaded onto 12% SDS-PAGE gels. One of the gels was stained with Coomassie Brilliant Blue and the other gel was used to perform a western blot. The blot was probed for Caf1 using an anti-Caf1 antibody followed by detection of bound antibody using goat anti-mouse IgA-horse-radish peroxidise conjugate. Bound antibody was detected using 4CN (4-chloro-1-naphthol) substrate.
(346) The western blot membrane was scanned and analysed by the ImageJ software to compare the density of the bands on the western blot. The mean of the relative density of the bands and the standard error of the mean were determined. The results obtained for the quantification of the Caf1 present in the flocculent layer and the size of the flocculent layer measured can be seen in
(347) 4.2. Expression of Heterologous Proteins Fused to the Caf1 Subunit in Escherichia coli
(348) The caf1 gene in pBAD33 was mutated by the insertion of: (1) 6-Histidine near its N-terminus (Caf1-6HisNT); (2) PHSRN motif which is the RGD synergy sequence in fibronectin (Caf1-PHSRN) in the loop 1 of Caf1 (Caf1-PHSRN Loop1); (3) FLAG epitope (DYKDDDDK) (SEQ ID NO:61) in the N-terminus of Caf1 (caf1-FLAG epitope NT); (4) Cysteine in the NT-terminus of Caf1 (Caf1-Cys-NT); (5) Cysteine in the loop 4 of Caf1 (Caf1-G35C Loop4); Cysteine in the loop 2 of Caf1 (Caf1-Q106C Loop 2); (6) PENFF (SEQ ID NO:62) cleavage site for Metalloproteinase 13 (MMP13) in the N-terminus of Caf1 (Caf1-PENFF-NT); (7) 6-Histidine in the N-terminus of Caf1 followed by a spacer linking peptide (GGGGSGGGGS) (SEQ ID NO:63, Caf1-6His-NT spacer); (8) 6-Histidine in the C-terminus of Caf1 (Caf1-6His-CT); (9) PHSRN motif in the loop 3 of Caf1 (Caf1-PHSRN Loop3). These mutations in the caf1 gene were designed as variants of the caf1 gene. The variants were synthesised and cloned into pBAD33 vector by GeneArt (Invitrogen Life Technologies).
(349) 4.2.1. Co-Expression of Caf1 Mutants Using the Vector pBAD33 and pAH34L
(350) The caf1 gene (528 bp in size; GenBank, accession number AY450847) mutants were synthesised by GeneArt (Table 4) and cloned into pBAD33 vector between KpnI and XbaI restriction sites; followed by two stop codons.
(351) 4.2.2 Small-Scale Caf1 Mutant Co-Expression
(352) LB broth supplemented with 100 g/ml of ampicillin or 20 g/ml of chloramphenicol antibiotics and with both 100 g/ml of ampicillin and 20 g/ml of chloramphenicol antibiotics were used for culturing E. coli TOP10/pBAD33_SD_Caf1mutants, E. coli TOP10/pAH34L and E. coli TO P10/pBAD33_SD_Caf1mutants+pAH34L, respectively.
(353) Two groups with three glass test tubes each containing 10 ml of LB broth media with the required antibiotics were incubated at 37 C. with 180 rpm shaking until their optical density had reached 0.5-0.6 at 600 nm. After measuring the optical density, 0.2% of L-arabinose was added in the respective tubes. The following day, the bacterial cell culture was transferred to a 15 ml Falcon tube in aseptic conditions. The cultures were centrifuged and prepared to be analysed by SDS-PAGE and western blot as described before. This experiment was performed in triplicate.
(354) TABLE-US-00004 TABLE4 TheCaf1aminoacidsequencesofgenessynthesisedinpBAD33 Caf1 Aminoacidsequence Caf1-6HisNT MKKISSVIAIALFGTIATANAASSHHHHHHDLTASTTATATLVEP (SEQIDNO:64) ARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVN FTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVN GENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVT VSNQ Caf1-6HisNT+ MKKISSVIAIALFGTIATANAASSHHHHHHGGGGSGGGGSDLT Spacerlinking ASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLG peptide GYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGK (SEQIDNO:65) DSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKL AAGKYTDAVTVTVSNQ Caf1-PHSRN MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKE (DSRN)Loop1 GAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDP (SEQIDNO:66) MYLTFTSQDGNNHQFTTKVIGKPHSRNGGDISPKVNGENLVG DDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Caf1_PHSRN MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKE (NLVGD)Loop3 GAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDP (SEQIDNO:67) MYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGEPHSRND VVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Caf1_FLAG MKKISSVIAIALFGTIATANAADYKDDDDKDLTASTTATATLVEP epitopeNT ARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVN (SEQIDNO:68) FTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVN GENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVT VSNQ Caf1_CysNT MKKISSVIAIALFGTIATANAACDLTASTTATATLVEPARITLTYK (SEQIDNO:69) EGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGD PMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGD DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Caf1_G35C MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKE Loop4 GAPITIMDNCNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDP (SEQIDNO:70) MYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDD VVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Caf1_Q106C MKKISSVIAIALFGTIATANAADLTASTTATATLVEPARITLTYKE Loop2 GAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDP (SEQIDNO:71) MYLTFTSCDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDD VVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Caf1_PENFF-NT MKKISSVIAIALFGTIATANAAPENFFDLTASTTATATLVEPARIT (SEQIDNO:72) LTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTD AAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGEN LVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSN Q
(355) Plasmid DNA for each pBAD33_SD_Caf1 mutant was used to transform E. coli TOP10 competent cells either with or without pAH34L. As a positive control only pAH34L plasmid DNA was used to transform E. coli TOP10 competent cells. The transformed bacterial cells were grown on L-agar containing the relevant antibiotic(s) mentioned above. Individual colonies from a plate of transformed E. coli TOP10 competent cells were grown in glass test tubes with 10 mL of Lysogeny broth (LB) medium containing the relevant antibiotic(s) at 37 C. until they reached an optical density of 0.5-0.6 at 600 nm. Arabinose at a final concentration of 0.2% was added in each glass test tube. The bacterial cell culture was allowed to grow at 37 C. for 16 h. After this incubation time, the culture was centrifuged at 3000 rpm for 15 minutes at 4 C. The flocculent layer and the cell pellet were measured using a ruler (Table 5).
(356) Table 5 shows that, after induction with 0.2% of L-arabinose, co-expression of pBAD33 with pAH34L was needed to produce a flocculent layer in pBAD33_SD_caf1-FLAG epitope NT+pAH34L, pBAD33_SD_caf1-G35C Loop 4+pAH34L, pBAD33_SD_caf1-6His-NT spacer+pAH34L, pBAD33_SD_caf1-6His-CT+pAH34L, pBAD33_SD_caf1-PHSRN Loop 3+pAH34L.
(357) In two cultures, pBAD33_SD_caf1-Q106C Loop2+pAH34L and pBAD33_SD_caf1-PHSRN Loop1+pAH34L no flocculent layer was detected after induction. In the pBAD33_SD_caf1-PENFF-NT+pAH34L culture the inventors observed a flocculent layer before induction however they did not observe the flocculent after induction.
