CHIMERIC ANTIGEN RECEPTOR COMPOSITIONS AND METHODS FOR TREATING MUC1* DISEASES
20240424025 ยท 2024-12-26
Inventors
Cpc classification
A61K39/4611
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
Abstract
Disclosed herein are chimeric antigen receptors (CARs) that target MUC1*. In some embodiments, the CARs have been optimized to reduce T cell exhaustion.
Claims
1. An immune cell from an individual with a MUC1* positive cancer that expresses a chimeric antigen receptor comprising: (a) a MUC1* binding single chain antibody domain comprising: (i) heavy chain (HC) complementarity determining regions (CDRs) comprising: a HC-CDR1 comprising SEQ ID NO: 18, a HC-CDR2 comprising SEQ ID NO: 19, and a HC-CDR3 comprising SEQ ID NO: 20; and (ii) light chain (LC) CDRs comprising: a LC-CDR1 comprising SEQ ID NO: 21, a LC-CDR2 comprising SEQ ID NO: 22, and a LC-CDR3 comprising SEQ ID NO: 23; (b) a hinge region comprising SEQ ID NO: 40; (c) a transmembrane domain comprising SEQ ID NO: 41; and (d) a signaling domain comprising SEQ ID NO: 44.
2. The immune cell of claim 1, wherein the immune cell is a T-cell.
3. The immune cell of claim 1, wherein the immune cell is a natural killer cell.
4. A pharmaceutical composition comprising the immune cell of claim 1 and a saline solution.
5. The pharmaceutical composition of claim 4, further comprising an infusible cryopreservation solution.
6. The pharmaceutical composition of claim 5, wherein the infusible cryopreservation solution comprises one or more of sodium, potassium, magnesium, chloride, acetate, or gluconate.
7. The pharmaceutical composition of claim 5, wherein the infusible cryopreservation solution comprises 140 mEq sodium, 5 mEq potassium, 3 mEq magnesium, 98 mEq chloride, 27 mEq acetate, and 23 mEq gluconate.
8. The pharmaceutical composition of claim 5, wherein the infusible cryopreservation solution comprises human serum albumin (HSA) at a concentration range of 2% to 5%.
9. The pharmaceutical composition of claim 5, wherein the infusible cryopreservation solution has a pH from 7.0 to 7.5.
10. The pharmaceutical composition of claim 5, wherein the infusible cryopreservation solution comprises dimethyl sulfoxide (DMSO).
11. The pharmaceutical composition of claim 5, wherein the infusible cryopreservation solution comprises 2% to 5% (w/v) dimethyl sulfoxide (DMSO).
12. A method of treating cancer comprising administering the pharmaceutical composition of claim 4 to an individual with a MUC1* positive cancer of claim 1.
13. The method of claim 12, wherein the MUC1* positive cancer is MMP9 positive.
14. The method of claim 12, wherein the MUC1* positive cancer is breast cancer, colon cancer, prostate cancer, pancreatic cancer, or lung cancer.
15. The method of claim 14, wherein the MUC1* positive breast cancer is triple negative breast cancer.
16. The method of claim 12, wherein the method further comprises administration of a second anti-cancer agent.
17. The method of claim 16, wherein the second anti-cancer agent comprises a cytotoxic agent.
18. The method of claim 17, wherein the cytotoxic agent comprises a platinum-based agent or a taxane.
19. The method of claim 18, wherein the platinum-based agent is carboplatin or cisplatin.
20. The method of claim 18, wherein the taxane is paclitaxel or docetaxel.
21. A method of treating an early MUC1* positive cancer in a subject comprising administering to the subject an immune cell that expresses a chimeric antigen receptor comprising: (a) a MUC1* binding single chain antibody domain comprising: (i) heavy chain (HC) complementarity determining regions (CDRs) comprising: a HC-CDR1 comprising SEQ ID NO: 18, a HC-CDR2 comprising SEQ ID NO: 19, and a HC-CDR3 comprising SEQ ID NO: 20; and (ii) light chain (LC) CDRs comprising: a LC-CDR1 comprising SEQ ID NO: 21, a LC-CDR2 comprising SEQ ID NO: 22, and a LC-CDR3 comprising SEQ ID NO: 23; (b) a hinge region comprising SEQ ID NO: 40; (c) a transmembrane domain comprising SEQ ID NO: 41; and (d) a signaling domain comprising SEQ ID NO: 44.
22. A method of treating a recurrent MUC1* positive cancer in a subject comprising administering to the subject an immune cell that expresses a chimeric antigen receptor comprising: (a) a MUC1* binding single chain antibody domain comprising: (i) heavy chain (HC) complementarity determining regions (CDRs) comprising: a HC-CDR1 comprising SEQ ID NO: 18, a HC-CDR2 comprising SEQ ID NO: 19, and a HC-CDR3 comprising SEQ ID NO: 20; and (ii) light chain (LC) CDRs comprising: a LC-CDR1 comprising SEQ ID NO: 21, a LC-CDR2 comprising SEQ ID NO: 22, and a LC-CDR3 comprising SEQ ID NO: 23; (b) a hinge region comprising SEQ ID NO: 40; (c) a transmembrane domain comprising SEQ ID NO: 41; and (d) a signaling domain comprising SEQ ID NO: 44.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0007] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0008] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
DETAILED DESCRIPTION OF THE INVENTION
[0019] Chimeric antigen receptors (CARs) are molecules that include a targeting domain specific for a cell surface antigen, a transmembrane domain, and a T cell signaling moiety. When expressed on the surface of an immune cell, such as a T cell, the CARs mediate binding to a target cell and activate the T cells, ultimately inducing the target cell lysis. CARs are a promising approach to treat hematological malignancies, including non-Hodgkin lymphoma, B-cell acute lymphoblastic leukemia, and multiple myeloma. However, T cell exhaustion remains a challenge in CAR-T therapies and there remains a need for effective immunotherapies to treat solid tumors as well as hematological malignancies.
MUC1*
[0020] MUC1* is an ideal target for cancer drugs as it is aberrantly expressed on over 75% of all solid tumor cancers and is likely overexpressed on an even higher percentage of metastatic cancers.
[0021] MUC1* is a variant form of the mucin MUC1 that is found on over 75% of solid tumors. On normal tissues, MUC1 is expressed on the apical surface of polarized cells as a Type I membrane protein with an extracellular N-terminus having hundreds of highly o-glycosylated tandem repeats followed by a self-aggregation domain, a transmembrane domain, and a cytoplasmic tail. MUC1* is a MUC1 cleavage product with a truncated extracellular domain that functions as a growth factor receptor. Metalloproteinase cleavage of MUC1 clips off the tandem repeat and self-aggregation domains, leaving behind a newly accessible ligand-binding domain of about 45 amino acids. MUC1* activation by growth factor ligands that dimerize MUC1* such as NME7 promotes the growth and metastasis of cancer cells by inducing MAP kinase phosphorylation and other intracellular growth signals. Proteolytic elimination of the self-aggregation domain permits MUC1* to redistribute over the entire cell surface.
[0022] Full-length MUC1 runs on SDS-polyacrylamide gels with a molecular weight of about 150-350 kDa, depending on the number of tandem repeats and glycans, and can be detected with the commercially available VU4H5 and HMPV antibodies. MUC1* has a calculated molecular weight of 16-18 kDa, depending on cleavage site, and runs at about 25 kDa on SDS-polyacrylamide gels. The C2 antibody binds to a conformational epitope of MUC1* that is not accessible on the full-length MUC1 protein found on normal tissues.
