MR1 RESTRICTED T CELL RECEPTORS FOR CANCER IMMUNOTHERAPY

Abstract

The invention relates to a method of isolating a T cell that expresses a T cell receptor capable of binding specifically to an antigen presented by a cancer cell in association with an MR1 molecule. The method comprises the steps of (a) providing a preparation of T cells, (b) contacting the preparation with cancer cells expressing MR1 protein; (c) isolating a T cell that is specifically reactive to said cancer cells.

The invention further relates to a method of preparing a T cell preparation expressing select MR1 recognizing T cell receptors from transgene expression vectors, the use of such T cell preparations in treatment of cancer, and to collections of MR1 reactive T cell receptor encoding nucleic acids and cells.

Claims

1. A method of preparing a preparation of MR1T cells that express a T cell receptor capable of binding to an antigen presented by a cancer cell in association with an MR1 molecule, comprising the steps of a. providing a tumour sample obtained from a patient; b. contacting said tumour sample with i. a plurality of T cell clones, wherein each T cell clone is characterized by an MR1T cell receptor capable of binding specifically to an antigen presented by a cancer cell in association with an MR1 molecule; or ii. a plurality of isolated, labelled and multimerized soluble T cell receptors isolated from MR1T cell receptor molecules; wherein each of said T cell clones or each of said isolated, labelled and multimerized soluble T cell receptors is characterized by a CDR3 sequence tract selected from any one of SEQ ID NO 065 to SEQ ID NO 096, or a CDR3 sequence tract characterized by a sequence identical to a sequence selected from any one of SEQ ID NO 065 to SEQ ID NO 096 with one or two amino acid substitutions, particularly wherein said substitutions are selected according to the substitution rules given below; more particularly the T cell clone or soluble TCR is characterized by a CDR3 sequence selected from any one of SEQ ID NO 065 to SEQ ID NO 096 wherein the sequence comprises a maximum total of 0,1, or 2 substitutions in a position located between the fourth N terminus amino acid and the fifth C terminus amino acid of said CDR3 alpha, gamma or delta sequences, or the fourth N terminus amino acid and the sixth C terminus amino acid of said CDR3 beta sequence, according to the substitution rules: glycine (G) and alanine (A) are interchangeable; valine (V), leucine (L), and isoleucine (I) are interchangeable, A and V are interchangeable; tryptophan (W) and phenylalanine (F) are interchangeable, tyrosine (Y) and F are interchangeable; serine (S) and threonine (T) are interchangeable; aspartic acid (D) and glutamic acid (E) are interchangeable asparagine (N) and glutamine (Q) are interchangeable; N and S are interchangeable; N and D are interchangeable; E and Q are interchangeable; methionine (M) and Q are interchangeable; cysteine (C), A and S are interchangeable; proline (P), G and A are interchangeable; arginine (R) and lysine (K) are interchangeable; or wherein each of said T cell clones or said isolated, labelled and multimerized soluble T cell receptors is characterized by a nucleic acid sequence selected from SEQ ID NO 007 to SEQ ID NO 012 or SEQ ID NO 037 to SEQ ID NO 060 or SEQ ID NO 063 to SEQ ID NO 064 and/or an amino acid sequence selected from SEQ ID NO 001 to SEQ ID 006 or SEQ ID NO 013 to SEQ ID NO 036 or SEQ ID NO 061 to SEQ ID NO 062; or a T cell receptor a chain nucleic acid sequence selected from SEQ ID NO 007, 009 to 011 or SEQ ID NO 037 to SEQ ID NO 048 and/or an amino acid sequence selected from SEQ ID NO 001, 003 to 005 or SEQ ID NO 013 to SEQ ID NO 024; or an amino acid sequence at least 85% (>90%, 95%, 98%) identical to SEQ ID NO 001, 003 to 005 or SEQ ID NO 013 to SEQ ID NO 024 and having the same biological activity, particularly an amino acid sequence at least 85% (>90%, 95%, 98%) identical to SEQ ID NO 001, 003 to 005 or SEQ ID NO 013 to SEQ ID NO 024 comprising a CDR sequence selected from SEQ ID NO 065 to SEQ ID NO 079 and/or a T cell receptor β chain nucleic acid sequence selected from SEQ ID NO 008, 010 to 012 or SEQ ID NO 049 to SEQ ID NO 060 and/or an amino acid sequence selected from SEQ ID NO 002, 004 to 006 or SEQ ID NO 025 to SEQ ID NO 036 or an amino acid sequence at least 85% (≥90%, 95%, 98%) identical to SEQ ID SEQ ID NO 002, 004 to 006 or SEQ ID NO 025 to SEQ ID NO 036 and having the same biological activity, particularly an amino acid sequence at least 85% (≥90%, 95%, 98%) identical to SEQ ID NO 002, 004 to 006 or SEQ ID NO 025 to SEQ ID NO 036 comprising a CDR sequence selected from SEQ ID NO 080 to SEQ ID NO 094; or a T cell receptor γ chain nucleic acid sequence SEQ ID NO 61 and/or an amino acid sequence SEQ ID NO 063 or a sequence at least 85% (≥90%, 95%, 98%) identical thereto and having the same biological activity, particularly an amino acid sequence at least 85% (≥90%, 95%, 98%) identical to SEQ ID NO 063 and comprising a CDR3 of SEQ ID NO 095; and/or a T cell receptor δ chain nucleic acid sequence SEQ ID NO 64 and/or an amino acid sequence SEQ ID NO 062, or an amino acid sequence at least 85% (≥90%, 95%, 98%) identical to SEQ ID NO 062 and comprising a CDR3 of SEQ ID NO 096; or wherein each of said T cell clones or said isolated, labelled and multimerized soluble T cell receptors is characterized by a T cell receptor α chain and β chain nucleic acid sequence pair selected from the pairs: SEQ ID NO 007 and SEQ ID NO 008; or SEQ ID NO 009 and SEQ ID NO 010; or SEQ ID NO 011 and SEQ ID NO 012, SEQ ID NO 037 and SEQ ID NO 049; or SEQ ID NO 038 and SEQ ID NO 050; or SEQ ID NO 039 and SEQ ID NO 051; or SEQ ID NO 040 and SEQ ID NO 052; or SEQ ID NO 041 and SEQ ID NO 053; or SEQ ID NO 042 and SEQ ID NO 054; or SEQ ID NO 043 and SEQ ID NO 055; or SEQ ID NO 044 and SEQ ID NO 056; or SEQ ID NO 045 and SEQ ID NO 057; or SEQ ID NO 046 and SEQ ID NO 058; or SEQ ID NO 047 and SEQ ID NO 059; or SEQ ID NO 048 and SEQ ID NO 060; or wherein each of said T cell clones or said isolated, labelled and multimerized soluble T cell receptors is characterized by a T cell receptor γ chain and δ chain nucleic acid sequence pair selected from SEQ ID NO 063 and SEQ ID NO 064; or wherein each of said T cell clones or said isolated, labelled and multimerized soluble T cell receptors is characterized by a T cell receptor α chain and β chain amino acid sequence pair selected from: SEQ ID NO 001 and SEQ ID NO 002; or, SEQ ID NO 003 and SEQ ID NO 004; or SEQ ID NO 005 and SEQ ID NO 006, SEQ ID NO 013 and SEQ ID NO 025; or SEQ ID NO 014 and SEQ ID NO 026; or SEQ ID NO 015 and SEQ ID NO 027; or SEQ ID NO 016 and SEQ ID NO 028; or SEQ ID NO 017 and SEQ ID NO 029; or SEQ ID NO 018 and SEQ ID NO 030; or SEQ ID NO 019 and SEQ ID NO 031; or SEQ ID NO 20 and SEQ ID NO 032; or SEQ ID NO 021 and SEQ ID NO 033; or SEQ ID NO 022 and SEQ ID NO 034; or SEQ ID NO 023 and SEQ ID NO 035; or SEQ ID NO 024 and SEQ ID NO 036; or a pair selected from the pairs given in the previous two paragraphs wherein each of the partners may have a sequence at least 85% (≥90%, 95%, 98%) identical to the indicated SEQ ID NO and the pair has the same biological activity as the unmutated pair; or wherein each of said T cell clones or said isolated, labelled and multimerized soluble T cell receptors is characterized by a T cell receptor γ chain SEQ ID NO 061 and δ chain amino acid sequence SEQ ID NO 062, or a pair wherein each of the partners may have a sequence at least 85% (≥90%, 95%, 98%) identical thereto and the pair has the same biological activity as the unmutated pair; iii. identifying an MR1T cell receptor specifically reactive to said tumour sample; c. providing a T cell preparation; d. introducing into said T cell preparation a nucleic acid expression construct encoding an MR1-reactive T cell receptor identified as being specifically reactive to said tumour sample in step iii., yielding a transgene T cell preparation.

2. The method according to claim 1, wherein said T cell preparation is obtained from the same patient (autologous adoptive T cell therapy).