(358) The flocculent layer was very thick in the L-arabinose induced cultures of pBAD33_SD_caf1-G35C Loop 4+pAH34L when compared with the non-induced cultures which could indicate some contribution of the mutant to the polymer. In the case of pBAD33_SD_caf1-FLAG epitope NT+pAH34L the size of the layer was similar in the induced and non-induced cultures. It was more difficult to understand this result if one only uses the size of the layer as an indication of Caf1 co-expression.
(359) Thus, a western-blot was performed to analyse these samples using the monoclonal anti-caf1 antibody and the monoclonal anti-FLAG epitope antibody (
(360) TABLE-US-00005 TABLE 5 Measurements of the flocculent layer thickness in E. coli TOP10 cells transformed with plasmid pBAD33_SD_caf1 mutants jointly with pAH34L encoding for Caf1 WT. The same measurements were performed in E. coli TOP10 transformed with plasmid pAH34L and with plasmid pBAD33_SD_caf1 mutants in separately. All data are reported as mean of three independent experiments standard error of the mean (S.E.M). Flocculent layer (cm) (Mean S.E.M) n = 3 No L- 0.2% L- Plasmids arabinose arabinose pBAD33_SD_caf1-6His NT + pAH34L 0.2 0.005 0.2 0.005 pBAD33_SD_caf1-PHSRN Loop1 + pAH34L pBAD33_SD_caf1-FLAG epitope NT + 0.2 0.003 0.2 0.005 pAH34L pBAD33_SD_caf1-Cys-NT + pAH34L 0.1 0.003 pBAD33_SD_caf1-G35C Loop 4 + 0.3 0.006 1 0.044 pAH34L pBAD33_SD_caf1-Q106C Loop2 + pAH34L pBAD33_SD_caf1-PENFF-NT + pAH34L 0.2 0.003 pBAD33_SD_caf1-6His-NT spacer + 0.3 0.008 0.3 0.008 pAH34L pBAD33_SD_caf1-6His-CT + pAH34L 0.1 0.003 0.2 0.005 pBAD33_SD_caf1-PHSRN Loop 3 + 0.2 0.003 0.3 0.005 pAH34L pBAD33_SD_caf1-6His NT pBAD33_SD_caf1-PHSRN Loop1 pBAD33_SD_caf1-FLAG epitope NT pBAD33_SD_caf1-Cys-NT pBAD33_SD_caf1-G35C Loop 4 pBAD33_SD_caf1-Q106C Loop2 pBAD33_SD_caf1-PENFF-NT pBAD33_SD_caf1-6His-NT spacer pBAD33_SD_caf1-6His-CT + pAH34L pBAD33_SD_caf1-PHSRN Loop 3 pAH34L 0.1 0.003 0.1 0.005
(361)
(362)
(363)
(364)
(365) 4.3 Discussion
(366) 4.3.1. Co-Expression of Caf1 WT was Mediated by the Two Compatible Plasmids, pAH34L and pBAD33
(367) This study demonstrates a system for co-expression of copies of the caf1 gene using the plasmid pBAD33 which contains: (1) the pBR322-compatible p15A origin of replication from the pACYC184 vector and (2) resistance to chloramphenicol antibiotic, and the caf operon using the plasmid pAH34L which has a different origin of replication (ColE1) and antibiotic resistance (kanamycin) and thus cells can maintain both plasmids if grown on kanamycin/chloramphenicol L-agar plates. Based on the size of the flocculent layer, TOP10 E. coli cells transformed by two compatible plasmids and grown in media containing L-arabinose expressed higher levels of caf1 gene. This was confirmed by western blot using the monoclonal anti-Caf1 antibody.
(368) In other studies Bga and co-workers (16) investigated the overproduction of PapA (the major pilin subunit) by electron microscopy and immunoblot analysis of PapA antigen. For that, they constructed a plasmid pPAP267, which overproduces just the PapA pilin subunit and it was introduced into HB101 cells harbouring the pPAP5, which contain the wild-type pap operon (composed of 11 genes responsible for the expression of papA pilin) and found that the expression of PapA was 10-fold higher in comparison with pPap5 alone and also the pili were longer than the wild-type. This showed the possibility of co expression but the polymers produced were homogenous and there was no direct evidence that the pPAP5 products were in the polymer.
(369) In this study, it was possible to modulate the Caf1 expression over a range of L-arabinose concentrations, from 0.02 to 2%. The levels of caf1 expression increased with the increase of L-arabinose concentration (
(370) However, an efficient repression of caf1 expression was not achieved in the presence of 0.2% D-glucose. In fact, cells grow better and expressed more protein in some cases with glucose.
(371) 4.3.2 Caf1-Flag and Caf1-6his-NT+Spacer were Co-Inserted into Polymers with Caf1 WT
(372) The inventors have developed an approach to co-express Caf1 mutants with Caf1 WT (caf wildtype) using the expression system mentioned above. Analysis of co-expression of Caf1 mutants was performed by western blot using antibodies against the proteins in the study.
(373) Caf1-FLAG co-expressed with Caf1 WT proteins, resulting in the generation of mixed polymers. To the inventors knowledge this is the first demonstration of mixed polymers of this type. Zavialov et al. (21) have presented an approach for heterologous expression of recombinant proteins in E. coli. For that, they created genes encoding chimeric proteins in which for example, the human Interleukine-1 was introduced between the Caf1 signal peptide and the mature Caf1 subunit leaving the C-terminus of the Caf1 subunit available to interact with the chaperone, Caf1M. This system did not however produce polymers.
(374) In this study the Caf1-FLAG and Caf1-6His-NT spacer were detected in Caf1 polymers secreted on the surface of E. coli (see western blot for FLAG epitope using the monoclonal anti-FLAG epitope antibody,
5. Cross-Linking Caf1 Hydrogels
(375) Caf1 WT was covalently cross-linked with three cross-linkers containing different spacer arm length (i.e. the distances between conjugated molecules) and different numbers of the same functional group, N-hydroxysuccinimide (NHS) at the end.
(376) The NHS-ester reacts with primary amines to form covalent amide bonds. The reaction is usually performed in phosphate buffer at pH 7.2-8.0 for 0.5 h at room temperature. Primary amine buffers such as Tris-buffered saline are not compatible because they compete for reaction; however, in some procedures, it is useful to add Tris or glycine buffer at the end of a conjugation procedure to quench (stop) the reaction. The reaction releases N-hydroxysuccinimide (M.W. 115), which can be removed easily by dialysis or desalting.
(377) In this study, the inventors analysed Caf1WT hydrogels by the traditional scanning electron microscopy SEM, after gelation, after gelation followed by freeze drying, and also by Environmental scanning electron microscopy (ESEM). The ESEM methodology is a variant of SEM which works in a low vacuum and has the ability to keep the sample in a hydrated state due to the control of the water vapour pressure within the chamber by maintaining the sample temperature constant using the Peltier stage. Moreover, the sample can be prepared without coating with carbon or gold unlike high-vacuum SEM applications that require the coating of the sample to avoid charge build-up.