[0023] After MUC1 is cleaved to MUC1*, release of the bulk of the extracellular domain of MUC1 unmasks a binding site for ligands such as NME1, NME6, NME7, NME7AB, NME7-X1 or NME8. Ligands that dimerize MUC1* activate downstream signaling by MUC1*, which can induce growth and/or metastasis in cancer cells.
Chimeric Antigen Receptor Compositions
[0024] Disclosed herein are CAR compositions that target MUC1*. In some embodiments, the CAR constructs that target MUC1*, have been optimized to reduce T cell exhaustion relative to a control CAR composition that targets MUC1*. In some embodiments, the control CAR comprises the amino acid sequence according to SEQ ID NO: 47. In some embodiments, the CAR comprises a mutated CD3 zeta signaling domain sequence. In some embodiments, the mutated CD3 zeta signaling domain contains a point mutation of a tyrosine to a phenylalanine in at least one ITAM motif, at least two ITAM motifs, or at least three ITAM motifs. In some embodiments, the mutated CD3 zeta signaling domain contains a point mutation of tyrosine to a phenylalanine in the second, and third ITAM motif, whereas the first ITAM motif is not mutated.
[0025] Disclosed herein are chimeric antigen receptors (CARs) that comprise an amino acid sequence that comprises in an N-terminal to C-terminal order: (a) a first region comprising a signal sequence; (b) a second region comprising: i) a heavy chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 1, a linker, and a light chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 2, or (ii) a light chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 2, a linker, and a heavy chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 1; (c) a third region comprising a hinge sequence and a transmembrane domain sequence that comprises an amino acid sequence that has at least 85% identity to SEQ ID NO: 3; and (d) a fourth region comprising a costimulatory domain sequence and a signaling domain sequence wherein the fourth region comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 4. In some embodiments the signal sequence is cleaved off from the CAR during its biosynthesis to yield a mature CAR polypeptide.
TABLE-US-00001 TABLE1 ChimericAntigenReceptorSequences Region SEQ of ID CAR Description Sequence NO: Second C2heavychain EVQLVESGGGLVKPGGSLRL 1 Region variabledomain SCAASGFTFSGYAMSWVRQA PGKGLEWVSTISSGGTYIYY PDSVKGRFTISRDNAKNSLY LQMNSLRAEDTAVYYCARLG GDNYYEYFDVWGKGTTVTVS S Second C2lightchain DIVLTQSPASLAVSPGQRAT 2 Region variabledomain ITCRASKSVSTSGYSYMHWY QQKPGQPPKLLIYLASNLES GVPARFSGSGSGTDFTLTIN PVEANDTANYYCQHSRELPF TFGGGTKVEIKRT Third Hingeand KHLCPSPLFPGPSKPFWVLV 3 Region Transmembrane VVGGVLACYSLLVTVAFIIF WV Fourth Costimulatory RSKRSRLLHSDYMNMTPRRP 4 Region domainsequence GPTRKHYQPYAPPRDFAAYR andsignaling SRVKFSRSADAPAYKQGQNQ domainsequence LYNELNLGRREEYDVLDKRR GRDPEMGGKPRRKNPQEGLF NELQKDKMAEAFSEIGMKGE RRRGKGHDGLFQGLSTATKD TFDALHMQALPPR
First Region
[0026] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to any one of SEQ ID NOs: 5, 7, 9, 11, 13, 15, or 17. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to any one of SEQ ID NOs: 5, 7, 9, 11, 13, 15, or 17. In some embodiments, the signal sequence comprises the amino acid sequence according to any one of SEQ ID NOs: 5, 7, 9, 11, 13, 15, or 17.
[0027] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 5. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 5. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 5.
[0028] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 7. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 7. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 7.
[0029] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 9. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 9. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 9.
[0030] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 11. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 11. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 11.
[0031] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 13. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 13. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 13.
[0032] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 15. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 15. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 15.
[0033] In some embodiments, the signal sequence comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 17. In some embodiments, the signal sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 17. In some embodiments, the signal sequence comprises the amino acid sequence according to SEQ ID NO: 17.
TABLE-US-00002 TABLE2 SignalSequences Region SEQ of ID CAR Description Sequence NO: First CD8 MALPVTALLLPLALLLHAAR 5 P First HumanIL2 atgtacaggatgcagctgct 6 DNA gagctgcatcgccctgagcc tggccctggtgaccaacagc First HumanIL2 MYRMQLLSCIALSLALVTNS 7 aa First Granulocyte- atgtggctgcagagcctgct 8 macrophage gctgctgggcaccgtggcct colony- gcagcatcagc stimulating factor(GM- CSF)chain DNA First Granulocyte- MWLQSLLLLGTVACSIS 9 macrophage colony- stimulating factor(GM- CSF)chain aa First murine atggagacagacacactcct 10 Ig-kappa gctatgggtactgctgctct (IgK) gggttccaggttccactggt DNA First murine METDTLLLWVLLLWVPGSTG 11 Ig-kappa (IgK) aa First Human atggacatgagggtgcccgc 12 Ig-kappa ccagctgctgggcctgctgc (IgK) tgctgtggctgaggggcgcc DNA aggtgc First Human MDMRVPAQLLGLLLLWLRGA 13 Ig-kappa RC (IgK) aa First CD33 atgcccctgctgctgctgct 14 DNA gcccctgctgtgggccggcg ccctggcc First CD33 MPLLLLLPLLWAGALA 15 aa First tPAHuman atggacgccatgaagagggg 16 tissue cctgtgctgcgtgctgctgc plasminogen tgtgcggcgccgtgttcgtg activator agccccagc DNA First tPAHuman MDAMKRGLCCVLLLCGAVFV 17 tissue SPS plasminogen activator aa
Second Region
[0034] In some embodiments, the second region comprises in an N-terminal to C-terminal order the heavy chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 1, the linker, and the light chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 2.
[0035] In some embodiments, the second region comprises in an N-terminal to C-terminal order the light chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 2, the linker, and the heavy chain variable domain that comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 1.
[0036] In some embodiments, the heavy chain variable domain comprises complementarity determining regions (CDRs) HC-CDR1, HC-CDR2, and HC-CDR3, wherein the HC-CDR1, the HC-CDR2, and the HC-CDR3 comprise the amino acid sequences: HC-CDR1: SEQ ID NO: 18; HC-CDR2: SEQ ID NO: 19; HC-CDR3: SEQ ID NO: 20.
[0037] In some embodiments, the light chain variable domain comprises complementarity determining regions (CDRs) LC-CDR1, LC-CDR2, and LC-CDR3, wherein the LC-CDR1, the LC-CDR2, and the LC-CDR3 comprise the amino acid sequences: LC-CDR1: SEQ ID NO: 21; LC-CDR2: SEQ ID NO: 22; LC-CDR3: SEQ ID NO: 23.
[0038] In some embodiments, the heavy chain variable domain comprises complementarity determining regions (CDRs) HC-CDR1, HC-CDR2, and HC-CDR3, wherein the HC-CDR1, the HC-CDR2, and the HC-CDR3 comprise the amino acid sequences: HC-CDR1: SEQ ID NO: 18; HC-CDR2: SEQ ID NO: 19; HC-CDR3: SEQ ID NO: 20 and the light chain variable domain comprises complementarity determining regions (CDRs) LC-CDR1, LC-CDR2, and LC-CDR3, wherein the LC-CDR1, the LC-CDR2, and the LC-CDR3 comprise the amino acid sequences: LC-CDR1: SEQ ID NO: 21; LC-CDR2: SEQ ID NO: 22; LC-CDR3: SEQ ID NO: 23.
[0039] In some embodiments, the heavy chain variable domain comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the amino acid sequence according to SEQ ID NO: 1.