3. The method according to claim 1, wherein said T cell preparation is obtained from another subject, particularly a HLA-matched subject (allogeneic adoptive T cell therapy).

4. The method according to claim 1, wherein said T cell preparation is obtained from peripheral blood, particularly wherein said T cell preparation is obtained by selecting PBMC for expression of one or several T cell markers selected from the group containing CD4, CD8, CD27, CD45RA and CD57, particularly selecting CD3.sup.+ CD4.sup.+, or CD3.sup.+ CD8.sup.+, or CD3.sup.+ CD27.sup.+ CD45RA.sup.+, or CD3.sup.+ CD27.sup.+ CD45RA.sup.−, or CD3.sup.+ CD27.sup.− CD45RA.sup.−, or CD3.sup.+ CD57.sup.− or CD3.sup.+ CD57.sup.+ T cells.

5. The method according to claim 1, wherein said T cell preparation is obtained from a tumour biopsy followed by subsequent expansion in-vitro.

6. A preparation of MR1-specific T cells obtained by the method of claim 1 for use in a method of therapy or prevention of cancer, in particular a cancer characterized by MR1 expression.

7. An expression vector comprising a nucleic acid sequence encoding a. a functional T cell receptor heterodimer, or b. a T cell receptor α chain capable of forming a functional T cell receptor heterodimer together with a T cell receptor β chain, and/or c. a T cell receptor β chain capable of forming a functional T cell receptor heterodimer together with a T cell receptor α chain, wherein said T cell receptor heterodimer is capable of specifically binding to an MR1 molecule, wherein said MR1 molecule is expressed on a tumour cell and presents a tumour-associated antigen, and wherein said nucleic acid sequence is or comprises a nucleic acid sequence selected from SEQ ID NO 007 to SEQ ID NO 012, and/or encodes an amino acid sequence selected from SEQ ID NO 001 to SEQ ID 006; or an amino acid sequence at least 85% (≥90%, 95%, 98%) identical to SEQ ID NO 001, 003 to 005 and having the same biological activity, particularly an amino acid sequence at least 85% (≥90%, 95%, 98%) identical to SEQ ID NO 001, 003 to 005 comprising a CDR sequence selected from SEQ ID NO 065 to SEQ ID NO 067; or is or comprises a T cell receptor a chain nucleic acid sequence selected from SEQ ID NO 007, SEQ ID NO 009 or SEQ ID NO 011, and/or encodes amino acid sequences selected from SEQ ID NO 001, SEQ ID NO 003 or SEQ ID NO 005; or is or comprises a T cell receptor β chain nucleic acid sequence selected from a selected from SEQ ID NO 008, SEQ ID NO 010 or SEQ ID NO 012, and/or encodes an amino acid sequences selected from SEQ ID NO 002, SEQ ID NO 004 or SEQ ID NO 006; or is or comprises a T cell receptor a chain and β chain nucleic acid sequence pair selected from the pairs: SEQ ID NO 007 and SEQ ID NO 008; or SEQ ID NO 009 and SEQ ID NO 010; or SEQ ID NO 011 and SEQ ID NO 012; or encodes a T cell receptor α chain and β chain amino acid sequence pair selected from the pairs: SEQ ID NO 001 and SEQ ID NO 002; or SEQ ID NO 003 and SEQ ID NO 004; or SEQ ID NO 005 and SEQ ID NO 006.

8. An isolated T cell receptor protein heterodimer comprising an amino acid sequence selected from SEQ ID NOs 001 to 006, or a sequence at least 85% (≥90%, 95%, 98%) identical to an amino acid sequence selected from SEQ ID NOs 001 to 006 and having the same biological activity, particularly wherein the sequence comprises a CDR3 sequence selected from SEQ ID 65, 66, 67, 80, 81 and 82.

9. The isolated T cell receptor protein heterodimer according to claim 8, wherein said isolated T cell receptor protein comprises a pair of amino acid sequence selected from SEQ ID NO 001 and SEQ ID NO 002, SEQ ID NO 003 and SEQ ID NO 004, SEQ ID NO 005 and SEQ ID NO 006 or a pair selected from the pairs given hereinabove wherein each of the partners may have a sequence at least 85% (≥90%, 95%, 98%) identical to the indicated SEQ ID NO and the pair has the same biological activity as the unmutated pair; particularly wherein each of the amino acid sequences comprises a CDR3 sequence identical to the indicated SEQ ID NO.

10. The isolated T cell receptor protein heterodimer that binds to an MR1 molecule according to claim 8, wherein said MR1 molecule presents a tumour-associated antigen.

11. A recombinant cell comprising the expression vector according to claim 7, wherein said recombinant cell is a T cell derived from a. peripheral blood or b. a tumour infiltrating lymphocyte.

12. The recombinant cell according to claim 11 for use in a method of therapy or prevention of cancer, in particular a cancer characterized by MR1 expression.

13. The recombinant cell for use in a method of therapy or prevention of cancer according to claim 12, wherein said cell is administered by adoptive T cell immunotherapy.

14. A collection of nucleic acid sequences, wherein each member of the collection facilitates the expression of a different T cell receptor α chain, T cell receptor β chain, or a T cell receptor a chain and β chain combination in a mammalian cell, wherein said combination is capable of specifically binding to an MR1 molecule presenting a cancer antigen, wherein the collection comprises a sequence selected from SEQ ID NO 007 to SEQ ID NO 012 and/or the collection comprises sequences encoding a monoer of the T cell receptor molecule (or a T cell receptor constituting alpha or beta chain) dimer of claim 8 selected from SEQ ID NO 001 to SEQ ID 006.

15. A collection of recombinant T cells, wherein each member of the collection expresses as a transgene a T cell receptor capable of specifically binding to an MR1 molecule presenting a cancer antigen according to claim 8.

16. An MR1 expressing nucleic acid expression vector comprising a nucleic acid sequence encoding MR1 under control of a promoter sequence operable in a mammalian cell, for use in cancer treatment, wherein said MR1 expressing nucleic acid expression vector is administered before, concomitant with or after administration of an expression vector according to claim 7 or an expressing recombinant cell thereof.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0097] FIG. 1. MR1T cells do not recognize microbial antigens. (A) Surface expression of MR1 by CCRFSB, THP-1 and A375-MR1 cells. Grey histograms indicate staining with isotype-matched control mAbs. Stimulation of (B) MR1T cell clone DGB129 or (C) MAIT cell clone SMC3 by the three cell lines in A in the absence (no Ag) or presence of E. coli lysate (E. coli) and/or anti-MR1 blocking mAbs (α-MR1). The MAIT clone SMC3 was previously isolated from PBMC of a healthy donor and expresses canonical MAIT phenotype and function. Columns indicate IFN-γ release (mean+SD). Stimulation of (D) DGB129 MR1T or (E) SMC3 MAIT cells by THP-1 cells, constitutively expressing surface MR1, loaded with synthetic 6,7-dimethyl-8-D-ribityllumazine (RL-6,7-diMe) with or without anti-MR1 mAbs. Columns indicate mean IFN-γ release+SD. Data are representative of four (A, B and C), two (D and E). *P<0.05 (Unpaired Student's t-test).

[0098] FIG. 2. Isolation strategy of MR1T cell clones from peripheral T cells. (A) FACS analysis of purified T cells previously expanded with irradiated A375-MR1 cells following overnight co-culture with A375-MR1 cells in the absence of exogenous antigens. Left dot plot shows CD3 and CellTrace violet (CTV) staining in live cells. Right dot plot shows CD69 and CD137 expression of CD3-positive CTV-negative gated cells. Arrows indicate gating hierarchy. Numbers indicate the percentages of cells within the gates. Cells from Donor A are illustrated as a representative donor. (B, D) Cumulative results of T cell clones screening from Donors A and B. T cell clones were generated from CD3.sup.+CTV.sup.−CD137.sup.+ sorted T cells as depicted in A. Graphs show the individual clones (x axis) and their IFN-γ release (y axis), expressed as ratio between the amount of cytokine secreted in response to A375-MR1 cells vs. A375 WT cells.

[0099] Each dot represents a single T cell clone, tested at the same time in the indicated experimental conditions. The vertical lines indicate the number of T cell clones displaying MR1-restricted reactivity (i.e. the clones showing an IFN-γ release ratio above the arbitrary cut-off of 2). Results are representative of two independent experiments. (C, E) IFN-γ release by 14 representative clones from Donor A and 11 clones from Donor B after stimulation with A375 WT, A375-MR1 and A375-MR1 in the presence of blocking anti-MR1 mAbs (α-MR1). Dots represent the IFN-γ release (mean±SD of duplicate cultures) by each clone. Results are representative of three independent experiments. * P<0.05 (Unpaired Student's t-test).

