Reusable initiators for synthesizing nucleic acids
12168211 ยท 2024-12-17
Assignee
Inventors
Cpc classification
C12Q2525/186
CHEMISTRY; METALLURGY
C12Q2565/50
CHEMISTRY; METALLURGY
C12Q2525/101
CHEMISTRY; METALLURGY
C12Q2565/50
CHEMISTRY; METALLURGY
C12Y207/07031
CHEMISTRY; METALLURGY
C12Q1/6811
CHEMISTRY; METALLURGY
C12P19/34
CHEMISTRY; METALLURGY
C12N9/1264
CHEMISTRY; METALLURGY
C12Y207/07019
CHEMISTRY; METALLURGY
C12Q2525/186
CHEMISTRY; METALLURGY
C12Q2525/101
CHEMISTRY; METALLURGY
B01J19/0046
PERFORMING OPERATIONS; TRANSPORTING
C12Q1/6806
CHEMISTRY; METALLURGY
International classification
B01J19/00
PERFORMING OPERATIONS; TRANSPORTING
C12N9/12
CHEMISTRY; METALLURGY
C12P19/34
CHEMISTRY; METALLURGY
C12Q1/6806
CHEMISTRY; METALLURGY
C12Q1/6811
CHEMISTRY; METALLURGY
Abstract
The invention provides improved methods for synthesizing polynucleotides, such as DNA and RNA, using renewable initiators coupled to a solid support. Using the methods of the invention, specific sequences of polynucleotides can be synthesized de novo, base by base, in an aqueous environment, without the use of a nucleic acid template.
Claims
1. A method for synthesizing oligonucleotides on a reusable solid support, the method comprising: exposing a nucleic acid initiator attached to a solid support to nucleotide analogs in the presence of a polymerase to create a first oligonucleotide, wherein the nucleic acid initiator comprises a sequence-specific cleavage element; contacting the nucleic acid initiator with a releasing agent to cleave the sequence-specific cleavage element and release the first oligonucleotide from the nucleic acid initiator; dephosphorylating a 3-end of the solid support-attached nucleic acid initiator; and enzymatically renewing the sequence-specific cleavage element.
2. The method of claim 1 wherein the nucleic acid initiator comprises a 5-amine, 5-hydroxyl, 5-phosphate, 5-sulfhydryl, or 5-benzaldehyde group attached to the solid support comprising formyl, chloromethyl, epoxide, amine, thiol, alkene, or terminal C-F bonds.
3. The method of claim 1 wherein the nucleic acid initiator is irreversibly attached to the solid support.
4. The method of claim 1 wherein the sequence-specific cleavage element is incorporated into the nucleic acid initiator after a 5 end of the nucleic acid initiator has been irreversibly coupled to the solid support.
5. The method of claim 4 wherein the sequence-specific cleavage element is incorporated enzymatically.
6. The method of claim 1 wherein the sequence-specific cleavage element comprises a poly-U tract.
7. The method of claim 1 wherein the nucleic acid initiator comprises an index element, the method further comprising: extending a 3 end of the nucleic acid initiator with complementary nucleotide analogs to a 3 sequence of the nucleic acid initiator to synthesize the first oligonucleotide under to permit hairpin formation; extending the first oligonucleotide after hairpin formation using the index element as a template.
8. The method of claim 7 wherein the 3 sequence of the nucleic acid initiator is complimentary to the sequence-specific cleavage element.
9. The method of claim 7, further comprising incorporating a homopolymer tract into the first oligonucleotide to create a single stranded 3 end thereof subsequent to the hairpin.
10. The method of claim 1, further comprising: before contacting the nucleic acid initiator with a releasing agent, incorporating a second sequence-specific cleavage element on a 3 end of the first oligonucleotide to create a second nucleic acid initiator and exposing the second nucleic acid initiator, attached to the first oligonucleotide, to nucleotide analogs in the presence of a polymerase to create a second oligonucleotide, wherein contacting the nucleic acid initiator and the second nucleic acid initiator with the releasing agent cleaves the sequence-specific cleavage element and the second sequence-specific cleavage element and release the first oligonucleotide and the second oligonucleotide from the nucleic acid initiator and the second nucleic acid initiator.