(378) 5.1 Experimental Results
(379) 5.1.1 Cross-Linking of CAF1 WT with Different Spacer Arm Lengths
(380) Caf1 protein at a final concentration of 30 mg/ml was cross-linked with DTSSP (Pierce), NHS-PEG-NHS (Creative PAGWorks) and 4-arm NHS-PEG (Creative PEGWorks) solutions at final concentrations of 3, 6, 9 and 15 mg/ml which correspond to ratio of cross-linking (w/w, cross-linkers:Caf1) of 1:10, 1:5, 1:3, 1:2, respectively. The methods used for crosslinking were in accordance with the manufacturer's instructions. The Caf1 hydrogels at these ratios were characterised regarding their gelation time, swelling, degree of cross-linking analysed by SDS-PAGE gel, Transmission Electron microscopy (TEM), biocompatibility of the Caf1 hydrogels with mammalian cells performing viability/cytotoxicity assay and morphology studied by Scanning Electron microscopy (SEM).
(381) 5.1.2 Gelation Time
(382) The gelation rate of the Caf1 hydrogels was monitored under sealed conditions at room temperature for 30 minutes, stirring every minute. Table 6 shows that increasing the concentration of DTSSP cross-linker did not change the gelation time. After 30 minutes the reaction did not lose its fluidity, e.g. when the tubes were slightly inverted the solution in the tube slid along the walls of the glass test tubes and did not result in a gel, thus the gelation time was not determined (N.D). However, increasing the concentration of NHS-PEG-NHS (also called 2-arm-PEG-NHS herein) decreased slightly the gelation time. A more visible decrease in the gelation time was observed by the addition of 4-arm PEG-NHS. The gelation rate of the 4-arm PEG-NHS was quicker than the 2-arm PEG-NHS. For example the quickest gelation time for 4-arm-PEG-NHS and NHS-PEG-NHS was 2 seconds and 24 min, respectively. Nevertheless, based only in these simple observations we noticed that all Caf1 hydrogels cross-linked with the different cross-linkers resulted in a sample viscosity comparable with the viscosity of the corresponding solution of the Caf1.
(383) 5.1.3 Swelling
(384) The swelling of Caf1 hydrogels cross-linked with DTSSP, NHS-PEG-NHS and 4-arm PEG-NHS at different concentrations were determined based on analysis of changes in diameter (differences between the initial diameter before swelling and final diameter after swelling by the addition of PBS) which increased with the decrease of cross-linker concentration. This trend was more pronounced for the Caf1 hydrogel cross-linked with DTSSP (w/w ratio of cross-linking of 1:10).
(385) TABLE-US-00006 TABLE 6 Analysis of the gelation time of Caf1 cross-linked with DTSSP, NHS-PEG-NHS and 4-arm PEG-NHS hydrogels at room temperature (30 min) and the percentage of change between the initial diameter of the hydrogels drops on the plastic surface and their final diameter after addition of PBS and incubation at 37 C. All data are reported as mean percentage of three independent experiments standard error of the mean (S.E.M). Ratio Swelling Cross- (crosslinker:protein) Gelation % Mean Protein linker (w/w) time(min) S.E.M Caf1 DTSSP 1:10 N.D 61.2 0.17 1:5 N.D 58.1 0.12 1:3 N.D 54.3 0.11 1:2 N.D 44.4 0.11 NHS-PEG- 1:10 N.D 40.3 0.17 NHS 1:5 27 0.58 40.2 0.42 1:3 26 0.33 35.2 0.33 1:2 24 0.33 32.9 0.49 4-arm 1:10 22 0.33 24.2 0.60 PEG-NHS 1:5 5 0.17 24.7 0.33 1:3 4 0.33 14.2 0.05 1:2 2 0.17 14.2 0.03
(386)
(387) 5.1.4 Degree of Cross-Linking
(388) Caf1 polymers were treated with three different cross-linkers each presenting a NHS reactive group on each end of the cross-linker. The NHS group reacts with primary amine groups of lysines at pH 7-8.5 to form stable amide bonds. The reactions were terminated after 30 min. After cross-linking, the samples were incubated in SDS sample buffer at 100 C. for 5 min and the loaded onto a 4-20% gradient polyacrylamide gel for electrophoresis.
(389) Table 7 shows the values of relative density obtained by densitometry using the image J software. Analysis of the cross-linked fraction and non-cross-linked fraction were performed. The theoretic values for the cross-linked fractions were determined by subtracting the amount of Caf1 protein sample (in the absence of cross-linkers) to the Caf1 protein sample (in the presence of one of the cross-linkers) non-cross-linked fraction. Increasing the concentration of the cross-linkers increased the Caf1 cross-linked fraction, according to the theoretical values and decreased the Caf1 non-cross-linked fraction. The exception was for the Caf1 cross-linking with 4-arm PEG-NHS sample at a mass ratio of 1:2 which showed a decrease in the non-cross-linked and in the cross-linked fraction. The theoretical value was higher than that obtained for the cross-linked fraction.
(390) TABLE-US-00007 TABLE 7 Relative densitometry for Caf1 non-cross-linked and cross-linked fractions was determined by ImageJ software. All data are reported as mean of three independent experiments standard error of the mean (S.E.M). * The- Non-cross- oretical linked Cross-linked values for Caf1:Cross- fraction fraction the cross- Cross- linker (Mean (Mean linked linker (w/w) S.E.M) S.E.M) fraction DTSSP 1:10 0.34 0.016 0.55 0.033 0.66 1:5 0.33 0.0015 0.58 0.08 0.67 1:3 0.30 0.010 0.63 0.05 0.70 1:2 0.28 0.0018 0.82 0.06 0.72 NHS-PEG- 1:10 0.87 0.0095 0.11 0.015 0.13 NHS 1:5 0.86 0.068 0.17 0.026 0.14 1:3 0.72 0.0039 0.20 0.07 0.28 1:2 0.61 0.0008 0.30 0.04 0.39 4-armNHS- 1:10 0.71 0.013 0.33 0.022 0.30 PEG 1:5 0.33 0.014 0.57 0.04 0.67 1:3 0.21 0.014 0.62 0.023 0.79 1:2 0.16 0.0036 0.28 0.02 0.84 * Caf1.sub.cross-linked fraction = Caf1.sub.free-molecules Caf1x Cross-linker X.sub.remained non-cross-linked fraction
(391)
(392) TEM images show small pieces of Caf1 hydrogels cross-linked with DTSSP with average sizes of 76 nm and a uniform size distribution ranging from 10 to 300 nm. Caf1 hydrogels cross-linked with NHS-PEG-NHS presented an average size of 393 nm and a more disperse size distribution with mesh sizes ranging from 10 to 600 nm. The Caf1 hydrogels cross-linked with 4-arm PEG-NHS showed an average size of 254 nm and extreme size distribution from around 20 nm to 1500 nm.