[0100] FIG. 3. MR1T cells are common in the blood of healthy individuals. (A) Flow cytometry analysis of purified T cells from a representative donor (Donor C) after overnight co-culture with A375 WT or A375-MR1 cells. Dot plots show CD69 and CD137 expression on live CD3.sup.+ cells. Numbers indicate the percentage of cells in the gates. (B) Frequency of CD69.sup.+CD137.sup.+ T cells from 5 different donors after overnight co-culture with A375 WT or A375-MR1 cells. (C) Cumulative results of T cell clone stimulation assays from Donor C. T cell clones were generated from CD3.sup.+CD69.sup.+CD137.sup.+ sorted T cells as depicted in A, right dot plot. The graph shows the number of tested clones (x axis) and IFN-γ release (y axis) expressed as ratio between the amounts of cytokine secreted in response to A375-MR1 cells vs. A375 WT cells. Each dot represents a single T cell clone, tested at the same time in the indicated experimental conditions. The vertical line indicates the number of T cell clones displaying MR1-restricted reactivity (i.e. the clones showing an IFN-γ release ratio above arbitrary cut-off of 2). Results are representative of two independent experiments. (D) Recognition of A375-MR1 but not A375 WT cells in the absence of exogenous antigens by 8 representative MR1-restricted T cell clones from Donor C. Inhibition of T cell clone reactivity to A375-MR1 cells by blocking anti-MR1 mAbs (α-MR1). Dots represent the IFN-γ release (mean±SD of duplicate cultures) by each clone tested in the three experimental conditions. Results are representative of three independent experiments. * P<0.05 (Unpaired Student's t-test).

[0101] FIG. 4. MR1T TCR gene transfer confers MR1-restricted recognition of A375 cells. Stimulation of (A) SKW-3 cells expressing the DGB129 TCR (SKW3-DGB129) and (B) J.RT3-T3.5 cells expressing the MAIT MRC25 TCR (J.RT3-MAIT) with A375 cells that expressed (A375-MR1) or lacked (A375 WT) MR1, with or without E. coli lysate and anti-MR1 mAbs. Stimulation of SKW-3 cells expressing the TCRs of three individual MR1T cell clones (C) DGA4 (SKW3-DGA4), (D) DGB70 (SKW3-DGB70) and (E) JMA (SKW3-JMA) with A375-MR1 or A375 WT cells in the presence or not of or anti-MR1 mAbs. CD69 median fluorescence intensity (MFI)+SD of duplicate cultures of transduced T cells are shown. The CD69 MFI of transduced T cells cultured in the absence of APCs is also shown. Mock-transduced T cells showed background levels of CD69 expression when incubated with A375-MR1 or A375 WT (not shown). Data are representative of three independent experiments. * P<0.05 (Unpaired Student's t-test).

[0102] FIG. 5. Differential recognition of various types of tumour cells by MR1T cell clones. (A) Recognition of four human cells lines expressing constitutive surface levels of MR1 by the representative SMC3 MAIT cell clone in the absence (no Ag) or presence of E. coli lysate (E. coli) with or without anti-MR1 blocking mAbs (α-MR1). (B) Recognition of the same cell types as in A by thirteen MR1T cell clones with or without anti-MR1 mAbs (α-MR1). Graphs show IFN-γ release (mean±SD of duplicate cultures).

[0103] FIG. 6. MR1T cell clones do not react to microbial ligands or to 6-FP. (A) Response of seven MR1T cell clones and one control MAIT cell clone co-cultured with A375 cells expressing (A375-MR1) or not (A375 WT) MR1 in the presence or absence of E. coli lysate. Blocking of T cell clone reactivity by anti-MR1 mAbs (α-MR1) is also shown. (B) Response of MR1T cell clones to A375 cells expressing either WT MR1 molecules (A375-MR1) or K43A-mutated MR1 molecules (A375-MR1 K43A) in the presence of 6-formyl pterin (6-FP). (C) Stimulation of control MAIT cell clone MRC25 or control TCR Vγ9Vδ2 clone G2B9 with A375-MR1 or A375-MR1 K43A cells previously incubated with or without E. coli lysate or zoledronate, respectively, either in the absence or presence of 6-FP. Results are expressed as mean±SD of IFN-γ measured in duplicate cultures. Results are representative of three independent experiments. * P<0.05 (Unpaired Student's t-test).

[0104] FIG. 7. MR1T cell clones do not recognize Ac-6-FP. (A) Stimulation of three representative MR1T cell clones by A375-MR1 cells in the absence or presence of acetyl-6-formyl pterin (Ac-6-FP). (B) Stimulation of two MAIT cell clones (MRC25 and SMC3) by A375-MR1 cells pulsed with E. coli lysate in the absence or presence of Ac-6-FP. (C) A375-MR1 cells were treated with zoledronate (Zol) in the absence or presence of Ac-6-FP (25 μg/ml) and used to stimulate a TCR Vγ9-Vδ2 cell clone (G2B9). (D) A375 cells expressing K43A mutant MR1 molecules (A375-MR1 K43A) were used to stimulate the three MR1T cell clones shown in A, in the absence or presence of Ac-6-FP (25 μg/ml). (E) Stimulation of the two MAIT cell clones used in B by A375-MR1 K43A cells pulsed with E. coli lysate in the absence or presence of Ac-6-FP (25 μg/ml). Results are expressed as mean±SD of IFN-γ release assessed in duplicate cultures and are representative of three independent experiments. * P<0.05 (Unpaired Student's t-test).

[0105] FIG. 8. MR1T cells recognize antigens present in tumour cells and not derived from RPMI 1640 medium. Stimulation of the DGB129 MR1T cell clone by MR1-overexpressing (A) A375 cells (A375-MR1) and (B) THP-1 cells (THP1-MR1) grown for 4 days in RPMI 1640 or in PBS both supplemented with 5% human serum. Inhibition of T cell clone reactivity by anti-MR1 blocking mAbs (α-MR1) is shown. DGB129 cells recognize APCs loaded with fractions isolated from (C) THP-1 cell lysate or from (D) in vivo grown mouse breast tumour EMT6. Fractions E1 and E2 contain hydrophobic molecules; fractions N1-N4 contain hydrophilic molecules. (E) DGB70 MR1T cells react to N3 fraction of THP-1 lysate. (F) Stimulation of DGB129 and DGB70 T cells by THP-1-derived fractions N3 and N4 loaded onto plastic-bound recombinant MR1. Shown is T cell release of IFN-γ or GM-CSF mean±SD of duplicate cultures (representative of three independent experiments). Total cytokine release is shown in panels A, B, F; fold increase over background is shown in panels C, D, E. *P<0.05 (Unpaired Student's t-test).

[0106] FIG. 9. MR1T cells display differential anti-tumour responses. The MR1-expressing tumour cell lines THP-1 and A375 were cultured overnight with the MR1T cell clones (A) DGB129 or (B) DGB70 at the indicated effector:target (E:T) ratios. The graphs show the percentages of apoptotic target cells in individual experimental conditions, assessed by flow cytometry using Annexin V and propidium iodide staining. MR1T cells were identified by staining with anti-CD3 mAbs and excluded from the analysis. Inhibition of MR1T cell clone killing capacity by anti-MR1 (α-MR1) mAbs is also shown at the 1:1 E:T ratio. (C) Recognition of Mo-DCs isolated from a healthy individual by thirteen MR1T cell clones with or without anti-MR1 mAbs (α-MR1). Graphs show IFN-γ release (mean±SD of duplicate cultures). (D) Recognition of Mo-DCs from three donors by the representative DGB129 MR1T cell clone in the absence or presence of anti-MR1 (α-MR1) mAbs. IFN-γ release in the supernatants is shown and expressed as mean±SD. (E) Flow cytometry analysis of co-stimulatory molecules CD83 and CD86 on Mo-DCs after co-culture with DGB129 MR1T cells with or without anti-MR1 mAbs (α-MR1). A control group consisting of Mo-DCs stimulated with LPS (10 ng/ml) in the absence of T cells is also shown. Numbers indicate percentages of cells in each quadrant. (F) Stimulation of JMAN MR1T cell clone by LS 174T and HCT116 gastrointestinal tumour cell lines and by normal gut epithelial cells (GEC) in the presence or not of anti-MR1 mAbs (α-MR1). Columns show IFN-γ release (mean±SD of duplicate cultures). All the results are representative of at least three independent experiments. * P<0.05 (Unpaired Student's t-test).

[0107] FIG. 10. Functional heterogeneity of MR1T cell clones. (A) IFN-γ released by 7 selected MR1T cell clones stimulated with A375-MR1 cells. ELISA results are expressed as mean±SD of IFN-γ release measured in duplicate cultures. (B) Analysis of 16 additional cytokines by multiplex cytokine assay performed on the same supernatants for which IFN-γ is shown in A. Results are representative of two independent experiments.

[0108] FIG. 11. MR1T cell clones display multiple chemokine-receptor expression profiles. Flow cytometry analysis of CXCR3, CCR4 and CCR6 surface expression by seven selected resting MR1T cell clones. Graphs show the relative fluorescence intensity calculated by dividing the median fluorescence intensity (MFI) of specific mAb staining by the MFI of the corresponding isotype control. Data are representative of two independent experiments.