11. The method of claim 1, wherein the polymerase is a nucleotidyl transferase or a modified nucleotidyl transferase.
12. The method of claim 1, wherein the polymerase is terminal deoxynucleotidyl transferase (TdT) or a modified TdT.
13. The method of claim 1, wherein the nucleotide analogs have an unmodified 3-OH and a cleavable terminating group, and wherein the cleavable terminating group blocks subsequent nucleotidyl transferase activity but results in a nucleotide substrate for nucleotidyl transferase upon cleavage of the terminating group.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
DESCRIPTION DETAILED
(40) The invention provides improved methods for synthesizing polynucleotides, such as DNA and RNA, using enzymes and nucleic acid analogs. Using the disclosed methods, specific sequences of polynucleotides can be synthesized de novo, base by base, in an aqueous environment, and without the use of a nucleic acid template.
(41) Nucleotide analogs may have an unmodified 3 hydroxyl, or may have a 3-O-blocking group or may have a blocker releasably attached to a phosphate. In any case, the blocking group is designed to not leave behind substantial additional molecules, i.e., designed to leave behind scarless nucleotides that are recognized as natural nucleotides by the enzyme. Thus, at the conclusion of the synthesis, upon removal of the last blocking group, the synthesized polynucleotide is chemically and structurally equivalent to the naturally-occurring polynucleotide with the same sequence. The synthetic polynucleotide can, thus, be incorporated into living systems without concern that the synthesized polynucleotide will interfere with biochemical pathways or metabolism.
(42) The process and analogs of the invention are used for the non-template mediated enzymatic synthesis of oligo- and oligodeoxynucleotides especially of long oligonucleotides (<5000 nt). Products can be single stranded or partially double stranded depending upon the initiator used. The synthesis of long oligonucleotides requires high efficiency incorporation and high efficiency of reversible terminator removal. The initiator bound to the solid support consists of a short, single strand DNA sequence that is either a short piece of the user defined sequence or a universal initiator from which the user defined single strand product is removed.
(43) In one aspect, the disclosed methods employ commercially-available nuclcotidyl transferase enzymes, such as terminal deoxynucleotidyl transferase (TdT), to synthesize polynucleotides from nucleotide analogs in a step-by-step fashion. The nucleotide analogs are of the form:
NTP-Linker-Inhibitor
(44) wherein NTP is a nucleotide triphosphate (i.e., a dNTP or an rNTP), the linker is a cleavable linker between the pyridine or pyrimidine of the base, and the inhibitor is a group that prevents the enzyme from incorporating subsequent nucleotides. At each step, a new nucleotide analog is incorporated into the growing polynucleotide chain, whereupon the enzyme is blocked from adding an additional nucleotide by the inhibitor group. Once the enzyme has stopped, the excess nucleotide analogs are removed from the growing chain, the inhibitor can be cleaved from the NTP, and new nucleotide analogs can be introduced in order to add the next nucleotide to the chain. By repeating the steps sequentially, it is possible to quickly construct nucleotide sequences of a desired length and sequence. Advantages of using nucleotidyl transferases for polynucleotide synthesis include: 1) 3-extension activity using single strand (ss) initiating primers in a template-independent polymerization, 2) the ability to extend primers in a highly efficient manner resulting in the addition of thousands of nucleotides, and 3) the acceptance of a wide variety of modified and substituted NTPs as efficient substrates.
(45) In addition, the invention can make use of an initiator sequence that is a substrate for nucleotidyl transferase. The initiator is attached to a solid support and serves as a recognition site for the enzyme. The initiator is preferably a universal initiator for the enzyme, such as a homopolymer sequence, and is recyclable on the solid support, the formed oligonucleotide being cleavable from the initiator.