[0040] In some embodiments, the light chain variable domain comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the amino acid sequence according to SEQ ID NO: 2.
[0041] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to any one of SEQ ID NOs: 24, 26, 28, 30, 32, 34, 36, or 38. In some embodiments, the linker comprises an amino acid sequence that has at least 95% identity to any one of SEQ ID NOs: 24, 26, 28, 30, 32, 34, 36, or 38. In some embodiments, the linker comprises the amino acid sequence according to any one of SEQ ID NOs: 24, 26, 28, 30, 32, 34, 36, or 38.
[0042] In some embodiments, the linker comprises an amino acid sequence of the formula (GGGGS)n wherein n is a number from 1 to 5 (SEQ ID NO: 50).
[0043] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 24. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 24. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 24.
[0044] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 26. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 26. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 26.
[0045] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 28. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 28. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 28.
[0046] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 30. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 30. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 30.
[0047] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 32. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 32. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 32.
[0048] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 34. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 34. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 34.
[0049] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 36. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 36. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 36.
[0050] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 38. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 38. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 38.
[0051] In some embodiments, the linker comprises an amino acid sequence that has at least 90% identity to SEQ ID NO: 24. In some embodiments, the linker comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 24. In some embodiments, the linker comprises the amino acid sequence according to SEQ ID NO: 24. In some embodiments, the second region comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 39. In some embodiments, the second region comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 39. In some embodiments, the second region comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 39. In some embodiments, the second region comprises the amino acid sequence according to SEQ ID NO: 39.
TABLE-US-00003 TABLE3 SecondRegionSequences* Region SEQ of ID CAR Description Sequence NO: Second HC-CDR1 GYAMS 18 Second HC-CDR2 TISSGGTYIYYPDSVKGR 19 Second HC-CDR3 LGGDNYYEYFDV 20 Second LC-CDR1 RASKSVSTSGYSYMH 21 Second LC-CDR2 LASNLES 22 Second LC-CDR3 QHSRELPFT 23 Second Linker GGGGSGGGGSGGGGS 24 Second Linker20 ggtggcggtggttcaggtgg 25 DNA tgggggctctggcgggggtg gcagcggcggaggagggtca Second Linker20 GGGGSGGGGSGGGGSGGGGS 26 aa Second Linker25 ggtggcggtggttcaggtgg 27 DNA tgggggctctggcgggggtg gcagcggcggaggagggtca ggaggaggaggtagt Second Linker25 GGGGSGGGGSGGGGSGGGGS 28 aa GGGGS Second Linker218S ggatctacaagcggaagcgg 29 DNA caagcctggctccggcgagg gcagcaccaagggc Second Linker218S GSTSGSGKPGSGEGSTKG 30 aa Second Linker32 gggggttccggtgggggatc 31 DNA tggaggtggcagcggtggtg ggggggatcaggtggtgggg gtcaggcggaggcggttcag gcggcggtgggtca Second Linker32 GGSGGGSGGGSGGGGGSGGG 32 aa GSGGGGSGGGGS Second LinkerR18 ggcggcagcagcaggagcag 33 DNA cagcagcggcggcggcggca gcggcggggcggc Second LinkerR18 GGSSRSSSSGGGGSGGGG 34 aa Second LinkerGS18 ggcagcaccagcggcggcgg 35 DNA cagcggcggcggcagcggcg gcggcggcagcagc Second LinkerGS18 GSTSGGGSGGGSGGGGSS 36 aa Second Linker14 ggcggcagcggcggcagcgg 37 DNA cggcagcggcggcagcggcg gc Second Linker14 GGSGGSGGSGGSGG 38 aa Second C2scFv EVQLVESGGGLVKPGGSLRL 39 SCAASGFTFSGYAMSWVRQA PGKGLEWVSTISSGGTYIYY PDSVKGRFTISRDNAKNSLY LQMNSLRAEDTAVYYCARLG GDNYYEYFDVWGKGTTVTVS SGGGGSGGGGSGGGGSDIVL TQSPASLAVSPGQRATITCR ASKSVSTSGYSYMHWYQQKP GQPPKLLIYLASNLESGVPA RFSGSGSGTDFTLTINPVEA NDTANYYCQHSRELPFTFGG GTKVEIKRT *CDRs were determined by the Kabat method.
Third Region
[0052] In some embodiments, the hinge region comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 40. In some embodiments, the hinge region comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 40. In some embodiments, the hinge region comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 40. In some embodiments, the hinge region comprises the amino acid sequence according to SEQ ID NO: 40.
[0053] In some embodiments, the transmembrane domain comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 41. In some embodiments, the transmembrane domain comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 41. In some embodiments, the transmembrane domain comprises the amino acid sequence according to SEQ ID NO: 41. In some embodiments, the third region comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 3.
[0054] In some embodiments, the third region comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 3. In some embodiments, the third region comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 3. In some embodiments, the third region comprises the amino acid sequence according to SEQ ID NO: 3.
TABLE-US-00004 TABLE4 ThirdRegionSequences Region SEQ of ID CAR Description Sequence NO: Third hinge KHLCPSPLFPGPSKP 40 Third transmembrane FWVLVVVGGVLACY 41 domain SLLVTVAFIIFWV
Fourth Region
[0055] In some embodiments, the costimulatory domain sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 42. In some embodiments, the costimulatory domain sequence comprises the amino acid sequence according to SEQ ID NO: 42. In some embodiments, the signaling domain sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 43. In some embodiments, the signaling domain sequence comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 43. In some embodiments, the signaling domain sequence comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 43. In some embodiments, the signaling domain sequence comprises the amino acid sequence according to SEQ ID NO: 43.
[0056] In some embodiments, the signaling domain sequence comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 44. In some embodiments, the signaling domain sequence comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 44. In some embodiments, the signaling domain sequence comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 44. In some embodiments, the signaling domain sequence comprises the amino acid sequence according to SEQ ID NO: 44.
[0057] In some embodiments, the fourth region comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 4. In some embodiments, the fourth region comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 4. In some embodiments, the fourth region comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 4. In some embodiments, the fourth region comprises the amino acid sequence according to SEQ ID NO: 4.
TABLE-US-00005 TABLE5 FourthRegionSequences Region SEQ of ID CAR Description Sequence NO: Fourth costimulatory RSKRSRLLHSDYMNMTPRRPG 42 domain PTRKHYQPYAPPRDFAAYRS sequence Fourth signaling RVKFSRSADAPAYKQGQNQLY 43 domain NELNLGRREEYDVLDKRRGRD sequence- PEMGGKPRRKNPQEGLYNELQ CD3 KDKMAEAYSEIGMKGERRRGK zeta GHDGLYQGLSTATKDTYDALH MQALPPR Fourth signaling RVKFSRSADAPAYKQGQNQLY 44 domain NELNLGRREEYDVLDKRRGRD sequence- PEMGGKPRRKNPQEGLFNELQ CD3 KDKMAEAFSEIGMKGERRRGK zeta1xx GHDGLFQGLSTATKDTFDALH MQALPPR
Full Length CAR Sequences
[0058] In some embodiments, the CAR comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 45 or SEQ ID NO: 48. In some embodiments, the CAR comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 45 or SEQ ID NO: 48. In some embodiments, the CAR comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 45 or SEQ ID NO: 48. In some embodiments, the CAR comprises the amino acid sequence according to SEQ ID NO: 45 or SEQ ID NO: 48.