6 Viability and Cytotoxicity Assay
(393) The viability/cytoxicity assay (Promega) is used to assess cell viability and cytotoxicity of the materials used. The first part of the assay simultaneously measures two protease activities; one is a marker of cell viability, and the other is a marker of cytotoxicity. The live-cell protease activity is restricted to intact viable cells and is measured using a fluorogenic, cell-permeant, peptide substrate (glycylphenylalanyl-aminofluorocoumarin; GF-AFC). The substrate enters intact cells and is cleaved by the live-cell protease activity to generate a fluorescent signal proportional to the number of living cells. This live-cell protease becomes inactive upon loss of cell membrane integrity and leakage into the surrounding culture medium. A second, fluorogenic cell-impermeant peptide substrate (bis-alanylalanyl-phenylalanyl-rhodamine 110; bis-AAF-R110) is used to measure dead-cell protease activity, which is released from cells that have lost membrane integrity. Because bis-AAF-R110 is not cell-permeant, essentially no signal from this substrate is generated by intact, viable cells.
(394) Rat primary osteoblasts were cultured using standard culturing techniques on the surface of Caf1 hydrogels (made in accordance with the invention). After 24 h, viability and membrane integrity were determined by the viability/cytotoxicity assay (Promega), in which intact viable cells protease activity is measured using a fluorogenic, cell-permeant, peptide substrate (glycylphenylalanyl-aminofluorocoumarin; GF-AFC) and dead-cell protease activity is measured by the cell-impermeant peptide substrate (bis-alanylalanyl-phenylalanyl-rhodamine 110; bis-AAF-R110). Table 8 shows the percentage of viability and cytotoxicity for rat primary osteoblasts attached on Caf1 hydrogels. Cells tolerated 2D culture on the Caf1 hydrogels shown by 70-80% viability and low percentages for cytoxicity.
(395) TABLE-US-00008 TABLE 8 Percentage of cell viability and cytotoxicity when attached on Caf1 hydrogels cross-linked with different cross-linkers at various ratios. Ratio Cell viability Cell cytotoxicity Hydrogels (crosslinker:protein) (%) (%) Caf1: DTSSP 1:10 80% 20% 1:5 76% 24% 1:3 78% 22% 1:2 80% 20% Caf1: NHS-PEG- 1:10 77% 23% NHS 1:5 77% 23% 1:3 76% 24% 1:2 73% 27% Caf1: 4-arm 1:10 71% 29% PEG-NHS 1:5 77% 23% 1:3 75% 25% 1:2 74% 26% Only Caf1 61% 39% DME Medium 84% 16% 15% ethanol 7% 93%
7. Hydrogels Comprising Caf1 Polymers Crosslinked with 4-Arm PEG-NHS
(396) The ability of Caf1 polymers cross-linked with 4-arm PEG-NHS to form a hydrogel was explored.
(397) The TEM images (
(398) The Caf1 polymer cross-linked with 4-arm PEG-NHS at various ratios of cross-linking (Caf1:cross-linker, w/w) samples at 1:3000000, 1:300000, 1:30000, 1:3000, 1:300, 1:60 and 1:30 after gelation as mentioned before were heated at 100 C. for 5 min in SDS-sample buffer and loaded onto a SDS-PAGE. The gel was scanned and analysed as described above by ImageJ version 1.46. The values corresponding to Caf1 cross-linked fraction either determined by ImageJ the Caf1 non-cross-linked fraction are presented in Table 9. The Caf1 cross-linked fraction increased with the increase of cross-linker concentration.
(399) TABLE-US-00009 TABLE 9 Relative densitometry for Caf1 non-cross-linked and cross-linked fractions was determined by ImageJ software. All data are reported as mean of three independent experiments standard error of the mean (S.E.M). *Theoretical Non-cross-linked Cross-linked values for Caf1:4-arm fraction fraction cross-linked PEG-NHS (Mean S.E.M) (Mean S.E.M) fraction 1:3000000 0.99 0.0034 0.006 0.0014 0.01 1:300000 0.99 0.0024 0.0079 0.0015 0.01 1:30000 0.98 0.0023 0.043 0.033 0.02 1:3000 0.97 0.0022 0.051 0.028 0.03 1:300 0.89 0.0017 0.14 0.066 0.11 1:60 0.85 0.0016 0.18 0.05 0.15 1:30 0.73 0.0026 0.22 0.07 0.27 *Caf1.sub.cross-linked fraction = Caf1.sub.free-molecules Caf1x Cross-linker X.sub.remained non-cross-linked fraction
(400) The TEM images (
(401) 7.1 Morphology of Caf1 Hydrogel by Scanning Electron Microscopy (SEM)
(402)
(403)
(404) Unprocessed hydrated Caf1 hydrogels were visualised by ESEM. In ESEM, the hydrogels are exposed to a saturated water vapour environment with minimal drying which allows the study of the pore structure of the hydrogels in the natural hydrated state. The hydrated Caf1 hydrogel exhibited nanopores ranging from 100 nm to 600 nm. The mean size of the pores was approximately 3000.005 nm but the size distribution observed seems relatively wide. The void spaces of Caf1 protein hydrogel are larger than dehydrated Caf1 hydrogel (
8 Morphology of Mammalian Cells on the Caf1 Hydrogel by SEM
(405) Mouse 3T3 fibroblasts and rat primary osteoblasts were cultured using standard culture conditions on the surface of Caf1 WT hydrogels made in accordance with the invention. After 24 h, cells were fixed in 2% of glutaraldehyde, dehydrated and gold coating to be visualised by traditional SEM. In 2D cultures, more fibroblasts presented elongated morphology than osteoblasts. (
9 General Discussion of Examples 5 to 8
(406) 9.1 Caf1 Protein Cross-Linked with 4-Arm PEG-NHS Formed a Gel-Like Material.
(407) Caf1 hydrogels were prepared at room temperature using the tube-inversion method. The gelation time was visually estimated to be within 24 to 27 min for NHS-PEG-NHS and 2 to 22 min for 4-arm PEG-NHS, depending on the concentration of the cross-linker. The higher the concentration of these two cross-linkers the quicker the gelation time. The reaction of Caf1 with different concentrations of DTSSP did not allow the visual estimation of the gelation time since a solid gel was not observed (Table 6).
(408) Thus, the gelation rate was significantly quicker with 4-arm PEG-NHS than the NHS-PEG-NHS and the DTSSP. The increase in gelation rate of 4-arm PEG-NHS could be due to the structure of 4-arm PEG which influences its ability to react with the primary amine groups of Caf1.
(409) The data provided herein showed that the structure of 4-arm PEG-NHS was important for the formation of a gel within a few minutes. The Caf1 protein cross-linked with 4-arm PEG-NHS in ratios (w/w) of 1:5, 1:3 and 1:2 formed hydrogels in 5, 4 and 2 min, respectively (Table 6). Nevertheless, Caf1 protein cross-linked with DTSSP was not gel-like material even after 30 min using the same protein:cross-linker ratios and under sealed conditions (Table 9). The cross-linking reaction time of 30 min was determined based on the available literature and as described in the product instructions. The cross-linkers contain N-hydroxysuccinimide (NHS) ester at the end of the chain which reacts immediately with the primary amines (NH2) of the proteins, and can be rapidly hydrolysed in aqueous solution.