(46) Methods of the invention are well-suited to a variety of applications that currently use synthetic nucleic acids, e.g., phosphoramidite-synthesized DNA oligonucleotides. For example, polynucleotides synthesized using the methods of the invention are used as primers for nucleic acid amplification, hybridization probes for detection of specific markers, and for incorporation into plasmids for genetic engineering. However, because the disclosed methods produce longer synthetic strings of nucleotides, at a faster rate, and in an aqueous environment, the disclosed methods also lend themselves to high-throughput applications, such as screening for expression of genetic variation in cellular assays, as well as synthetic biology. Furthermore, the methods of the invention will provide the functionality needed for next-generation applications, such as using DNA as synthetic read/write memory, or creating macroscopic materials synthesized completely (or partially) from DNA.
(47) The invention and systems described herein provide for synthesis of polynucleotides, including deoxyribonucleic acids (DNA) and ribonucleic acids (RNA). While synthetic pathways for natural nucleotides, such as DNA and RNA, are described in the context of the common nucleic acid bases, e.g., adenine (A), guanine (G), cytosine (C), thymine (T), and uracil (U), it is to be understood that the methods of the invention can be applied to so-called non-natural nucleotides, including nucleotides incorporating universal bases such as 3-nitropyrrole 2-deoxynucloside and 5-nitroindole 2-deoxynucleoside, alpha phosphorothiolate, phosphorothioate nucleotide triphosphates, or purine or pyrimidine conjugates that have other desirable properties, such as fluorescence. Other examples of purine and pyrimidine bases include pyrazolo[3,4-d]pyrimidines, 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo (e.g., 8-bromo), 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 8-azaguanine and 8-azaadenine, deazaguanine, 7-deazaguanine, 3-deazaguanine, deazaadenine, 7-deazaadenine, 3-deazaadenine, pyrazolo[3,4-d]pyrimidine, imidazo[1,5-a]1,3,5 triazinones, 9-deazapurines, imidazo[4,5-d]pyrazines, thiazolo[4,5-d]pyrimidines, pyrazin-2-ones, 1,2,4-triazine, pyridazine; and 1,3,5 triazine. In some instances, it may be useful to produce nucleotide sequences having unreactive, but approximately equivalent bases, i.e., bases that do not react with other proteins, i.e., transcriptases, thus allowing the influence of sequence information to be decoupled from the structural effects of the bases.
Analogs
(48) The invention provides nucleotide analogs having the formula NTP-linker-inhibitor for synthesis of polynucleotides in an aqueous environment. With respect to the analogs of the form NTP-linker-inhibitor, NTP can be any nucleotide triphosphate, such as adenosine triphosphate (ATP), guanosinc triphosphatc (GTP), cytidine triphosphatc (CTP), thymidinc triphosphate (TTP), uridine triphosphate (UTP), nucleotide triphosphates, deoxyadenosine triphosphate (dATP), deoxyguanosine triphosphate (dGTP), deoxycytidine triphosphate (dCTP), deoxythymidine triphosphate (dTTP), or deoxyuridine triphosphate (dUTP).
(49) The linker can be any molecular moiety that links the inhibitor to the NTP and can be cleaved. For example, the linkers can be cleaved by adjusting the pH of the surrounding environment. The linkers may also be cleaved by an enzyme that is activated at a given temperature, but inactivated at another temperature. In some embodiments, the linkers include disulfide bonds.
(50) Linkers may, for example, include photocleavable, nucleophilic, or electrophilic cleavage sites. Photocleavable linkers, wherein cleavage is activated by a particular wavelength of light, may include benzoin, nitroveratryl, phenacyl, pivaloyl, sisyl, 2-hydroxy-cinamyl, coumarin-4-yl-methyl, or 2-nitrobenzyl based linkers.
(51) Examples of nucleophilic cleavage sites include fluoride ion cleavable silicon-oxygen bonds or esters which may be cleaved in a basic solution. Electrophilically-cleaved linkers may include acid induced cleavage sites which may comprise trityl, tert-butyloxycarbonyl groups, acetal groups, and p-alkoxybenzyl esters and amides. In certain aspects, a cleavable linker may include a cysteine residue as shown in
(52) The linker can be attached, for example, at the N4 of cytosine, the N3 or O4 of thymine, the N2 or N3 of guanine, and the N6 of adenine, or the N3 or O4 of uracil because attachment at a carbon results in the presence of a residual scar after removal of the polymerase-inhibiting group. The linker is typically on the order of at least about 10 Angstroms long, e.g., at least about 20 Angstroms long, e.g., at least about 25 Angstroms long, thus allowing the inhibitor to be far enough from the pyridine or pyrimidine to allow the enzyme to bind the NTP to the polynucleotide chain via the attached sugar backbone. In some embodiments, the cleavable linkers are self-cyclizing in that they form a ring molecule that is particularly non-reactive toward the growing nucleotide chain.