[0109] FIG. 12. MR1T cells reduce the number of human melanoma lung nodules in mice. Immunocompromised NSG mice were injected with the human melanoma A375 cells expressing MR1 (A375-MR1) and with MR1T cells. On day 14, mice were sacrificed and lung nodules were counted after India ink perfusion. P<0.0001 (Unpaired Student's t-test).

BRIEF DESCRIPTION OF THE DESCRIBED SEQUENCES

[0110] The nucleic and/or amino acid sequences provided herewith are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file named 95083_306_17_seq.txt, created Dec. 19, 2021, about 128 KB, which is incorporated by reference herein.

EXAMPLES

Methods

[0111] Cells. The following human cell lines were obtained from American Type Culture Collection: A375 (melanoma), THP-1 (myelomonocytic leukemia), J.RT3-T3.5 (TCRβ-deficient T cell leukemia), LS 174T (colon adenocarcinoma), HCT116 (colon carcinoma), Huh7 (hepatocellular carcinoma), HEK 293 (human embryonic kidney), and CCRF-SB (acute B cell lymphoblastic leukemia). SKW-3 cells (human T cell leukemia deficient in TCRα, β, γ and δ genes) were obtained from the Leibniz-Institute DSMZ-German Collection of Microorganisms and Cell Cultures. Two representative MAIT clones (MRC25 and SMC3) and one TCR γδ clone, (G2B9) (Gober et al., The Journal of experimental medicine 197, 163-168 (2003)) were used in this study as control cells and were generated from blood of two healthy donors and maintained in culture as previously described (Lepore et al., Nat Commun 5, 3866 (2014)). MR1T cells were isolated from the peripheral blood of healthy individuals after informed consent was obtained from donors at the time of blood collection under approval of the “Ethikkommision Nordwest and Zentralschweiz/EKNZ (139/13). Briefly, T cells purified by negative selection (EasySep™ Human T Cell Enrichment Kit, StemCell) were stimulated with irradiated (80 Gray) A375-MR1 cells (ratio 2:1) once a week for three weeks. Human rIL-2 (5 U/ml; Hoffmann-La Roche), rIL-7 and rIL-15 (both at 5 ng/ml, Peprotech) were added at day +2 and +5 after each stimulation. Twelve days after the last stimulation cells were washed and co-cultured overnight with A375-MR1 cells (ratio 2:1). CD3.sup.+CD69.sup.+CD37.sup.+ cells were then sorted and cloned by limiting dilution in the presence of PHA (1 μg/ml, Wellcome Research Laboratories), human rIL-2 (100 U/ml, Hoffmann-La Roche) and irradiated PBMC (5×10.sup.5 cells/ml). In other experiments, MR1T cells clones were generated using the same protocol from sorted CD3.sup.+CD69.sup.+CD137.sup.+ upon a single overnight stimulation with A375-MR1 cells (ratio 2:1). T cell clones were periodically re-stimulated following the same protocol (Lepore et al., ibid.). Monocytes and B cells were purified (>90% purity) from PBMCs of healthy donors using EasySep Human CD14 and CD19 positive selection kits (Stemcell Technologies) according to the manufacturer instructions. Mo-DCs were differentiated from purified CD14.sup.+ monocytes by culture in the presence of GM-CSF and IL-4 as previously described (Lepore et al., ibid.). Human normal gut epithelial cells (GEC) were isolated from gut biopsies of tumour-free individuals according to a published protocol (Graves et al., Journal of immunological methods 414, 20-31 (2014)).

[0112] Generation of cells expressing MR1A gene covalently linked with β2 m. A human MR1A cDNA construct linked to β2 m via a flexible Gly-Ser linker was generated by PCR as previously described (Lepore et al., ibid.). The K43A substitution in the MR1A cDNA was introduced into the fusion construct using the following primers: MR1 K43A_f 5′-CTCGGCAGGCCGAGCCACGGGC (SEQ ID NO 097) and MR1 K43A_r 5′GCCCGTGGCTCGGCCTGCCGAG (SEQ ID NO 098). Resulting WT and mutant constructs were cloned into a bidirectional lentiviral vector (LV) (Lepore et al., ibid.). HEK 293 cells were transfected with individual LV-MR1A-β2 m constructs together with the lentivirus packaging plasmids pMD2.G, pMDLg/pRRE and pRSV-REV (Addgene) using Metafectene Pro (Biontex) according to manufacturer instructions. A375, and THP-1, cells were transduced by spin-infection with virus particle containing supernatant in the presence of 8 μg/ml protamine sulfate. Surface expression of MR1 was assessed by flow cytometry and positive cells were FACS sorted.

[0113] Soluble recombinant β2 m-MR1-Fc fusion protein. β2 m-MR1-Fc fusion construct was obtained using human MR1A-β2 m construct described above as template. DNA complementary to β2 m-MR1A gene was amplified by PCR using primers: β2 mXhoI_f 5′-CTCGAGATGTCTCGCTCCGTGGCCTTA (SEQ ID NO 099) and MR1-IgG1_r 5′-GTGTGAGTTTTGTCGCTAGCCTGGGGGACCTG (SEQ ID NO 100), thus excluding MR1 trans-membrane and intracellular domains. The DNA complementary to the hinge region and CH2-CH3 domains of human IgG1 heavy chain was generated using the following primers: NheI-hinge-f 5′-CAGGTCCCCCAGGCTAGCGACAAAACTCACAC (SEQ ID NO 101) and IgG1NotI_r 5′-GCGGCCGCTCATTTACCCGGAGACAGGGAGA (SEQ ID NO 102) from pFUSE-hIgG1-Fc1 (InvivoGen). The β2m-MR1A and IgG1 PCR products were joined together using two-step splicing with overlap extension PCR and the resulting construct subcloned into the XhoI/NotI sites of the BCMGSNeo expression vector. CHO-K1 cells were transfected with the final construct using Metafectene Pro (Biontex), cloned by limiting dilutions and screened by ELISA for the production of β2m-MR1-Fc fusion protein. Selected clones, adapted to EX-CELL ACF CHO serum-free medium (Sigma), were used for protein production and β2m-MR1-Fc was purified using Protein-A-Sepharose (Thermo Fisher Scientific) according to manufacturer instructions. Protein integrity and purity were verified by SDS-PAGE and Western Blot using anti-MR1 mAb 25.6 (Biolegend).

[0114] Flow cytometry and antibodies. Cell surface labeling was performed using standard protocols. Intracellular labeling was performed using the True-Nuclear™ Transcription Factor Buffer Set according to the manufacturers' instructions. The following anti-human mAbs were obtained from Biolegend: CD4-APC (OKT4), CD8α-PE (TuGh4), CD161-Alexa Fluor 647 (HP-3G10), CD69-PE (FN50), CD3-PE/Cy7, Brilliant Violet-711, or Alexa-700 (UCHT1), CD137-biotin (n4b4-1), CXCR3-Brilliant Violet 421 (G025H7), CD83-biotin (HB15e), MR1-PE (26.5) and TRAV1-2-PE (10C3). CD86-FITC (2331), CCR4-PECy7 (1G1) and CCR6-PE (11A9) mAbs were from BD Pharmingen. All these mAbs were used at 5 μg/ml. Biotinylated mAbs were revealed with streptavidin-PE, -Alexa Fluor 488, or -Brilliant violet 421 (2 μg/ml, Biolegend). Samples were acquired on LSR Fortessa flow cytometer (Becton Dickinson). Cell sorting experiments were performed using an Influx instrument (Becton Dickinson). Dead cells and doublets were excluded on the basis of forward scatter area and width, side scatter, and DAPI staining. All data were analyzed using FlowJo software (TreeStar).

[0115] TCR gene analysis of MR1T cell clones. TCRα and β or gene TCRγ and δ expression by MR1T cell clones was assessed either by RT-PCR using total cDNA and specific primers, or by flow cytometry using the IOTest® Beta Mark TCR Vβ Repertoire Kit (Beckman Coulter) according to the manufacturers' instructions or panyδ TCR-specific monoclonal antibodies (B1, Biolegend). For RT-PCR, RNA was prepared using the NucleoSpin RNA II Kit (Macherey Nagel) and cDNA was synthesized using Superscript III reverse transcriptase (Invitrogen). TCRα, β, γ and δ cDNAs were amplified using sets of Vα, Vβ, Vγ and Vδ primers as directed by the manufacturer (TCR typing amplimer kit, Clontech). Functional transcripts were identified by sequencing and then analyzed using the ImMunoGeneTics information system (http://www.imgt.org).

[0116] TCR gene transfer. TCRα and β functional cDNA from the MAIT cell clone MRC25 were cloned into the XhoI/NotI sites of the BCMGSNeo expression vector (Karasuyama and Melchers Eur. J. Immunol. 1988 18:97-104) and the resulting constructs were used to co-transfect J.RT3-T3.5 cells by electroporation according to standard procedure. Transfectants expressing TRAV1-2 and CD3 were FACS sorted. The TCRα and β or TCRγ and δ functional cDNAs from MR1T clones were cloned into the XmaI/BamHI sites of a modified version of the plasmid 52962 (Addgene) expression vector. SKW-3 cells were transduced with virus particle-containing supernatant generated as described above. Cells were FACS sorted based on CD3 expression.