(410) Caf1 hydrogels cross-linked with linear PEG-NHS (NHS-PEG-NHS) was less efficient at forming hydrogels in the same ratios and preparation conditions. In this case the gelation time was slower than with 4-arm PEG-NHS (Table 6). Possibly the reaction between Caf1 and either DTSSP or NHS-PEG requires additional time to form a more compact structure during gelation.
(411) The gelation time reported here is on the order of minutes, which is comparable with other studies using PEG hydrogels.
(412) 9.2 Swelling
(413) The diameter of drops of Caf1 hydrogel cross-linked with DTSSP, NHS-PEG-NHS and 4-arm PEG-NHS changed little with increasing cross-linker added to the reaction. This means that if the concentration of cross-linker is increased, the difference between the initial diameter of the drop measured and the final diameter of the same drop after 16 h in PBS at 37 C. is less and then the ratio between the difference of the two diameters and the initial diameter is lesser than if we added less cross-linker to the reaction with Caf1 polymers, i.e. the Caf1 hydrogel with less cross-linker concentration will spread lesser than the one with more concentration of cross-linker.
(414) Comparing, for example, the diameter change of Caf1 hydrogel cross-linked with DTSSP at ratio of cross-linking of 1:10 is higher (61.2%) than both the diameter change of Caf1 hydrogel cross-linked with NHS-PEG-NHS (40.3%) and 4-arm PEG-NHS (24.2%) using the same ratio of cross-linking (Table 6). Without being limited to this theory, this result could indicate that the hydrogel swelling is a function of network structure of the cross-linker which is consistent with previous research.
(415) 9.3 Caf1 Hydrogel Cross-Linked with 4-Arm PEG-NHS Shows a Higher Degree of Cross-Linking (
(416) After Caf1 hydrogel cross-linking for 30 min at room temperature, 10 l of each hydrogel were heated at 100 C. for 5 min in the presence of SDS-sample buffer and loaded onto a 4-20% gradient gel as well as the control Caf1 protein without any cross-linker at the same concentration used for the formation of Caf1 hydrogel. The gel was stained with Coomassie Brilliant Blue, scanned and analysed by ImageJ version 1.46 software. The band of approximately 15 kDa corresponding to the Caf1 monomer in the non-cross linked Caf1 sample (control) was used as reference for the subsequent analysis. The relative density of the Caf1 monomer band in Caf1 samples cross-linked with the different cross-linkers at various concentrations was determined. The ratio between the values obtained for each sample and the value obtained for the reference sample allowed the determination of the relative density for each band to be calculated. The calculation using the monomers was more accurate than using relative amounts of dimer, trimer, etc due to the presence of a single band with about 15 kDa corresponding to the Caf1 monomer. Since the calculations of the relative density for the high molecular weight bands were more complex. These were considered a single band and designed as Caf1 cross-linked fraction.
(417) At the bottom of the gel the bands with approximately 15 kDa should correspond to the monomers of Caf1 which were not cross-linked. In the case of Caf1 cross-linked with DTSSP, the bands which are resolved between the 25 and 37 kDa protein standard markers could correspond to the Caf1 dimers (35 kDa) linked by one molecule of DTSSP (608.51 Da) (lanes 1-4). In the case of Caf1 cross-linked with NHS-PEG-NHS the bands with approximately 37 kDa protein standard markers might correspond to a Caf1 dimer linked by one molecule of NHS-PEG-NHS (10 kDa) (lanes 5-8). The Caf1 cross-linking with 4-arm PEG-NHS presents a second band which is resolved between 50 and 75 kDa protein standard markers that could correspond to the Caf1 dimer (35 kDa) linked by one molecule of 4-arm PEG-NHS (20 kDa) (lanes 9 to 12). The remaining high molecular weight bands are not possible to define them only by SDS-PAGE gel analysis. Increasing the ratio of cross-linking using different cross-linkers decreased the Caf1 monomeric fraction. A more accurate technique to determine the mass of the complexes formed by Caf1 and cross-linkers could be mass spectrometry, but varying levels of cross-linker attached to monomers would make this difficult.
(418) The theoretical values for the cross-linked fraction were calculated by subtracting the value of the Caf1 non-cross-linked fraction of each sample analysed from the Caf1 reference. As the concentration of the cross-linkers increased the Caf1 cross-linked fraction also increased. In the case of the highest concentration of 4 arm PEG-NHS (20000 Da) the high molecular weight of Caf1 cross-linked fraction did not allow it to totally pass through the gradient gel and thus the value for Caf1 cross-linked fraction calculated (0.28) was higher than the theoretical values calculated (0.84).
(419) 9.4 Caf1 Hydrogel Cross-Linked with DTSSP Revealed a Highly Compact Structure However NHS-PEG-NHS and 4-Arm PEG-NHS Formed Porous Scaffold. High Concentrations of 4-Arm PEG-NHS Resulted in a More Compact Structure (
(420) Caf1 polymers cross-linked with a short arm length cross-linker such as DTSSP (12.0 ) promote a closer contact between the Caf1 fibres and increase the probability of Caf1 self-assembling. Thus, the images obtained by TEM revealed a compact Caf1 hydrogel which reflects this Caf1 fibres proximity (
(421) A different result was obtained for Caf1 polymers cross-linked with a long spacer NHS-PEG-NHS (197 ), which can better separate the Caf1 fibres. Large Caf1 hydrogel meshes were observed by TEM (
(422) When the even longer spacers (394 ) with four arms containing a functional group (NHS) each were used, the interactions between Caf1 and the 4-arm PEG-NHS were frequent due to the number of NHS groups and lysines residues on the Caf1 available for the reaction. The structure was more condensed that on NHS-PEG-NHS (
(423) TEM observations revealed hydrogel meshes (pieces of hydrogel). Without being limited to this theory, this could be due to (1) the preparation of hydrogel for TEM analysis; (2) differences in Caf1 polymer length; (3) number of cross-linking sites obtained by the Caf1 and cross-linker reaction (
(424) The 4-arm PEG-NHS was further characterised due to the fact that it formed a gel-like network.
(425) The Caf1 hydrogels were only obtained with the Caf1 in a polymeric form approximately up to 1.5 m long seen by Soliakov and colleagues (10) which is composed of many monomers each of them containing 8 lysines that can interact with NHS functional groups presented in the cross-linkers ends. In the Caf1 monomeric form this large networks were not seen just as in the other control, 4-arm PEG-NHS only (
(426) Without being limited to this theory, a highly porous hydrogel (
(427) 9.5 Caf1 Hydrogels Presented Varying Pore Diameters Depending on the Technique Used (
(428) The pore diameter of Caf1 hydrogels were assessed by SEM and ESEM. The samples analysed by SEM were prepared by critical point drying and dehydrated using differential ethanol concentrations which might cause some collapse of the network. The pores diameters obtained were on the order of nanometers, while freeze-dried hydrogels presented larger pore with a mean pore diameter of 80.003 m (can be seen in
(429) Caf1 hydrogels were then analysed by ESEM to avoid the dehydration process. The images revealed a mesh-like network structure with a mean pore diameter of 300 nm (can be seen in
(430) 9.6 Caf1 WT Hydrogels are Non-Toxic for Cells However Promote Low Cell Adhesion
(431) Cell hydrogel interaction was examined by measuring the cell viability and spreading on glass coverslips surfaces coated with Caf1 hydrogel cross-linked with 4-arm PEG-NHS (w/w ratio of cross-linking of 1:2). Viable primary osteoblasts seeded onto Caf1 hydrogel displayed few elongated expansion and most of the cells were in a rounded-shape. The mouse 3T3 fibroblasts were not tested for viability. Nevertheless, it was visible that more fibroblasts displayed an elongated morphology when seeded onto Caf1 hydrogels. The cell adhesion and spreading could be improved by the addition of cell adhesive peptides (e.g. RGDS) and also incorporation of proteolytic degradation sites such as metalloproteinases cleavage sites.