[0059] In some embodiments, the CAR comprises an amino acid sequence that has at least 95% identity to SEQ ID NO: 45 or SEQ ID NO: 48 and the heavy chain variable domain comprises complementarity determining regions (CDRs) HC-CDR1, HC-CDR2, and HC-CDR3, wherein the HC-CDR1, the HC-CDR2, and the HC-CDR3 comprise the amino acid sequences: HC-CDR1: SEQ ID NO: 18; HC-CDR2: SEQ ID NO: 19; HC-CDR3: SEQ ID NO: 20 and the light chain variable domain comprises complementarity determining regions (CDRs) LC-CDR1, LC-CDR2, and LC-CDR3, wherein the LC-CDR1, the LC-CDR2, and the LC-CDR3 comprise the amino acid sequences: LC-CDR1: SEQ ID NO: 21; LC-CDR2: SEQ ID NO: 22; LC-CDR3: SEQ ID NO: 23.
[0060] In some embodiments, the CAR comprises an amino acid sequence that has at least 98% identity to SEQ ID NO: 45 or SEQ ID NO: 48 and the heavy chain variable domain comprises complementarity determining regions (CDRs) HC-CDR1, HC-CDR2, and HC-CDR3, wherein the HC-CDR1, the HC-CDR2, and the HC-CDR3 comprise the amino acid sequences: HC-CDR1: SEQ ID NO: 18; HC-CDR2: SEQ ID NO: 19; HC-CDR3: SEQ ID NO: 20 and the light chain variable domain comprises complementarity determining regions (CDRs) LC-CDR1, LC-CDR2, and LC-CDR3, wherein the LC-CDR1, the LC-CDR2, and the LC-CDR3 comprise the amino acid sequences: LC-CDR1: SEQ ID NO: 21; LC-CDR2: SEQ ID NO: 22; LC-CDR3: SEQ ID NO: 23.
[0061] In some embodiments, the CAR comprises an amino acid sequence that has at least 99% identity to SEQ ID NO: 45 and the heavy chain variable domain comprises complementarity determining regions (CDRs) HC-CDR1, HC-CDR2, and HC-CDR3, wherein the HC-CDR1, the HC-CDR2, and the HC-CDR3 comprise the amino acid sequences: HC-CDR1: SEQ ID NO: 18; HC-CDR2: SEQ ID NO: 19; HC-CDR3: SEQ ID NO: 20 and the light chain variable domain comprises complementarity determining regions (CDRs) LC-CDR1, LC-CDR2, and LC-CDR3, wherein the LC-CDR1, the LC-CDR2, and the LC-CDR3 comprise the amino acid sequences: LC-CDR1: SEQ ID NO: 21; LC-CDR2: SEQ ID NO: 22; LC-CDR3: SEQ ID NO: 23.
[0062] In some embodiments, the CAR binds to MUC1*. In some embodiments, the CAR binds to MUC1. In some embodiments, the CAR binds to MUC1* and MUC1.
[0063] Disclosed herein are nucleic acid compositions that encode any of the CARs described herein. In some embodiments, the nucleic acid sequence further comprises the sequence according to SEQ ID NO: 46.
TABLE-US-00006 TABLE6 FullLengthCARCompositionSequences SEQ ID Description Sequence NO: MUC1*-28zX- MALPVTALLLPLALLLHAARPEVQLVESGG 45 aminoacid GLVKPGGSLRLSCAASGFTFSGYAMSWVRQ sequence APGKGLEWVSTISSGGTYIYYPDSVKGRFT ISRDNAKNSLYLQMNSLRAEDTAVYYCARL GGDNYYEYFDVWGKGTTVTVSSGGGGSGGG GSGGGGSDIVLTQSPASLAVSPGQRATITC RASKSVSTSGYSYMHWYQQKPGQPPKLLIY LASNLESGVPARFSGSGSGTDFTLTINPVE ANDTANYYCQHSRELPFTFGGGTKVEIKRT KHLCPSPLFPGPSKPFWVLVVVGGVLACYS LLVTVAFIIFWVRSKRSRLLHSDYMNMTPR RPGPTRKHYQPYAPPRDFAAYRSRVKFSRS ADAPAYKQGQNQLYNELNLGRREEYDVLDK RRGRDPEMGGKPRRKNPQEGLFNELQKDKM AEAFSEIGMKGERRRGKGHDGLFQGLSTAT KDTFDALHMQALPPR WPRE tcgacaatcaacctctggattacaaaattt 46 Sequence gtgaaagattgactggtattcttaactatg ttgctccttttacgctatgtggatacgctg ctttaatgcctttgtatcatgctattgctt cccgtatggctttcattttctcctccttgt ataaatcctggttgctgtctctttatgagg agttgtggcccgttgtcaggcaacgtggcg tggtgtgcactgtgtttgctgacgcaaccc ccactggttggggcattgccaccacctgtc agctcctttccgggactttcgctttccccc tccctattgccacggcggaactcatcgccg cctgccttgcccgctgctggacaggggctc ggctgttgggcactgacaattccgtggtgt tgtcggggaaatcatcgtcctttccttggc tgctcgcctgtgttgccacctggattctgc gcgggacgtccttctgctacgtcccttcgg ccctcaatccagcggaccttccttcccgcg gcctgctgccggctctgcggcctcttccgc gtcttcgccttcgccctcagacgagtcgga tctccctttgggccgcctccccgcctg MUC1*- MALPVTALLLPLALLLHAARPEVQLVESGG 47 8BZ- GLVKPGGSLRLSCAASGFTFSGYAMSWVRQ amino APGKGLEWVSTISSGGTYIYYPDSVKGRFT acid ISRDNAKNSLYLQMNSLRAEDTAVYYCARL sequence GGDNYYEYFDVWGKGTTVTVSSGGGGSGGG GSGGGGSDIVLTQSPASLAVSPGQRATITC RASKSVSTSGYSYMHWYQQKPGQPPKLLIY LASNLESGVPARFSGSGSGTDFTLTINPVE ANDTANYYCQHSRELPFTFGGGTKVEIKRT TTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLL LSLVITLYCKRGRKKLLYIFKQPFMRPVQT TQEEDGCSCRFPEEEEGGCELRVKFSRSAD APAYKQGQNQLYNELNLGRREEYDVLDKRR GRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKD TYDALHMQALPPR Mature EVQLVESGGGLVKPGGSLRLSCAASGFTFS 48 MUC1*- GYAMSWVRQAPGKGLEWVSTISSGGTYIYY 28zX- PDSVKGRFTISRDNAKNSLYLQMNSLRAED aminoacid TAVYYCARLGGDNYYEYFDVWGKGTTVTVS sequence SGGGGSGGGGSGGGGSDIVLTQSPASLAVS (without PGQRATITCRASKSVSTSGYSYMHWYQQKP signal GQPPKLLIYLASNLESGVPARFSGSGSGTD sequence) FTLTINPVEANDTANYYCQHSRELPFTFGG GTKVEIKRTKHLCPSPLFPGPSKPFWVLVV VGGVLACYSLLVTVAFIIFWVRSKRSRLLH SDYMNMTPRRPGPTRKHYQPYAPPRDFAAY RSRVKFSRSADAPAYKQGQNQLYNELNLGR REEYDVLDKRRGRDPEMGGKPRRKNPQEGL FNELQKDKMAEAFSEIGMKGERRRGKGHDG LFQGLSTATKDTFDALHMQALPPR
Nucleic Acid Molecules
[0064] Disclosed herein are nucleic acid molecules that encode any of the CAR polypeptides described herein. In some embodiments, the nucleic acid molecule further comprises the sequence according to SEQ ID NO: 46. In some embodiments, the recombinant nucleic acid includes a nucleic acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity sequence identity to a nucleic acid sequence according to SEQ ID NO: 46.