[0117] Fractionation of cell and whole tumour lysates. Total cell lysates were generated from a single pellet of 2.5×10.sup.9THP-1 cells via disruption in water with mild sonication. The sonicated material was then centrifuged (15,000 g for 15 min at 4° C.) and the supernatant collected (S1). Next, the pellet was re-suspended in methanol, sonicated, centrifuged as before, and the supernatant obtained was pooled with the S1 supernatant. The final concentration of methanol was 10%. The total cell extract was then loaded onto a C18 Sep-Pak cartridge (Waters Corporation) and the unbound material was collected and dried (fraction E-FT). Bound material was eluted in batch with 75% (fraction E1) and 100% methanol (fraction E2). The E-FT material was re-suspended in acetonitrile/water (9:1 vol/vol) and loaded onto a NH.sub.2 Sep-Pak cartridge (Waters Corporation). Unbound material (fraction N-FT) and 4 additional fractions were eluted with increasing quantities of water. Fraction N1 was eluted with 35% H.sub.2O, fraction N2 with 60% H.sub.2O, fraction N3 with 100% H.sub.2O, and fraction N4 with 100% H.sub.2O and 50 mM ammonium acetate (pH 7.0). All fractions were dried and then re-suspended in 20% methanol (fractions E1, E2 and N-FT) or 100% H.sub.2O (all other fractions) prior to being stored at −70° C.

[0118] Mouse EMT6 breast tumours were prepared as described (Zippelius et al., Cancer Immunol Res 3, 236-244 (2015)). Freshly excised tumours were extensively washed in saline, weighted and 4 g masses were homogenized in 7 ml of HPLC-grade water using a Dounce tissue grinder. Tumour homogenate underwent two freeze-thaw cycles, centrifuged (3,250 g) for 10 min at 4° C., and supernatant was collected and stored at −70° C. The pellet was extracted a second time with 2 ml of HPLC-grade water, centrifuged (5,100 g) for 10 min at 4° C. and the supernatant was collected and stored at −70° C. The pellet was further extracted with 9 ml of HPLC-grade methanol for 5 min at room temperature by vortexing, centrifuged (5,100 g) for 10 min at 4° C., and supernatant collected. The three supernatants were pooled, dried, and resuspended in water:methanol (10:1). Material was fractionated using C18 and NH.sub.2 Sep-Pak cartridges as above.

[0119] T cell activation assays. MR1-restricted T cells (5×10.sup.4/well unless otherwise indicated) were co-cultured with indicated target cells (5×10.sup.4/well) in 200 μl total volume in duplicates or triplicates. T cells were cultured with indicated APCs for 24 h. In some experiments, anti-MR1 mAbs (clone 26.5) or mouse IgG2a isotype control mAbs (both at 30 μg/ml) were added and incubated for 30 min prior to the addition of T cells. E. coli lysate was prepared from the DH5α strain (Invitrogen) grown in LB medium and collected during exponential growth. Bacterial cells were washed twice in PBS and then lysed by sonication. After centrifugation (15,000 g for 15 min), the supernatant was collected, dried, and stored at −70° C. APCs were pulsed for 4 h with E. coli lysate equivalent to 10.sup.8 CFU/ml (unless otherwise indicated) before addition of T cells. In some experiments, APCs were pre-incubated with 6-FP or Ac-6-FP (Schircks Laboratories) for 4 h before co-culture with T cells. In control experiments with TCR γδ cells expressing TCR Vγ9 and Vδ2 chains, the APCs were first treated for 6 h with zoledronate (10 μg/ml) prior to T cell addition. Activation experiments with plate-bound recombinant human β2m-MR1-Fc were performed by coating β2m-MR1-Fc onto 96 well plates (4 μg/ml) and loading with cartridge-purified cell lysates for 4 h at 37° C. before washing twice and adding T cells. Supernatants were collected after 24 h and IFN-γ or GM-CSF were assessed by ELISA. Multiple cytokines and chemokines in cell culture supernatants were analyzed using the Milliplex MAP human cytokine/chemokine magnetic bead panel—Premixed 41 plex (HCYTMAG-60K-PX41; Merck Millipore) according to the manufacturer's instructions. Samples were acquired on a Flexmap 3D system (Merck Millipore) and Milliplex analyst software was used to determine mean fluorescence intensity and analyte concentration.

[0120] Killing of tumour cells. Killing assays were performed using target cell lines (2×10.sup.4 cells/nil) incubated either alone or with T cells at different E/T ratios for 24 h, in the presence or absence of anti-MR1 mAb (30 μg/ml, clone 26.5). The target cells were stained with PE-Annexin V (BD) and propidium iodide (PI) (Sigma-Aldrich), as previously described (2). T cells were identified by staining with anti-CD3 mAbs and excluded from the analysis. Apoptosis was evaluated as follows: Annexin V.sup.+PI.sup.+=advanced apoptosis and Annexin V.sup.−PI.sup.+=necrosis. The percentage of apoptotic+necrotic cells in the absence of T cells (spontaneous apoptosis; no T cells) is also shown.

[0121] Statistics. Data were analyzed using Unpaired Student's t-test (Prism 6, GraphPad software).

Identification and Characterization of Novel Tumour-Reactive MR1-Restricted T Cells in Healthy Donors

[0122] The inventors detected an atypical MR1-restricted T cell clone that did not react to microbial ligands during earlier studies on the repertoire of human MAIT cells. This T cell clone (DGB129) recognized cell lines constitutively displaying surface MR1 (CCRF-SB lymphoblastic leukemia cells, or THP-1 monocytic leukemia cells; FIG. 1A) or transfected with the MR1 gene (A375 melanoma cells; A375-MR1; FIG. 1A) in the absence of any exogenously added antigens (FIG. 1B). Sterile recognition of MR1.sup.+ target cells was fully inhibited by blocking with anti-MR1 monoclonal antibodies (mAbs) (FIG. 1B), and thus resembled the MAIT cell response to E. coli-derived antigens assessed in parallel (FIG. 1C). Importantly, DGB129 T cells also failed to recognize the synthetic MAIT cell agonist 6,7-dimethyl-8-D-ribityllumazine (RL-6,7-diMe; FIG. 1D), differently from a control MAIT cell clone, which instead was stimulated in MR1-dependent manner by this compound (FIG. 1E). DGB129 cells did not express the canonical semi-invariant TCR typical of MAIT cells (Table 1).

[0123] The inventors asked whether the DGB129 clone was representative of a novel population of tumour-reactive MR1-restricted T cells different from microbe-reactive MAIT cells. They therefore established a method to isolate and study these unpredicted MR1-restricted T cells. Purified T cells from two healthy donors were labelled with the proliferation marker CellTrace violet (CTV) and stimulated with irradiated A375-MR1 cells in the absence of exogenous antigens. Proliferating cells were re-challenged with A375-MR1 cells and those expressing high levels of the activation marker CD137 were sorted and cloned by limiting dilution (FIG. 2A). Individual T cell clones were then interrogated for their capacity to recognize A375-MR1 and A375 cells lacking MR1 (A375-WT). In both donors the inventors found that a major fraction of T cell clones (126/195 and 37/57, respectively) displayed specific recognition of A375-MR1 cells (FIG. 2B,D), which was inhibited by anti-MR1 blocking mAbs (FIG. 2C,E). Staining with TCR Vβ-specific mAbs of 12 MR1-reactive T cell clones revealed that they expressed 7 different TRBV chains (TRBV4-3, 6-5/6-6/6-9, 9, 18, 25-1, 28, 29-1) with some of the clones sharing the same TRBV gene. Furthermore, none expressed the TRAV1-2 chain, canonical for MAIT cells.

[0124] Lack of specific markers did not allow univocal identification of these novel T cells ex vivo by standard flow cytometry. Therefore, their frequency was estimated by combining flow cytometry analysis after very short-time in vitro stimulation and single T cell cloning experiments. Purified blood T cells from five healthy donors were co-cultured overnight with MR1-deficient or MR1-sufficient A375 cells and analysed for the expression of the activation markers CD69 and CD137 (FIG. 3A). In all of the five donors screened, the percentage of CD69.sup.+CD137.sup.+ T cells detected was consistently higher after stimulation with A375-MR1 cells (range 0.034-0.072% of T cells) than after co-culture with A375-WT cells (range 0.015-0.032%) (FIG. 3A,B). As the two types of APCs differed for MR1 expression, MR1-reactive T cells accounted for the increased numbers of activated T cells after stimulation with MR1-positive APCs. Using this approach, the inventors estimated that the circulating T cell pool of the analysed individuals contained A375-MR1-reactive T cells at frequency ranging between 1:2,500 (0.072−0.032=0.04%) and 1:5,000 (0.034−0.015=0.019%). This estimated frequency is higher than the frequency of peptide-specific CD4.sup.+ T cells after antigen exposure (Lucas et al., J Virol 78:7284-7287; Su et al., Immunity 38:373-383). These observations were supported by parallel experiments in which sorted CD69.sup.+CD137.sup.+ overnight-activated T cells from one of these donors (Donor C, FIG. 3A, right panel) were cloned. Indeed, 31 out of 96 screened T cell clones (32%) displayed specific reactivity to A375-MR1 cells (FIG. 3C), which was inhibited by anti-MR1 mAbs (FIG. 3D). Accordingly, the calculated frequency of A375-MR1-responsive T cells among blood T cells of this donor was 1:5,000 (0.065×0.32=0.02%), a value consistent with the estimated range. Detailed analysis of representative T cell clones derived from three donors confirmed that they displayed diverse TCRα and β chains and indicated differential expression of CD4, CD8 and CD161 (Table 1).