(432) Throughout the description and claims of this specification, the words comprise and contain and variations of them mean including but not limited to, and they are not intended to (and do not) exclude other moieties, additives, components, integers or steps. Throughout the description and claims of this specification, the singular encompasses the plural unless the context otherwise requires. In particular, where the indefinite article is used, the specification is to be understood as contemplating plurality as well as singularity, unless the context requires otherwise.
(433) Features, integers, characteristics, compounds, chemical moieties or groups described in conjunction with a particular aspect, embodiment or example of the invention are to be understood to be applicable to any other aspect, embodiment or example described herein unless incompatible therewith. All of the features disclosed in this specification (including any accompanying claims, abstract and drawings), and/or all of the steps of any method or process so disclosed, may be combined in any combination, except combinations where at least some of such features and/or steps are mutually exclusive. The invention is not restricted to the details of any foregoing embodiments. The invention extends to any novel one, or any novel combination, of the features disclosed in this specification (including any accompanying claims, abstract and drawings), or to any novel one, or any novel combination, of the steps of any method or process so disclosed.
(434) The reader's attention is directed to all papers and documents which are filed concurrently with or previous to this specification in connection with this application and which are open to public inspection with this specification, and the contents of all such papers and documents are incorporated herein by reference.
REFERENCES
(435) 1Abramov, V. M., Vasiliev, A. M., Khlebnikov, V. S., Vasilenko, R. N., Kulikova, N. L., Kosarev, I. V., Ishchenko, A. T., Gillespie, J. R., Millett, I. S., Fink, A. L. and Uversky, V. N. (2002) Structural and functional properties of Yersinia pestis Caf1 capsular antigen and their possible role in fulminant development of primary pneumonic plague. J Proteome Res. 1(4):307-15 2Galyov, E. E., Smirnov, Oyu, Karlishev, A. V., Volkovoy, K. I., Denesyuk, A. I., Nazimov, I. V., Rubtsov, K. S., Abramov, V. M., Dalvadyanz, S. M. and Zav'yalov, V. P. (1990) Nucleotide sequence of the Yersinia pestis gene encoding F1 antigen and the primary structure of the protein. Putative T and B cell epitopes. FEBS Lett. 277(1-2):230-2 3Garmory, H. S., Leckenby, M. W., Griffin, K. F., Elvin, S. J., Taylor, R. R., Hartley, M. G., Hanak, J. A. J., Williamson, E. D. And Cranenburgh, R. M. (2005) Antibiotic-Free Plasmid Stabilization by Operator-Repressor Titration for Vaccine Delivery by Using Live Salmonella nteric Serovar Typhimurium. Infection and Immunity. 73(4): 2005-2011 4Greene, L. A. And Tischler, A. S. (1976) Establishment of a Noradrenergic Clonal Line of Rat Adrenal Pheochromocytoma Cells Which Respond to Nerve Growth Factor. Proc Natl Acad Sci USA. 73(7): 2424-8. 5Hung, D. L., Knight, S. D., Woods, R. M., Pinkner, J. S. and Hultgren, S. J. (1996) Molecular basis of two subfamilies of immunoglobulin-like chaperones. EMBO Journal. 15(15) 3792-3805. 6Lindler, L. E., and Tall, B. D. (1993) Yersinia pestis Ph 6 antigen forms fimbriae and is induced by intracellular association with macrophages. Molecular Microbiology 8(2). 311-324. 7Lutolf, M. P. (2009) Integration column: Artificial ECM: expanding the cell biology toolbox in 3D. Integrative Biology. 1(3): 235-241 8Miller J., Williamson E. D., Lakey J. H., Pearce M. J., Jones S. M., Titball R. W. Macromolecular organisation of recombinant Yersinia pestis F1 antigen and the effect of structure on immunogenicity. (1998) FEMS Immunol Med Microbiol. 21(3):213-21 9Morton M., Garmory H. S., Perkins S. D., O'Dowd A. M., Griffin K. F., Turner A. K., Bennett A. M., Titball R. W. (2004) A Salmonella nteric serovar Typhi vaccine expressing Yersinia pestis F1 antigen on its surface provides protection against plague in mice. Vaccine. 22(20):2524-32. 10Soliakov A., Harris J. R., Watkinson A., Lakey J. H. (2010) The structure of Yersinia pestis Caf1 polymer in free and adjuvant bound states. Vaccine. 28(35):5746-54. 11Tibbitt, M., Anseth, K. S. (2009) Hydrogels as Extracellular Matrix mimics for 3D cell culture. Biotechnology and Bioengineering. 103(4): 655-663 12Titball R. W., Howells A. M., Oyston P. C., Williamson E. D. (1997) Expression of the Yersinia pestis capsular antigen (F1 antigen) on the surface of an aroA mutant of Salmonella typhimurium induces high levels of protection against plague. Infectious Immunology. 65(5):1926-30 13Williams, R. C., Gewurz, H. And Quie, P. G. (1972) Effects of fraction 1 from Yersinia pestis on phagocytosis in vitro. Journal of infectious diseases. 126(3): 235-241. 14Zaviolov, A. V., Kersley, J., Korpela, T., Zavalov, V. P., MacIntyre, S. and Knight, S. D (2002) Donor strand complementation mechanism in the biogenesis of non-pilus systems. Molecular Microbiology. 45(4): 983-995. 15Zavialov, A. V. and Knight, S. D. (2007) A novel self-capping mechanism controls aggregation of periplasmic chaperone Caf1M. Molecular Microbiology. 64(1): 153-164. 16Baga, M., Norgren, M. & Normark, S. (1987). BIOGENESIS OF ESCHERICHIA-COLI PAP PILI-PAPH, A MINOR PILIN SUBUNIT INVOLVED IN CELL ANCHORING AND LENGTH MODULATION. Cell 49, 241-251. 17Zavialov, A. V., Batchikova, N. V., Korpela, T., Petrovskaya, L. E., Korobko, V. G., Kersley, J., MacIntyre, S. & Zav'yalov, V. P. (2001). Secretion of recombinant proteins via the chaperone/usher pathway in Escherichia coli. Applied and Environmental Microbiology 67, 1805-1814. 18Piatek, R., Zalewska, B., Bury, K. and Kur, J. (2005) The chaperone-usher pathway of bacterial adhesin biogenesisfrom molecular mechanism to strategies of anti-bacterial prevention and modern vaccine design, Acta Biochimica Polonica, 52(3), pp. 639-646. 19Scheich, Christoph; Kummel, Daniel; Soumailakakis, Dimitri; Heinemann, Udo; Bussow, Konrad (2007) Vectors for co-expression of an unrestricted number of proteins. Nucleic acids research, vol 35, issue 6 20Guzman, Lm; Belin, D; Carson, Mj; et al. (1995) Tight regulation, modulation, and high-level expression by vectors containing the arabinose p-bad promoter journal of bacteriology Volume: 177 Issue: 14 Pages: 4121-4130 21Zavialov, A V; Batchikova, N V; Korpela, T; et al. (2001)Secretion of recombinant proteins via the chaperone/usher pathway in Escherichia coli, Applied And Environmental Microbiology, Volume: 67 Issue: 4 Pages: 1805-1814. 22Chalton, D. A., Musson, J. A., Flick-Smith, H., Walker, N., McGregor, A., Lamb, H. K., Williamson, E. D., Miller, J., Robinson, J. H. and Lakey, J. H. (2006) Immunogenicity of a Yersinia pestis vaccine antigen monomerized by circular permutation, Infection and Immunity, 74(12), pp. 6624-6631.