[0065] In some embodiments, the recombinant nucleic acid molecule is further defined as an expression cassette or a vector. It can be understood that an expression cassette generally includes a construct of genetic material that contains coding sequences and enough regulatory information to direct proper transcription and/or translation of the coding sequences in a recipient cell, in vivo and/or ex vivo. Generally, the expression cassette may be inserted into a vector for targeting to a desired host cell and/or into an individual. As such, in some embodiments, an expression cassette of the disclosure includes a coding sequence for the CAR polypeptide as disclosed herein, which is operably linked to expression control elements, such as a promoter, and optionally, any other sequences or a combination of other nucleic acid sequences that affect the transcription or translation of the coding sequence.
[0066] In some embodiments, the nucleotide sequence is incorporated into an expression vector. It can be understood by one skilled in the art that the term vector generally refers to a recombinant polynucleotide construct designed for transfer between host cells, and that may be used for the purpose of transformation, e.g, the introduction of heterologous DNA into a host cell. As such, in some embodiments, the vector can be a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. In some embodiments, the expression vector can be an integrating vector.
[0067] In some embodiments, the expression vector can be a viral vector. As can be appreciated by one of skill in the art, the term viral vector can refer either to a nucleic acid molecule (e.g, a transfer plasmid) that includes virus-derived nucleic acid elements that generally facilitate transfer of the nucleic acid molecule or integration into the genome of a cell or to a viral particle that mediates nucleic acid transfer. Viral particles generally include various viral components and sometimes also host cell components in addition to nucleic acid(s). The term viral vector may refer either to a virus or viral particle capable of transferring a nucleic acid into a cell or to the transferred nucleic acid itself. Viral vectors and transfer plasmids contain structural and/or functional genetic elements that are primarily derived from a virus. In some embodiments, the vector is a vector derived from a lentivirus, an adeno virus, an adeno-associated virus, a baculovirus, or a retrovirus. The term retroviral vector refers to a viral vector or plasmid containing structural and functional genetic elements, or portions thereof, that are primarily derived from a retrovirus. The term lentiviral vector refers to a viral vector or plasmid containing structural and functional genetic elements, or portions thereof, including LTRs that are primarily derived from a lentivirus, which is a genus of retrovirus.
[0068] In some embodiments, the nucleic acid sequences encoding the CAR polypeptides can be optimized for expression in the host cell of interest. For example, the G-C content of the sequence can be adjusted to average levels for a given cellular host, as calculated by reference to known genes expressed in the host cell. Methods for codon usage optimization are known in the art. Codon usages within the coding sequence of the chimeric receptor disclosed herein can be optimized to enhance expression in the host cell, such that about 1%, about 5%, about 10%, about 25%, about 50%, about 75%, or up to 100% of the codons within the coding sequence have been optimized for expression in a particular host cell.
[0069] The nucleic acid molecules provided can contain naturally occurring sequences, or sequences that differ from those that occur naturally, but, due to the degeneracy of the genetic code, encode the same polypeptide, e.g., antibody for the ECD. These nucleic acid molecules can consist of RNA or DNA (for example, genomic DNA, cDNA, or synthetic DNA, such as that produced by phosphoramidite-based synthesis), or combinations or modifications of the nucleotides within these types of nucleic acids. In addition, the nucleic acid molecules can be double-stranded or single-stranded (e.g, either a sense or an antisense strand).
[0070] The nucleic acid molecules are not limited to sequences that encode polypeptides (e.g, antibodies for the ECD); some or all of the non-coding sequences that lie upstream or downstream from a coding sequence (e.g, the coding sequence of a chimeric receptor) can also be included. Those of ordinary skill in the art of molecular biology are familiar with routine procedures for isolating nucleic acid molecules. They can, for example, be generated by treatment of genomic DNA with restriction endonucleases, or by performance of the polymerase chain reaction (PCR). In the event the nucleic acid molecule is a ribonucleic acid (RNA), molecules can be produced, for example, by in vitro transcription.
Cell Compositions Containing a CAR Composition
[0071] Disclosed herein are cell compositions comprising a CAR according to any of the above embodiments. In some embodiments, the cell is an immune cell. In some embodiments, the cell is a T-cell, a natural killer cell, a dendritic cell, or a mast cell. In some embodiments, the cell is derived from a patient or from a donor. In some embodiments, the cell remains active at least 30 days after administration to a patient. In some embodiments, the cell remains active at least 60 days after administration to a patient. In some embodiments, the cell remains active at least 90 days after administration to a patient, which can prevent tumor recurrence.
[0072] The nucleic acid molecules of the present disclosure can be introduced into a cell (i.e., a host cell), such as a human T cell, to produce a recombinant cell containing the nucleic acid molecule. Accordingly, some embodiments of the disclosure relate to methods for making a recombinant cell, including (a) providing a host cell capable of protein expression; and transducing the provided host cell with a recombinant nucleic acid of the disclosure to produce a recombinant cell. Introduction of the nucleic acid molecules of the disclosure into cells can be achieved by methods known to those skilled in the art such as, for example, viral infection, transfection, conjugation, protoplast fusion, lipofection, electroporation, nucleofection, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct micro-injection, nanoparticle-mediated nucleic acid delivery, and the like.
[0073] Accordingly, in some embodiments, the nucleic acid molecules can be introduced into a host cell by viral or non-viral delivery vehicles known in the art to produce an engineered cell. For example, the nucleic acid molecule can be stably integrated in the host genome, or can be episomally replicating, or present in the recombinant host cell as a mini-circle expression vector for a stable or transient expression. Accordingly, in some embodiments disclosed herein, the nucleic acid molecule is maintained and replicated in the recombinant host cell as an episomal unit. In some embodiments, the nucleic acid molecule is stably integrated into the genome of the recombinant cell. Stable integration can be completed using classical random genomic recombination techniques or with more precise genome editing techniques such as using zinc-finger proteins (ZNF), guide RNA directed CRISPR/Cas9, DNA-guided endonuclease genome editing NgAgo (Nalronobacleriiim gregoryi Argonaute), or TALEN genome editing (transcription activator-like effector nucleases).
[0074] The nucleic acid molecules can be encapsulated in a viral capsid or a lipid nanoparticle, or can be delivered by viral or non-viral delivery means and methods known in the art, such as electroporation. For example, introduction of nucleic acids into cells may be achieved by viral transduction. In a non-limiting example, baculoviral virus or adeno-associated virus (AAV) can be engineered to deliver nucleic acids to target cells via viral transduction. Several AAV serotypes have been described, and all of the known serotypes can infect cells from multiple diverse tissue types. AAV is capable of transducing a wide range of species and tissues in vivo with no evidence of toxicity, and it generates relatively mild innate and adaptive immune responses.
[0075] Lentiviral-derived vector systems are also useful for nucleic acid delivery and gene therapy via viral transduction. Lentiviral vectors offer several attractive properties as gene-delivery vehicles, including: (i) sustained gene delivery through stable vector integration into host genome; (ii) the capability of infecting both dividing and non-dividing cells; (iii) broad tissue tropisms, including important gene- and cell-therapy-target cell types; (iv) no expression of viral proteins after vector transduction; (v) the ability to deliver complex genetic elements, such as polycistronic or intron-containing sequences; (vi) a potentially safer integration site profile; and (vii) a relatively easy system for vector manipulation and production.
[0076] In some embodiments, host cells can be genetically engineered (e.g, transduced or transformed or transfected) with, for example, a vector construct of the present application that can be, for example, a viral vector or a vector for homologous recombination that includes nucleic acid sequences homologous to a portion of the genome of the host cell, or can be an expression vector for the expression of the CAR polypeptides of interest.