[0125] Collectively, these findings suggested that the identified tumour-reactive MR1-restricted T cells are a novel yet common polyclonal population of lymphocytes in the blood of healthy human individuals (hereafter termed MR1T cells).

MR1T Cell TCR Gene Transfer Confers MR1-Restricted Recognition of Tumour Cells

[0126] The inventors next investigated whether MR1T cell reactivity to tumour cells was mediated by the TCR. Expression of paired TCRα and β genes cloned from different MR1T cell clones in the TCR-deficient SKW-3 cells, conferred MR1 recognition of tumour cells which was comparable to that displayed by the original MR1T cells and which was completely blocked by anti-MR1-mAbs (FIG. 4A-C). In control experiments, transfer of TCRα and β genes of a representative MAIT cell clone conferred the ability to recognize A375-MR1 cells in MR1-dependent manner only in the presence of E. coli antigens (FIG. 4D). These data highlighted the critical role of the TCR in mediating MR1T cell recognition of tumour cells and suggested that MR1T cell TCR gene transfer can effectively redirect the reactivity of selected T cells toward MR1-expressing tumour cells.

Differential Recognition of Tumour Cells by MR1T Cell Clones

[0127] Having generated a large panel of MR1T cell clones reacting to MR1-expressing A375 melanoma cells, the inventors next investigated whether they could also recognize other types of tumour cells constitutively expressing surface MR1, including THP-1 myelomonocytic cells, Huh7 hepatoma cells, HCT116 colon carcinoma cells and LS 174T goblet-like colon adenocarcinoma cells. All these cell types supported MAIT cell activation in the presence of microbial antigens and in an MR1-dependent manner (FIG. 5A). The same cells were able to induce sterile activation of select MR1T cell clones to various extents. THP-1 cells were recognized by the majority of the tested MR1T cell clones, followed by the Huh7 hepatoma cells, the LS 174T goblet-like cells and the HCT116 colon carcinoma cells (FIG. 5B). Importantly, all responses were blocked by anti-MR1 mAbs.

[0128] These data further confirmed that MR1T cells are a novel and heterogeneous population of tumour-reactive T cells restricted to the non-polymorphic antigen-presenting molecule MR1.

MR1T Cells Recognize MR1-Bound Antigens Present in Tumour Cells

[0129] The inventors next studied the basis of MR1T cell reactivity to tumour cells. First, they sought to definitively rule out the possibility that MR1T cell clones could recognize microbial antigens, in analogy to MAIT cells. While a control MAIT cell clone reacted to A375-MR1 cells only in the presence of E. coli lysate, activation of different MR1T cell clones was not enhanced by the E. coli lysate (FIG. 6A). Consistent with these data, MR1-negative A375-WT cells failed to stimulate either type of T cells, irrespective of whether E. coli lysate was added, (FIG. 6A) and importantly anti-MR1 mAbs efficiently blocked both MR1T and MAIT cell responses (FIG. 6A). These findings confirmed that microbial ligands present in E. coli and stimulating MAIT cells do not stimulate the tested MR1T cells.

[0130] The inventors then tested the response of MR1T cells to the known MR1 ligands 6-FP and Ac-6-FP, which have previously been reported to stimulate a rare subset of TRAV1-2-negative T cells and inhibit MAIT cell activation by microbial antigens. MR1T cell stimulation was impaired in the presence of 6-FP or Ac-6-FP ligands, which also impaired E. coli stimulation of control MAIT cells, but did not disrupt control TCR γδ cell responses to cognate antigen presented by the same APCs, thus excluding compound toxicity (FIG. 6B,C and 7A-C). Notably, 6-FP or Ac-6-FP failed to inhibit the activation of MR1T cells or MAIT cells when the target A375 cells were transduced to express mutant MR1 molecules with defective ligand binding capacity (blockade of Schiff base formation with ligands by mutation of Lysine 43 into Alanine, A375-MR1 K34A; FIG. 6B,C and 7D,E). The specific inhibition observed with 6-FP or Ac-6-FP indicated that MR1T cells i) do not recognize 6-FP and Ac-6-FP, ii) react to MR1-bound cellular antigens, and iii) are stimulated by ligands that do not require the formation of a Schiff base with MR1.

[0131] To gain further information on the origin of the recognized antigens the inventors asked whether the stimulatory capacity of tumour target cells was dependent on culture medium constituents, as some MR1 ligands, e.g. 6-FP, may derive from folate present in RPMI 1640 medium used for cell culture. Both THP-1 and A375-MR1 cells were extensively washed and cultivated 4 days in phosphate buffered saline solution (PBS) supplemented exclusively with 5% human serum. Cells were washed daily before being used to stimulate DGB129 MR1T cells and the T cell activation assays were performed in PBS. THP-1 and A375-MR1 cells grown in RPMI 1640 or in PBS showed the same stimulatory capacity (FIG. 8A,B), thus indicating that medium constituents are not responsible for MR1T cell activation. To directly investigate whether the stimulatory antigens were present in target tumour cells, the inventors then performed T cell activation assays using as source of antigen two types of tumour lysates. The first lysate was obtained from in vitro cultured THP-1 cells, while the second one was prepared from mouse breast tumours immediately after resection. Two hydrophobic and four hydrophilic fractions were obtained and tested using as APCs THP-1 cells that constitutively express low levels of MR1. The DGB129 clone reacted only to fraction N4, containing highly hydrophilic compounds isolated from both freshly explanted mouse tumour and in vitro cultured THP-1 cells (FIG. 8C,D). These results ruled out the possibility that stimulatory antigens were derived from RPMI 1640 components and indicated their cellular origin. The inventors also tested the fractions generated from THP-1 lysates with DGB70, another representative MR1T cell clone. DGB70 cells recognized fraction N3 and not N4, (FIG. 8E), suggesting that at least two distinct compounds differentially stimulated the two MR1T clones. The same fractions were also loaded onto plastic-bound MR1 molecules and showed alternative and specific stimulatory capacity, i.e. N3 stimulated only DGB70 cells, while N4 stimulated only DGB129 cells (FIG. 8F). In the absence of N3 and N4 fractions, the two clones did not react to MR1, further indicating the requirement of specific antigens.

[0132] In conclusion, these data indicated that MR1T cells recognize MR1 complexed with ligands not derived from culture medium and present also in tumour cells grown in vivo.

MR1T Cells Display Differential Anti-Tumour Responses

[0133] To assess the anti-tumour activity of MR1T cells the inventors tested their capacity to directly kill tumour cells in vitro. Two representative MR1T cell clones (DGB129 and DGB70) efficiently killed both MR1-expressing THP-1 and A375 cells at various effector:target ratios (FIG. 9A,B). A control MAIT cell clone failed to kill these two cell types, although it was fully capable of killing when targets were E. coli-infected (not shown). These results indicated that MR1T cells display specific cytotoxic activity against MR1-expressing tumour cells.

[0134] Having found that MR1 T cells recognized and killed the myelomonocytic tumour cell line THP-1, the inventors next addressed whether they could also recognize normal myeloid cells including monocytes and monocyte-derived dendritic cells (Mo-DC) from different donors. Monocytes were not recognized by any of the tested MR1T cell clones (not shown). By contrast, some MR1T cell clones reacted to Mo-DC in MR1 dependent manner (FIG. 9C). Interestingly, experiments performed with the representative DGB129 MR1T cell clone revealed that recognition of Mo-DC did not result in Mo-DC killing (not shown), but promoted up-regulation of CD83 and CD86 activation markers by Mo-DC (FIG. 9D). Remarkably, the activation of Mo-DC induced by DGB129 cells was fully inhibited by anti-MR1 mAbs (FIG. 9D). These data suggested that some tumour-reactive MR1T cells elicit direct anti-tumour activity and also promote activation of innate immune cells, with important implications in the establishment of effective anti-tumour immune responses.

[0135] As the inventors observed that some MR1T cell clones reacted to HCT116 and LS 174T intestinal tumour cells, they next investigated whether they could also recognize normal gut epithelial cells (GEC) prepared from gut biopsies. GEC cells were not stimulatory for any of the tested HCT116- or LS 174T-reactive MR1T cell clones (FIG. 9F,G), thus suggesting that MR1T cell clones may display specific recognition of gastrointestinal tumour cells while not reacting to normal intestinal epithelial cells.