(436) Further embodiments of the invention are described in the following numbered paragraphs:
(437) Paragraph 1. A chaperone/usher family polypeptide monomer comprising a exogenous bioactive sequence.
(438) Paragraph 2. The polypeptide according to paragraph 1 wherein said polypeptide is a FG loop long family polypeptide monomer.
(439) Paragraph 3. The polypeptide according to paragraph 2, wherein said polypeptide is selected from the group consisting of Caf1, Saf1 and Afa/Dr.
(440) Paragraph 4. The polypeptide according to paragraph 3, wherein said polypeptide is a Caf1 polypeptide.
(441) Paragraph 5. The polypeptide according to paragraph 4, wherein said polypeptide is at least 70% identical to the polypeptide of SEQ ID NO:5. Alternatively, said polypeptide is at least 70% identical to the polypeptide of SEQ ID NO: 5 lacking the first 21 amino acid residues.
Paragraph 6. The polypeptide according to paragraph 1 wherein said polypeptide is a FG loop short family polypeptide monomer.
Paragraph 7. The polypeptide according to paragraph 6, wherein said polypeptide is selected from the group consisting of Fim and Pap.
Paragraph 8. The polypeptide according to any one of paragraphs 1 to 7, wherein said bioactive sequence is selected from the group consisting of a cell adhesion recognition motif, a growth factor sequence motif and a protease site.
Paragraph 9. The polypeptide according to paragraph 8, wherein said bioactive sequence is a cell adhesion recognition motif.
Paragraph 10. The polypeptide according to paragraph 9, wherein said cell adhesion recognition motif is an extracellular matrix cell adhesion recognition motif.
Paragraph 11. The polypeptide according to paragraph 10, wherein said cell adhesion recognition motif is from collagen, elastin, fibronectin, laminin, osteopontin, vitronectin or tenascin.
Paragraph 12. The polypeptide according to paragraph 11, wherein said cell adhesion recognition motif comprises the amino acid sequence RGD.
Paragraph 13. The polypeptide according to paragraph 11, wherein said cell adhesion recognition motif comprises the amino acid sequence PHSRN.
Paragraph 14. The polypeptide according to any one of paragraphs 1 to 13, wherein said bioactive sequence is comprised within said polypeptide at a site which is comprised within a loop structure upon folding of said polypeptide.
Paragraph 15. A chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer according to any one of paragraph 1 to 14.
Paragraph 16. The chaperone/usher family polymer according to paragraph 15, wherein said polymer is a fraction 1 antigen polymer, and said at least one chaperone/usher family polypeptide monomer is a CAF1 polypeptide monomer.
Paragraph 17. The chaperone/usher family polymer according to paragraph 15 or paragraph 16, wherein said exogenous bioactive sequence is a cell adhesion recognition motif comprising the amino acid sequence RGD.
Paragraph 18. The chaperone/usher family polymer according to any one of paragraphs 15 to 17, further comprising at least one naturally occurring CAF1 polypeptide monomer.
Paragraph 19. The chaperone/usher family polymer according to paragraph 18, wherein said at least one naturally occurring CAF1 polypeptide monomer is a Yersinia pestis CAF1 polypeptide.
Paragraph 20. The chaperone/usher family polymer according to paragraph 19, wherein said Yersinia pestis CAF1 polypeptide has the polypeptide sequence of SEQ ID NO:5. Alternatively, said Yersinia pestis CAF1 polypeptide has the polypeptide sequence of SEQ ID NO:5 lacking the first 21 amino acid residues.
Paragraph 21. The chaperone/usher family polymer according to any one of paragraphs 15 to 20, further comprising at least one further polypeptide monomer according to any one of paragraphs 1 to 14, wherein said exogenous bioactive sequence of said at least one further polypeptide monomer is distinct from said exogenous bioactive sequence of said at least one chaperone/usher family polypeptide monomer.
Paragraph 22. The chaperone/usher family polymer according to paragraph 21, wherein said exogenous bioactive sequence of said at least one chaperone/usher family polypeptide monomer is a cell adhesion recognition motif comprising the amino acid sequence RGD and wherein said exogenous bioactive sequence of said at least one further polypeptide monomer is a cell adhesion recognition motif comprising the amino acid sequence PHSRN.
Paragraph 23. A hydrogel comprising the polypeptide according to any one of paragraphs 1 to 14 or the chaperone/usher family polymer according to any one of paragraphs 15 to 22.
Paragraph 24. The hydrogel according to paragraph 23, further comprising a cross linking agent.
Paragraph 25. The hydrogel according to paragraph 24, wherein said cross linking agent is a biodegradable cross linking agent.
Paragraph 26. The hydrogel according to paragraph 24, wherein said cross linking agent is a non-degradable cross linking agent.
Paragraph 27. The hydrogel according to paragraph 24, wherein said cross linking agent comprises polyethylene glycol.
Paragraph 28. Use of a hydrogel according to any one of paragraphs 24 to 27 as a cell support scaffold.
Paragraph 29. The use according to paragraph 28, wherein said scaffold is a 2D cell support scaffold. Alternatively, said scaffold is a 1D cell support scaffold.
Paragraph 30. The use according to paragraph 28, wherein said scaffold is a 3D cell support scaffold.
Paragraph 31. A wound dressing comprising the hydrogel according to any one of paragraphs 23 to 27.
Paragraph 32. A hydrogel according to any one of paragraphs 23 to 27 for use in the treatment of a wound.
Paragraph 33. The hydrogel for use according to paragraph 32, wherein said wound is a chronic wound or wherein said wound is an acute wound.
Paragraph 34. An ocular implant comprising the hydrogel according to any one of paragraphs 23 to 27.
Paragraph 35. A hydrogel according to any one of paragraphs 23 to 27 for use in the treatment of an ocular injury.