[0077] As outlined above, some embodiments of the disclosure relate to various methods for making a recombinant cell, including (a) providing a host cell capable of protein expression; and transducing the provided host cell with a recombinant nucleic acid of the disclosure to produce a recombinant cell. Non-limiting exemplary embodiments of the disclosed methods for making a recombinant cell can further include one or more of the following features. In some embodiments, the host cell is obtained by leukapheresis performed on a sample obtained from a subject, and the cell is transduced ex vivo. In some embodiments, the recombinant nucleic acid is encapsulated in a viral capsid or a lipid nanoparticle. In some embodiments, the methods further include isolating and/or purifying the produced cells. Accordingly, the recombinant cells produced by the methods disclosed herein are also within the scope of the disclosure.
[0078] Techniques for transforming a wide variety of the above-mentioned host cells and species are known in the art and described in the technical and scientific literature. For example, DNA vectors can be introduced into eukaryotic cells via conventional transformation or transfection techniques. Suitable methods for transforming or transfecting cells can be found in Sambrook et al. (2012, supra) and other standard molecular biology laboratory manuals, such as, calcium phosphate transfection, DEAE-dextran mediated transfection, transfection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction, nucleoporation, hydrodynamic shock, and infection. In some embodiments, the nucleic acid molecule is introduced into a host cell by a transduction procedure, electroporation procedure, or a biolistic procedure. Accordingly, cell cultures including at least one recombinant cell as disclosed herein are also within the scope of this application.
Pharmaceutical Compositions
[0079] In some embodiments, the cell is in a saline solution comprising human serum albumin. In some embodiments, the cell is in an infusible cryopreservation solution. In some embodiments, the infusible cryopreservation solution comprises one or more of sodium, potassium, magnesium, chloride, acetate, or gluconate. In some embodiments, the infusible cryopreservation solution comprises 140 mEq sodium, 5 mEq potassium, 3 mEq magnesium, 98 mEq chloride, 27 mEq acetate, and 23 mEq gluconate. In some embodiments, the infusible cryopreservation solution comprises human serum albumin (HSA) at a concentration range of 2% to 5%. In some embodiments, the infusible cryopreservation solution comprises human serum albumin (HSA) at a final concentration of 2.5%. In some embodiments, the infusible cryopreservation solution has a pH from 7.0 to 7.5. In some embodiments, the infusible cryopreservation solution has a pH of 7.4. In some embodiments, the infusible cryopreservation solution comprises dimethyl sulfoxide (DMSO). In some embodiments, the infusible cryopreservation solution comprises 2% to 5% (w/v) dimethyl sulfoxide (DMSO). In some embodiments, the infusible cryopreservation solution comprises 5% (w/v) dimethyl sulfoxide (DMSO).
Methods of Treatment
[0080] Disclosed herein are methods of treating cancer comprising administering one or more cells expressing the CAR of any of claims 1-61 to a subject in need thereof. In some embodiments, the at least 300,000 to 1,000,000,0000 of the cells expressing the CAR of any of claims 1-61 are administered to the subject.
[0081] Disclosed herein are methods of treating cancer comprising administering one or more first cells comprising a first chimeric antigen receptor and also administering one or more second cells comprising a second chimeric antigen receptor, wherein the first cells express the CAR of any of claims 1-61 to a subject in need thereof.
[0082] Disclosed herein are methods of treating cancer comprising administering one or more first cells comprising a first chimeric antigen receptor and subsequently administering one or more second cells comprising a second chimeric antigen receptor, wherein the second chimeric antigen receptor comprises an amino acid sequence with at least 90% identity to SEQ ID NO: 47 to a subject in need thereof.
[0083] In some embodiments, the second chimeric antigen receptor comprises an amino acid sequence with at least 95% identity to SEQ ID NO: 47 to a subject in need thereof.
[0084] In some embodiments, the second chimeric antigen receptor comprises the amino acid sequence according to SEQ ID NO: 47 to a subject in need thereof.
[0085] In some embodiments, the at least 300,000 to 1,000,000,0000 of the first cells are administered to the subject.
[0086] In some embodiments, the at least 300,000 to 1,000,000,0000 of the second cells are administered to the subject.
[0087] In some embodiments, the cancer expresses MUC1. In some embodiments, the cancer expresses MUC1*. In some embodiments, the cancer is MMP9 positive. In some embodiments, the cancer is breast cancer, colon cancer, prostate cancer, pancreatic cancer, or lung cancer. In some embodiments, the breast cancer is HER2/ER+/PR, or HER2/ER+/PR+, or HER2/ER/PR+, or HER2+, or HER2+/PR+/ER, HER2+/ER+/PR, or triple negative breast cancer. In some embodiments, the breast cancer is HER2/ER+/PR. In some embodiments, the breast cancer is HER2/ER+/PR+. In some embodiments, the breast cancer is HER2/ER/PR+. In some embodiments, the breast cancer is HER2+/PR+/ER. In some embodiments, the breast cancer is HER2+/ER+/PR. In some embodiments, the breast cancer is triple negative breast cancer.
[0088] In some embodiments, the method further comprises administration of an anti-cancer agent. In some embodiments, the anti-cancer agent comprises a cytotoxic agent. In some embodiments, the cytotoxic agent comprises a platinum-based agent or a taxane. The method of claim 94, wherein the platinum-based agent is carboplatin or cisplatin. The method of claim 94, wherein the taxane is paclitaxel or docetaxel.
Articles of Manufacture
[0089] In another aspect of the disclosure, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic.
[0090] The label or package insert indicates that the composition is used for treating the condition of choice. The article of manufacture in this embodiment of the disclosure may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
[0091] Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
Definitions
[0092] The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms a, an and the are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms including, includes, having, has, with, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term comprising.
[0093] The term antibody is used in the broadest sense and covers fully assembled antibodies, antibody fragments that can bind antigen, for example, Fab, F(ab)2, Fv, single chain antibodies (scFv), diabodies, antibody chimeras, hybrid antibodies, bispecific antibodies, and the like.
[0094] The term complementarity determining region or CDR is a segment of the variable region of an antibody that is complementary in structure to the epitope to which the antibody binds and is more variable than the rest of the variable region. Accordingly, a CDR is sometimes referred to as hypervariable region. A variable region comprises three CDRs. CDR peptides can be obtained by constructing genes encoding the CDR of an antibody of interest. Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody-producing cells. See, for example, Larrick et al., Methods: A Companion to Methods in Enzymology 2:106 (1991); Courtenay-Luck, Genetic Manipulation of Monoclonal Antibodies, in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al. (eds.), pages 166-179 (Cambridge University Press 1995); and Ward et al., Genetic Manipulation and Expression of Antibodies, in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), pages 137-185 (Wiley-Liss, Inc. 1995).
[0095] In some instances, the CDRs of an antibody are determined according to (i) the Kabat numbering system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and, Kabat et al. (1991) Sequences of Proteins of Immunological Interest Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242); or (ii) the Chothia numbering scheme, which will be referred to herein as the Chothia CDRs (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1): 175-82; and U.S. Pat. No. 7,709,226); or (iii) the ImMunoGeneTics (IMGT) numbering system, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7:132-136 and Lefranc, M.-P. et al, 1999, Nucleic Acids Res., 27:209-212 (IMGT CDRs); or (iv) MacCallum et al, 1996, J. Mol. Biol., 262:732-745. See also, e.g., Martin, A., Protein Sequence and Structure Analysis of Antibody Variable Domains, in Antibody Engineering, Kontermann and Diibel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001).