[0136] To further assess the specificity of tumour recognition by MR1T cells, the inventors finally investigated whether they could react to other types of normal cells including neutrophils, NK cells, B cells and T cells. None of these cells were recognized by the tested MR1T cells (not shown).

[0137] Collectively, these data identify MR1T cells as a novel and heterogeneous population of human MR1-restricted T lymphocytes that i) differently react to various types of tumour cells, ii) display cytotoxic activity against tumour cells, iii) do not recognize normal cells with exception of in vitro-differentiated Mo-DC, and iv) do not kill Mo-DC but instead induce their activation. These findings suggested that MR1T cells display important anti-tumour properties and deserve to be exploited for their immunotherapeutic potential.

MR1T Cells are Functionally Heterogeneous

[0138] The inventors finally analyzed the cytokine secretion profile of representative MR1T cell clones upon stimulation by A375-MR1 tumour cells. All clones tested released IFN-γ (FIG. 10A). However, the inventors also observed diverse expression profiles of Th1 (IL-2, TNF-α and TNF-β), Th2 (IL-3, IL-4, IL-5, IL-6, IL-10, IL-13) and Th17 cytokines (IL-17A, G-CSF, GM-CSF), and other soluble factors (MIP-1β, soluble CD40L PDGF-AA and VEGF; FIG. 10B). The variable combinations and quantities of cytokines expressed by MR1T cells suggested considerable functional plasticity within this population. For example, clone DGA4 secreted large quantities of IL-17A, IL-6, TNF-α and GM-CSF, but failed to secrete the prototypic Th2 cytokines IL-4, IL-5, IL-10 or IL-13, and thus displayed an ‘atypical’ Th17-like phenotype. In contrast, clone TC5A87 released substantial amounts of VEGF and PGDF-AA, but only little Th1 or Th2 cytokines, and no IL-17A. Notably, four of the seven clones studied (DGB129, CH9A3, DGB70, JMA) displayed a Th2-skewed profile of cytokine release, a functional phenotype which has been recently associated with protective anti-tumour immunity.

[0139] The inventors next investigated the expression of three selected chemokine receptors known to be differentially expressed by T cell subsets with distinct functions and whose alternative combined expression regulates T cell recirculation and migration to diverse homing sites. All MR1T cell clones but DGA4 displayed high levels of CXCR3 (FIG. 11). In addition, the inventors observed divergent expression patterns of CCR4 and CCR6 (FIG. 11), which further suggested that MR1T cells are heterogeneous.

[0140] In a final series of studies it was investigated whether MR1T cells maintain their tumour-killing capacity in vivo using a lung solid tumour model. Mice intravenously injected with A375 melanoma cells expressing MR1 received DGB129 cells or were left untreated. On day 14, mice were sacrificed and the number of tumour nodules in the lungs was counted. While untreated mice showed 200-250 nodules, those treated with MR1T cells showed 1-6 nodules (FIG. 12). These results confirmed that in vivo growing tumour cells produce the antigens stimulating MR1T cells. Importantly, they provided strong evidence of the efficient capacity of MR1T cells to kill solid tumour cells in vivo.

[0141] Taken together, these data indicated that the tumour MR1-reactive T clones tested here are phenotypically and functionally diverse, thus suggesting that MR1T cells include multiple subsets with distinct recirculation patterns and tissue homing capacity and likely different roles in tumour immunity. In conclusion, these data identify MR1T cells as a novel population of human T lymphocytes that recognize MR1:tumour-associated-antigen complexes and may participate in anti-tumour immune responses with multiple effector functions.

TABLE-US-00001 TABLE 1 Phenotype of select MR1-reactive T cell clones. Clone CD4 CD8α CD161 TCRβ DGB129 − + − TRBV12-4 DGB70 − − − TRBV28 DGA28 − + + TRBV29-1 DGA4 − − + TRBV6-1 JMA − + − TRBV25-1 TC5A87 − + − TRBV25-1 CH9A3 − + − TRBV5-5

TABLE-US-00002 TABLE 2 Tumour cell lines recognized by human MR1T cells. Cell line Origin A375 Human melanoma CCRF-SB Human B lymphoblastic leukemia Huh7 Human hepatocellular carcinoma HCT116 Human colon carcinoma LS 174T Human colon adenocarcinoma THP-1 Human myelomonocytic leukemia
The following examples further illustrate the clinical workflow in which the invention is applied:

Screening of MR1-Expressing Cancers

[0142] A cancer patient's tissue fresh or fresh-frozen tissue biopsies are analyzed for MR1 expression using mAbs specific for human MR1 and PCR amplification of MR1 mRNA.

Cancer Therapy, Example 1: Selection of Best MRT1 TCR Genes for Recognition of Primary MR1-Expressing Cancer Cells

[0143] I. Primary MR1.sup.+ cancer cells isolated ex vivo are used to stimulate a library of previously characterized MR1T cell clones. Each clone expresses different TCR genes and recognizes different types of cancer cells. [0144] II. The MR1T cells clones best responding to the cancer cells of the patient are selected and their TCR genes are used for TCR gene therapy. Response is assayed as a function of cytokine release and/or surface marker expression. Cells are assayed by internal (cytokine) or surface marker staining with antibodies reactive to the assayed activation markers, exemplified but not restricted to CD3, CD69, CD137, CD150, and/or ICOS (surface markers) and INF-γ and GM-CSF (cytokine). [0145] III. When available soluble MR1T TCR will be multimerized and used to stain tumor cells isolated from tumour biopsies. The MR1T TCR multimers binding to tumour cells will allow rapid selection of MR1T TCRs suitable for gene therapy in that patient. [0146] IV. Several circulating patient T cell populations may be used as recipient T cells (naïve, central memory, effector memory, CD4.sup.+, CD8.sup.+, or CD4, CD8 double negative T cells). Naïve T cells are selected to allow unprimed T lymphocytes to mature in the presence of tumor cells when they are transduced with TCR genes recognizing MR1-tumor antigens. Central and effector memory cells are used because they provide immediate proliferation and effector functions (tumor killing) upon recognition of tumor cells expressing MR1. CD4 cells are selected to provide sufficient numbers of T helper cells that facilitate recruitment and expansion of other cells with anti-tumor functions. CD8 T cells are selected to facilitate killing of tumor cells. CD4-CD8 double negative T cells are selected for their innate-like functions such as immediate release of large amounts of killer effector molecules (TNFα, granzymes and granulysin). [0147] V. T cells expressing the transduced TCR genes and with selected effector functions are used for adoptive cell therapy (ACT).

[0148] T cells from peripheral blood of patients are stained with monoclonal antibodies specific for surface markers (CD4, CD8, CD27, CD45RA, CD57) and sorted. Each sorted population is activated with Dynabeads® Human T-Activator CD3/CD28 (ThermoFisher) and 24 h later transfected with the TCR genes encoding the MR1T TCR selected for the individual patient. This yields a modified T cell preparation (recipient T cells). In some cases, recipient T cells are also modified by gene-editing methods to inactivate PD1, ILT2 and ILT4 inhibitory genes or were transduced with CD137 and CD134 genes to promote cell survival, cell expansion and to enhance anti-cancer effector function.

[0149] Lymphodepletion is made in recipient cancer patients using a non-myeloablative chemotherapy preparative regimen (60 mg/kg cyclophosphamide for 2 days and 25 mg/m.sup.2 fludarabine administered for 5 days) followed by transfer of T cells and IL-2 given at 720,000 IU/kg to tolerance. In some instances, 200 or 1200 centigray (cGy; 1 Gy=100 rads) total-body irradiation is added to the preparative regimen. T cells expressing the MR1T exogenous TCR genes (the modified T cell preparation) are transferred into recipient.

[0150] TCR genes are cloned in safe recombinant lentivirus vectors (see for example Provasi et al., Nat Med 18, 807-815 (2012)), which contain suicide genes and cannot produce mature viral particles in the absence of other helper viruses. In some cases, TCR genes are cloned in vectors containing suicide genes (for examples, see Greco et al., Front Pharmacol 6, 95 (2015)), thus reducing the risks derived from unwanted gene insertion. In some cases RNA encoding the TCR MR1T genes is transfected in recipient cells (see for example Zhao et al. Molecular therapy 13, 151, 2006)).

Cancer Therapy, Example 2: Isolation of MR1T Cells from Tumor-Infiltrating Lymphocytes (TILs) of Patient to be Treated

[0151] VI. Autologous TILs are prepared from the cancer tissue biopsies according to our previously established protocol (De Libero, ibid.).
VII. T cells are expanded in vitro for 2-3 weeks using medium supplemented with IL-2, IL-7, and IL-15.
VIII. Expanded T cells are tested for reactivity against autologous MR1.sup.+ cancer cells. T cells that increase surface expression of activation markers (CD137, CD150, CD69, ICOS) are considered cancer-specific and if they are inhibited by the presence of anti-MR1 monoclonal antibodies, they are considered MR1-dependent.
Cancer-reactive T cells are sorted according to the expression of one of above activation markers and expanded and used for ACT, as outlined above.