Paragraph 36. An expression vector for producing a chaperone/usher family polypeptide monomer, comprising the operably linked elements of: a) a transcription promoter element; b) a nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer comprising a exogenous bioactive sequence; and c) a transcriptional terminator.
Paragraph 37. The expression vector according to paragraph 36, wherein said nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence encodes a CAF1 polypeptide monomer.
Paragraph 38. The expression vector according to paragraph 37, wherein said exogenous bioactive sequence is a cell adhesion recognition motif.
Paragraph 39. The expression vector according to paragraph 37 or paragraph 38, wherein said nucleic acid molecule has at least 70% identity to the nucleotide sequence of SEQ ID NO: 1.
Paragraph 40. The expression vector according to any one of paragraphs 36 to 39, further comprising a nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer.
Paragraph 41. The expression vector according to paragraph 40, wherein said nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer encodes a periplasmic chaperone specific for CAF1.
Paragraph 42. The expression vector according to paragraph 41, wherein said nucleic acid molecule that encodes the periplasmic chaperone specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 2.
Paragraph 43. The expression vector according to anyone of paragraphs 36 to 42, further comprising a nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer.
Paragraph 44. The expression vector according to paragraph 43, wherein said nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer encodes an outer membrane usher protein specific for CAF1.
Paragraph 45. The expression vector according to paragraph 44, wherein said nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 3.
Paragraph 46. The expression vector according to anyone of paragraphs 36 to 45, further comprising a nucleic acid molecule that encodes an expression regulator protein specific for the chaperone/usher family polypeptide monomer.
Paragraph 47. The expression vector according to paragraph 46, wherein said nucleic acid molecule that encodes an expression regulator protein specific for the chaperone/usher family polypeptide monomer encodes an expression regulator protein specific for CAF1.
Paragraph 48. The expression vector according to paragraph 47, wherein said nucleic acid molecule that encodes the expression regulator protein specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 4.
Paragraph 49. A host cell transformed with the expression vector according to any one of paragraphs 36 to 48.
Paragraph 50. The host cell according to paragraph 49, wherein said cell is a bacterial cell.
Paragraph 51. The host cell according to paragraph 50, wherein said bacterial cell is a gram negative bacterial cell.
Paragraph 52. The host cell according to paragraph 51, wherein said bacterial cell is Escherichia coli.
Paragraph 53. A method for producing a chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence, said method comprising: i) incorporating a nucleic acid molecule that encodes a chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence into an expression vector for expression in a host cell; and ii) transfecting a host cell with the expression vector;
wherein said host cell is provided with a nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer and a nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer and wherein the resulting transfected host cell produces a chaperone/usher family polymer.
Paragraph 54. The method according to paragraph 53, wherein said chaperone/usher family polymer is a fraction 1 antigen polymer and said at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence is a CAF1 polypeptide monomer.
Paragraph 55. The method according to paragraph 54, wherein said nucleic acid molecule that encodes the CAF1 polypeptide monomer comprising an exogenous bioactive sequence has at least 70% identity to the nucleotide sequence of SEQ ID NO: 1.
Paragraph 56. The method according to paragraph 54 or paragraph 55, wherein said nucleic acid molecule that encodes a periplasmic chaperone specific for the chaperone/usher family polypeptide monomer encodes a periplasmic chaperone specific for CAF1 and wherein said nucleic acid molecule that encodes an outer membrane usher protein specific for the chaperone/usher family polypeptide monomer encodes an outer membrane usher protein specific for CAF1.
Paragraph 57. The method according to paragraph 56, wherein said nucleic acid molecule that encodes the periplasmic chaperone specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 2.
Paragraph 58. The method according to paragraph 56 or paragraph 57, wherein said nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 3.
Paragraph 59. The method according to any one of paragraphs 56 to 58, wherein said host cell is provided with the nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1 by: i) incorporating the nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1 into an expression vector for expression in the host cell; and ii) transfecting the host cell with the expression vector.
Paragraph 60. The method according to paragraph 59, wherein said expression vector further comprises the nucleic acid molecule that encodes a CAF1 polypeptide monomer comprising a cell adhesion recognition motif.
Paragraph 61. The method according to any one of paragraphs 56 to 60, wherein said host cell is provided with the nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 by: i) incorporating the nucleic acid molecule that encodes the outer membrane usher protein specific for CAF1 into an expression vector for expression in the host cell; and ii) transfecting the host cell with the expression vector.
Paragraph 62. The method according to paragraph 61, wherein said expression vector further comprises the nucleic acid molecule that encodes a CAF1 polypeptide monomer comprising a cell adhesion recognition motif and/or the nucleic acid molecule that encodes a periplasmic chaperone specific for CAF1.
Paragraph 63. The method according to paragraph 53 to 62, wherein said host cell is further provided with a nucleic acid molecule that encodes an expression regulator specific for the chaperone/usher family polypeptide monomer.
Paragraph 64. The method according to paragraph 63, wherein said nucleic acid molecule that encodes an expression regulator specific for the chaperone/usher family polypeptide monomer encodes an expression regulator specific for CAF1.
Paragraph 65. The method according to paragraph 63 or paragraph 64, wherein said nucleic acid molecule that encodes the expression regulator specific for CAF1 has at least 70% identity to the nucleotide sequence of SEQ ID NO: 4.
Paragraph 66. The method according to any one of paragraphs 53 to 65, wherein said bioactive sequence is a cell adhesion recognition motif.
Paragraph 67. The method according to any one of paragraphs 53 to 66, wherein said host cell is a bacterial cell.
Paragraph 68. The method according to paragraph 67, wherein said bacterial cell is a gram negative bacterial cell.
Paragraph 69. The method according to paragraph 68, wherein said bacterial cell is Escherichia coli.
Paragraph 70. A method for producing a chaperone/usher family polymer comprising at least one chaperone/usher family polypeptide monomer comprising an exogenous bioactive sequence comprising: i) providing a vessel comprising a host cell according to any one of paragraphs 49 to 52; ii) providing cell culture conditions which facilitate chaperone/usher family polypeptide monomer expression by a cell culture contained in the vessel; and optionally iii) collecting chaperone/usher family polymer from the vessel.
Paragraph 71. Use of a fraction 1 antigen polymer as an antifouling agent.
Paragraph 72. An antifouling composition comprising a fraction 1 antigen polymer.
Paragraph 73. A chaperone/usher family polypeptide monomer as described herein with reference to the accompanying drawings.
Paragraph 74. A chaperone/usher family polymer as described herein with reference to the accompanying drawings.
Paragraph 75. A hydrogel as described herein with reference to the accompanying drawings.
Paragraph 76. A wound dressing as described herein with reference to the accompanying drawings.
Paragraph 77. A wound dressing as described herein with reference to the accompanying drawings.
Paragraph 78. An ocular implant as described herein with reference to the accompanying drawings.
Paragraph 79. An expression vector as described herein with reference to the accompanying drawings.
Paragraph 80. A host cell transformed as described herein with reference to the accompanying drawings.
Paragraph 81. A method for producing a chaperone/usher family polymer as described herein with reference to the accompanying drawings.