[0096] With respect to the Kabat numbering system, CDRs within an antibody heavy chain molecule are typically present at amino acid positions 31 to 35, which optionally can include one or two additional amino acids, following 35 (referred to in the Kabat numbering scheme as 35 A and 35B) (CDR1), amino acid positions 50 to 65 (CDR2), and amino acid positions 95 to 102 (CDR3). Using the Kabat numbering system, CDRs within an antibody light chain molecule are typically present at amino acid positions 24 to 34 (CDR1), amino acid positions 50 to 56 (CDR2), and amino acid positions 89 to 97 (CDR3). As is well known to those of skill in the art, using the Kabat numbering system, the actual linear amino acid sequence of the antibody variable domain can contain fewer or additional amino acids due to a shortening or lengthening of a FR and/or CDR and, as such, an amino acid's Kabat number is not necessarily the same as its linear amino acid number.
[0097] A single-chain variable fragment (scFv) is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an antibody, connected with a short linker peptide of ten to about 25 amino acids. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker. scFv antibodies are, e.g. described in Houston, J. S., Methods in Enzymol. 203 (1991) 46-96). In addition, antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain, namely being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the antigen binding property of full length antibodies.
[0098] As used herein, the term percent (%) amino acid sequence identity or percent (%) identity with respect to a sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as EMBOSS MATCHER, EMBOSS WATER, EMBOSS STRETCHER, EMBOSS NEEDLE, EMBOSS LALIGN, BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
[0099] In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
[0100] The terms individual(s), subject(s) and patient(s) are used interchangeably herein and refer to any mammal. In some embodiments, the mammal is a human. In some embodiments, the mammal is a non-human. None of the terms require or are limited to situations characterized by the supervision (e.g. constant or intermittent) of a health care worker (e.g. a doctor, a registered nurse, a nurse practitioner, a physician's assistant, an orderly or a hospice worker).
[0101] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
EXAMPLES
[0102] The following examples are provided to further illustrate some embodiments of the present disclosure, but are not intended to limit the scope of the disclosure; it will be understood by their exemplary nature that other procedures, methodologies, or techniques known to those skilled in the art may alternatively be used.
[0103] Provided herein are exemplary experiments, procedures and findings on MUC1*-28zX, a successor to MUC1*-8BZ. MUC1*-28zX overcomes two major challenges to the effective use of chimeric antigen receptor T cell therapies (CAR) T cell therapy for solid tumor cancers: (1) CAR T cell exhaustion; and 2) inability to recognize and kill low antigen-expressing tumor cells, which are characteristic of early-stage cancers.
[0104] As disclosed here, studies demonstrate that T cells expressing MUC1*-28zX demonstrated greatly increased persistence and ability to recognize and kill tumor cells expressing low to medium amounts of the antigen. MUC1*-28zX T cells are also effective against cancer cells with high MUC1* expression, which are characteristic of late-stage cancers. Additionally, in vitro studies of MUC1*-28zX T cells in co-culture with normal cells expressing full-length MUC1 showed no evidence of T cell activation and essentially no killing of the normal cells.
Example 1: Chimeric Antigen Receptors Targeting MUC1*
[0105] The three chimeric antigen receptors (CARs) evaluated in these examples share a common humanized single chain antibody (scFv) domain, huC2, derived from the C2 antibody specific for MUC1*. In MUC1*-8BZ, huC2 is linked to hinge and transmembrane regions derived from CD8, a costimulatory domain derived from 4-1BB, and a signaling domain derived from CD3 (CD3z) (
Example 2: MUC1* Expression in Xenograft Tumors
[0106] MUC1* expression was quantified by staining tumors with the C2 antibody and determining an H-score, as described by Meyerholz and Ram. See Meyerholz D.K. and Beck A.P., Principles and approaches for reproducible scoring of tissue stains in research. Lab Invest, 2018. 98(7): p. 844-855; Ram S, Vizcarra P, Whalen P, Deng S, Painter CL, Jackson-Fisher A, et al. (2021) Pixelwise H-score: A novel digital image analysis-based metric to quantify membrane biomarker expression from immunohistochemistry images. PLoS ONE 16(9): e0245638. MUC1* expression is quantified on a scale of 0, 1, 2, or 3 in different regions of a tumor section, and the percentage of the tumor having each expression level is determined. The H-score is then calculated by summing (percentageexpression level) at each expression level. The maximum possible H-score is 300. Early tumors typically have a lower H-score. High H scores are a characteristic of early cancers, whereas later stage cancers are characterized by low H scores.
[0107] Xenograft tumors were generated by subcutaneous injection of cancer cells from cell lines representative of various cancer types into nude NOD/SCID/GAMMA (NSG) mice. In some instances, the cancer cells were engineered to overproduce MUC1*. Tumors were excised from the mice for H-score analysis when a pathologist determined that the tumor burden was excessive.
[0108] HCT-116 human colon cancer cells that had been transfected to express MUC1* and a luciferase reporter (HCT-MUC1*).
TABLE-US-00007 TABLE 7 MUC1* expression in xenograft tumors derived from human cancer cell lines as determined by H-score analysis Cancer Type Cell Line Excision Day H-Score Breast T47D-WT 100 10 Breast T47D-MUC1* 20-25 280 Breast T47D with 30% MUC1* 20-25 80 Breast T47D with 15% MUC1* 20-25 40 Breast T47D with 7.5% MUC1* 20-25 30 Lung NCI-H1975 20-25 40 Pancreas HPAF.II 20-25 200 Colon HCT-116 20-25 0
Example 3: Increased Persistence of MUC1*-28zX CAR T Cells
[0109] CAR T cells expressing MUC1*-28zX, MUC1*-28Z, or MUC1*-8BZ were incubated with magnetic beads presenting a synthetic MUC1* peptide (SEQ ID NO: 49) to simulate repeated CAR T stimulation and activation by the target antigen. After 6 days, the magnetic beads were removed and the pre-stimulated CAR T cells were co-cultured for 96 hours with a heterologous population of T47D breast cancer target cells expressing mCherry. 15% of the target cells were engineered to express high levels of MUC1* and also expressed a GFP marker. The remaining 85% of the target cells expressed low (wild-type) levels of MUC1*. After 96 hours of pre-stimulation, the MUC1*-28zX CAR T cells killed the target cells faster than the MUC1*-28Z or MUC1*-8BZ CAR T cells, demonstrating increased persistence (
Example 4: Persistent Shrinkage of Colon Cancer Tumors by MUC1*-28zX CAR T Cells
[0110] A colon cancer xenograft system was used to test the in vivo efficacy and persistence of MUC1*-28zX T cells. Tumors were generated in NSG mice by subcutaneous injection of HCT-116 human colon cancer cells that had been transfected to express MUC1* and a luciferase reporter (HCT-MUC1*). The parental HCT-116 cells are MUC1* negative, so MUC1* was ectopically expressed to render the cells susceptible to killing by CAR T cells with an anti-MUC1* targeting domain. The luciferase allows luminescence from the tumors to be detected using an IVIS instrument. The MUC1* expression vector carries a GFP reporter, and the luciferase expression vector carries an mCherry reporter. 500K HCT-MUC1* cancer cells were subcutaneously injected into a flank of female NSG mice. After allowing tumor formation and growth for five days, 10 M CAR T cells (E:T of 20:1) were injected into the tail vein, and changes in tumor mass were monitored by IVIS (
[0111] In controls treated with PBS buffer or untransduced T cells, the mice had to be sacrificed before Day 26 due to their massive tumor burden. In contrast, the MUC1*-28zX CAR T cells cleared the HTC-MUC1* tumors by Day 26. Half of the mice treated with MUC1*-28zX CAR T cells remained tumor free until the end of the experiment on Day 95. The tumors that recurred in other mice were MUC1* negative, suggesting that their Muc1* transgene had been silenced or lost. These results demonstrate that MUC1*-28zX CAR T cells have cytotoxic activity against MUC1* positive human colon cancer cells and that this activity persists for at least 90 days and suppresses tumor recurrence. Increased persistence is important because clinical experience with CAR T cell therapies has revealed that cancer remissions are brief in a substantial number of patients owing to poor CAR T cell persistence. Shah and Fry, Nat Rev Clin Oncol. 2019 June; 16(6): 372-385.