Sequences

[0152] In the event that there is a discrepancy between the sequence contained in the below specification pages, and the sequence protocol submitted in parallel as text file, the below sequences in this specification shall prevail.

Full-Length TCR α and β Protein Sequences including Leader Sequences

[0153] CDR3 sequences are shown underlined

TABLE-US-00003 TCR alpha new clone 1 SEQ ID 001 MAMLLGASVLILWLQPDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCD YTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLS LHIVPSQPGDSAVYFCAAQIYNQGGKLIFGQGTELSVKPNIQNPDPAVYQ LRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNS AVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLN FQNLSVIGFRILLLKVAGFNLLMTLRLWSS TCR alpha new clone 2 SEQ ID 003 MISLRVLLVILWLQLSWVWSQRKEVEQDPGPFNVPEGATVAFNCTYSNSA SQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSK LSDSATYLCVVTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSV CLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFA CANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRI LLLKVAGFNLLMTLRLWSS TCR alpha new clone 3 SEQ ID 005 MLTASLLRAVIASICVVSSMAQKVTQAQTEISVVEKEDVTLDCVYETRDT TYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTIT ASQVVDSAVYFCALSEEPSNTGKLIFGQGTTLQVKPDIQNPDPAVYQLRD SKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVA WSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQN LSVIGFRILLLKVAGFNLLMTLRLWSS TCR beta new clone 1 SEQ ID 002 MGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHEN MFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESA STNQTSMYLCASSFSSGKQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAE ISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALN DSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQI VSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMA MVKRKDSRG TCR beta new clone 2 SEQ ID 004 MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDR MYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESA IPNQTALYFCATSDVGTGDTGELFFGEGSRLTVLEDLKNVFPPEVAVFEP SEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQ PALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKP VTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSAL VLMAMVKRKDSRG TCR beta new clone 3 SEQ ID 006 MGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHEN MFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESA STNQTSMYLCASSRLLAGGQNEQFFGPGTRLTVLEDLKNVFPPEVAVFEP SEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQ PALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKP VTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSAL VLMAMVKRKDSRG

Full-Length TCR α and β Protein Sequences including Leader Sequences

[0154]

TABLE-US-00004 TCR alpha clone 4 SEQ ID NO 013 MWGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVL DGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSSYKLIFGSGTRLLVRPDIQNPDPAVY QLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFN NSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS TCR alpha clone 5 SEQ ID NO 014 MLLITSMLVLWMQLSQVNGQQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLV KSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAAAGGTSYGKLTFGQGTILTVHPNIQNPD PAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACA NAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS TCR alpha clone 6 SEQ ID NO 015 MKTFAGFSFLFLWLQLDCMSRGEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLT YIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAETWTDRGSTLGRLYFGRGTQLTVWP DIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNK SDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTL RLWSS TCR alpha clone 7 SEQ ID NO 016 MAMLLGASVLILWLQTDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAE GPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASLYNQGGKLIFGQGTELS VKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAW SNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLL MTLRLWSS TCR alpha clone 8 SEQ ID NO 017 MEKNPLAAPLLILWFHLDCVSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEA LFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCASGDSGYALNFGKGTSLLVTPHIQ NPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDF ACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLW SS TCR alpha clone 9 SEQ ID NO 018 MNYSPGLVSLILLLLGRTRGNSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLK ATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALTIWDYGGSQGNLIFGKGTKLSVKPN IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKS DFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLR LWSS TCR alpha clone 10 SEQ ID NO 019 MVLKFSVSILWIQLAWVSTQLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVV TGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGENSGYALNFGKGTSLLVTPHIQNPDPA VYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANA FNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS TCR alpha clone 11 SEQ ID NO 020 MMKSLRVLLVILWLQLSWVWSQQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPEL LMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSLSGGSYIPTFGRGTSLIVHPYI QNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSD FACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRL WSS TCR alpha clone 12 SEQ ID NO 021 MLLEHLLIILWMQLTWVSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALY KAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQLGGAGGTSYGKLTFGQGTILTVHPNI QNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSD FACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRL WSS TCR alpha clone 13 SEQ ID NO 022 MTSIRAVFIFLWLQLDLVNGENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIID IRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAANWSPQGNEKLTFGTGTRLTIIPNIQ NPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDF ACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLW SS TCR alpha clone 14 SEQ ID NO 023 MWGVFLLYVSMKMGGTTGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVL DGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCASMDSNYQLIWGAGTKLIIKPDIQNPDPAVY QLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFN NSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS TCR alpha clone 15 SEQ ID NO 024 MISLRVLLVILWLQLSWVWSQRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLL MSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVNRFTRDGNKLVFGAGTILRVKSYIQ NPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDF ACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLW SS TCR beta clone 4 SEQ ID NO 025 MSIGLLCCVAFSLLWASPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYS ASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSEVTGGYNEQFFGPGTRLTVLEDL KNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND SRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQ QGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG TCR beta clone 5 SEQ ID NO 026 MLSLLLLLLGLGSVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGS EATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVGAGQGPYTDTQYFGPGTRLTVLEDLK NVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDS RYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQ GVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG TCR beta clone 6 SEQ ID NO 027 MGIRLLCRVAFCFLAVGLVDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFS YDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSLGATGANEKLFFGSGTQLSVLED LNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALN DSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSY QQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF TCR beta clone 7 SEQ ID NO 028 MGSWTLCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYF NNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSYRGTEAFFGQGTRLTVVEDLNK VFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSR YCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQG VLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF TCR beta clone 8 SEQ ID NO 029 MGPGLLCWVLLCLLGAGPVDAGVTQSPTHLIKTRGQHVTLRCSPISGHKSVSWYQQVLGQGPQFIFQY YEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSFDVGLPPLHFGNGTRLTVTEDLN KVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDS RYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQ GVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF TCR beta clone 9 SEQ ID NO 030 MGPGLLHWMALCLLGTGHGDAMVIQNPRYQVTQFGKPVTLSCSQTLNHNVMYWYQQKSSQAPKLLFHY YDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSREWETQYFGPGTRLLVLEDLKNV FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRY CLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGV LSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG TCR beta clone 10 SEQ ID NO 031 MTIRLLCYMGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYS YGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSQLYRDTSNTGELFFGEGSRLTVL EDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPA LNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSE SYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG TCR beta clone 11 SEQ ID NO 032 MSIGLLCCAALSLLWAGPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYS VGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASGISGTASSYNSPLHFGNGTRLTVT EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPA LNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSV SYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF TCR beta clone 12 SEQ ID NO 033 MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQY YNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSVGGGLADTQYFGPGTRLTVLEDL KNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND SRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQ QGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG TCR beta clone 13 SEQ ID NO 034 MTIRLLCYMGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYS YGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSEYIQYSGNTIYFGEGSWLTVVED LNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALN DSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSY QQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF TCR beta clone 14 SEQ ID NO 035 MLLLLLLLGPGSGLGAVVSQHPSWVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGS KATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAKVTSGQHQGTTDTQYFGPGTRLTVLE DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPAL NDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSES YQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG TCR beta clone 15 SEQ ID NO 036 MLSLLLLLLGLGSVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGS EATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVEGRGYEQYFGPGTRLTVTEDLKNVFP PEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCL SSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLS ATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG

Full-Length TCR γ and δ Protein Sequences including Leader Sequences

[0155]

TABLE-US-00005 TCR gamma clone 1 SEQ ID NO 061 MQWALAVLLAFLSPASQKSSNLEGRTKSVIRQTGSSAEITCDLAEGSTG YIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRM ILRNLIENDSGVYYCATWETQELGKKIKVFGPGTKLIITDKQLDADVSP KPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQE GNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPI KTDVITMDPKDNCSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIIT CCLLRRTAFCCNGEKS TCR delta clone 1 SEQ ID NO 062 MLFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKAVTLNCLYETSW WSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAVKSVALTI SALQLEDSAKYFCALGVQALLPILGDTTDKLIFGKGTRVTVEPRSQPHT KPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGK YNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENT KQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFF L

TABLE-US-00006 TABLE X designation of sequence ID NOs Protein Nucleic acid Clone α β α CDR3 β CDR3 α β 1 1 2 65 80 7 8 2 3 4 66 81 9 10 3 5 6 67 82 11 12 4 13 25 68 83 37 49 5 14 26 69 84 38 50 6 15 27 70 85 39 51 7 16 28 71 86 40 52 8 17 29 72 87 41 53 9 18 30 73 88 42 54 10 19 31 74 89 43 55 11 20 32 75 90 44 56 12 21 33 76 91 45 57 13 22 34 77 92 46 58 14 23 35 78 93 47 59 15 24 36 79 94 48 60 Clone γ δ γCDR3 δ CDR3 γ δ (1) 61 62 95 96 63 64