Example 5: MUC1*-28zX Treatment of Breast Cancer Tumors With Low MUC1* Expression
[0112] The efficacy of MUC1*-28zX for treating breast cancer was investigated using T47D cells from a naturally-occurring human breast cancer that express low to medium amounts of MUC1*. Female NSG mice were implanted with 90-day estrogen pellets followed by subcutaneous injection of 250K T47D cells expressing luciferase. The mice were treated with MUC1*-28zX CAR T cells on Day 5 at an effector:target ratio of 1:1 (250K CAR T cells) or 10:1 (2.5 M CAR T cells). Tumor growth was monitored by IVIS. Both doses substantially inhibited tumor growth over 96 days when compared to a PBS control (
Example 6: MUC1*-28zX Treatment of Breast Cancers With Heterologous MUC1* Expression
[0113] Natural tumors are often comprised of cancer cells expressing heterogeneous amounts of MUC1* (WO2020146902). To model natural tumors, T47D breast cancer cells expressing low to medium amounts of MUC1* were mixed with transgenic T47D-MUC1* cells with high MUC1* expression. All of the T47D cells were transfected with a luciferase-mCherry expression vector to track tumor cells. The T47D-MUC1* cells were transfected with a Muc1*-GFP transgene to permit identification of by GFP fluorescence.
[0114] To investigate T cell persistence during the treatment of tumors with heterologous MUC1* expression, a total of 250K T47D cells consisting of 7.5%, 15%, or 30% T47D-MUC1* (high antigen) cells in a background of T47D-wt (low-medium antigen) cells were subcutaneously injected into female NSG mice that had previously been implanted with 90-day estrogen release pellets. Five days later, the animals were intravenously injected with either 250K or 2.5 M (E:T ratio of 1:1 or 10:1) human T cells that had been transduced with MUC1*-28zX, MUC1*-8BZ, or MUC1*-28Z, or a PBS buffer control.
[0115] Bioluminescence measurements of the T47D tumors shows that both doses of MUC1*-28zX CAR T cells inhibited the growth of T47D tumors regardless of the percentage of T47D-MUC1* cells, and did so more effectively than MUC1*-8BZ or MUC1*-28Z CAR T cells under all conditions tested. MUC1*-28zX inhibited tumor recurrence, whereas in animals treated with MUC1*-8BZ or MUC1*-28Z CAR T, tumors recurred around Day 40-50 post tumor implantation.
[0116] Results for the PBS control mice show that tumors with a higher percentage of high-expressing T47D-MUC1* cells had a higher growth rate, indicating that high expression of the MUC1* growth factor receptor contributes to tumor virulence. Likewise, immunofluorescent images from tumors at the end of the experiment revealed that untreated tumors were dominated by GFP positive T47D-MUC1* cells with high MUC1* expression (
[0117] CAR T cells were recovered from the blood, spleen and tumors of the mice at the end of the experiment to investigate the mechanism underlying the improved performance of the MUC1*-28zX CAR. Under conditions where the MUC1*-28zX CAR most strongly outperformed the CARs with a wild-type CD3z domain (1:1 effector:target ratio, 7.5% T47D-MUC1* cells), the number CAR T cells recovered from each sample was higher and the percentage of recovered CAR T cells displaying molecular markers of T cell exhaustion (TIM3, LAG3, and PD-1) was lower for MUC1*-28zX (
[0118] The maturation status of CAR T cells was determined by flow cytometry. Cells were stained with an antibody against human CD3 to identify transplanted T cells, the FAB2 antibody to detect CAR expression, and antibodies against CD62L and CD45RO to determine T cell maturation status. Nave T cells are CD62L positive and CD45RO negative. Central memory T cells (CM) are CD62L positive and CD45RO positive. Effector memory T cells (EM) are CD62L negative and CD45RO positive. Effector T cells are CD62L negative and CD45RO negative.
[0119] In mice with T47D human breast cancer tumors, the percentage of CAR T cells that were in the effector state on Day 69 after tumor implantation was higher for MUC1*-28zX than for MUC1*-8BZ (Table 8). The percentage MUC1*-28zX CAR T cells that were in the effector state doubled when the amount of MUC1* expressed by the tumors was increased (compare T47D-WT versus T47D-MUC1*). In contrast, higher MUC1* expression had no effect on the percentage of MUC1*-8BZ CAR T cells that progressed to the effector state. Additionally, 68% of the MUC1*-28zX CAR T cells recovered from mice on Day 93-96 post treatment were CD8 positive cells with cytotoxic activity. These results demonstrate that MUC1*-28zX CAR T cells were more strongly activated for killing the MUC1* positive tumors and were capable of responding to elevated MUC1* expression by the tumor.
TABLE-US-00008 TABLE 8 Maturation status of CAR T cells isolated from mice with breast cancer tumors MUC1*-28zX MUC1*-8BZ T47D-WT T47D-MUC1* T47D-WT T47D-MUC1* Eff 14.4 29.8 8.1 8.2 Nave 2.5 1.6 2.3 0.4 CM 8.8 3.2 7.9 13.8 EM 74.3 65.3 81.7 77.6 Values indicate the percentage of total CAR T cells, n = 5
[0120] To monitor maturation of MUC1*-28zX CAR T cells over time, blood was collected from CAR T treated mice on days 20 and 60 after tumor implantation. In this experiment, 15% of the T47D breast cancer cells had elevated MUC1* expression and the MUC1*-28zX CAR T cells were administered on Day 6 at two different doses (effector to target ratios of 1:1 or 10:1). With both doses, the percentage of CAR T cells that were nave T cells increased from Day 20 to Day 60, further supporting the persistence of MUC1*-28zX CAR T cells. In addition, the percentages of central memory (CM) and effector memory (EM) cells were reduced. These results demonstrate that a reservoir of nave MUC1*-28zX CAR T cells is available to prevent recurrence of the MUC1* positive tumors.
TABLE-US-00009 TABLE 9 Maturation status of MUC1*-28zX CAR T cells isolated from the blood of mice with T47D human breast cancer tumors E:T Ratio Day Nave CM EM Eff 1:1 20 15 10 3.7 3.2 5.0 4.4 76 54 69 27 13 0.0 0.0 73 33 10:1 20 20 4 6.0 0.8 6.7 2.0 67 11 69 36 6 0.4 0.3 0.4 0.2 63 16 Values indicate the percentage of total CAR T cells SEM, n = 5
Example 7. MUC1*-28zX Treatment of Lung Cancers
[0121] NCI-H1975 non-small cell lung cancer cells were implanted into NSG mice. On Day 5 and Day 12 post implantation, MUC1*-28zX or untransduced T cell generated from the same donor were intravenously administered at a 10:1 effector to target cell ratio Bioluminescent photographs taken at Day 18 show a 10-30 fold reduction in tumor volume with MUC1*-28zX T cells (
Example 8. MUC1*-28zX Treatment of Pancreatic Cancers
[0122] HPAF-II pancreatic cancer cells were intravenously implanted into NSG mice. On Day 5 and Day 12 post implantation, MUC1*-28zX or untransduced T cell generated from the same donor were intravenously administered at a 10:1 effector to target cell ratio. By Day 18 the control animals had to be sacrificed due to excess tumor burden. The MUC1*-28zX treated animals showed a 4-8 fold reduction in tumor volume (