(53) In certain aspects, a cleavable linker may include a variable number of methylene bridges on the NTP or the inhibitor side of a disulfide bond, including, for example, 1, 2, 3, or 4 methylene bridges as shown in
(54) For example, in some embodiments using a charged moiety as an inhibitor, the charged moiety may be from about 5 to about 60 bonds away from the NTP. In some other embodiments, the charged moiety of the inhibitor may be from about 10 to about 40 bonds away from the NTP. In some other embodiments, the charged moiety of the inhibitor can be from about 10 to about 35 bonds away from the NTP. In some other embodiments, the charged moiety of the inhibitor may be from about 10 to about 30 bonds away from the NTP. In some other embodiments, the charged moiety of the inhibitor is from about 10 to about 20 bonds away from the NTP. The number of bonds between the charged moiety and the NTP may be increased by including additional methylene bridges.
(55) The nucleotide analogs can include any moiety linked to the NTP that inhibits the coupling of subsequent nucleotides by the enzyme. The inhibitory group can be a charged group, such as a charged amino acid, or the inhibitory group can be a group that becomes charged depending upon the ambient conditions. In some embodiments, the inhibitor may include a moiety that is negatively charged or capable of becoming a negatively charged. For example, an inhibitor may include a chain of phosphate groups (e.g., 1, 2, or 3, phosphates) as
(56) shown in
(57) In certain aspects, a terminator or inhibitor may include a steric inhibitor group. Such a steric inhibitor group may allow for the NTP-linker-inhibitor (i.e., nucleotide analog) to be incorporated onto the unblocked 3 OH of an oligonucleotide, said incorporation being catalyzed by nucleotidyl transferase. The steric inhibitor group may physically block the incorporation of nucleotides or additional nucleotide analogs onto the unblocked 3 OH of the incorporated nucleotide analog. Steric inhibitors may also block 3 endonucleases from acting on a nucleotide analog and, accordingly, on oligonucleotides to which an un-cleaved nucleotide analog has been incorporated.
(58) Steric inhibitors can include, for example, chemical polymers, nanoparticles, poly-N-substituted glycines (peptoids), or proteins. A steric inhibitor of the invention may be a variety of sizes including, e.g., greater than 20 , greater than 30 , greater than 40 , greater than 50 , greater than 60 , greater than 70 , greater than 80 , greater than 90 , greater than 100
(59) , greater than 110 , greater than 120 , greater than 130 , greater than 140 , or greater than 150 . In preferred embodiments, a steric inhibitor may be monodisperse or substantially monodisperse. Steric inhibitors may be water soluble and conformationally-constrained (i.e., of
a rigid or semi-rigid form). In certain aspects, a steric inhibitor will physically block access to the active site of the relevant nucleotidyl transferase enzyme because of the size or the conformation of the inhibitor. In preferred embodiments, the steric inhibitor may comprise a non-natural bio-inspired polymer such as a polypeptoid or a non-natural polypeptide.
(60) In certain aspects, a self-assembling polypeptoid sequence may be used as a steric inhibitor. Peptoid monomers are often based on an N-substituted glycine backbone. Because the backbone is devoid of hydrogen bond donors, polypeptoids are readily processed while still being able to form secondary structures such as helices. They also provide the beneficial properties of allowing polarities and side chains similar to peptides, while being generally chemically and thermally stable. Self-assembling polypeptoid steric inhibitors according to the invention may self-assemble single peptoid helices to form microspheres in the micrometer range of diameters including, .3 m, .4 m, .5 m, .6 m, .7 m, .8 m, .9 m, 1.0 m, 1.5 m, 2 m, 2.5 m, 3 m, or 3.5 m, among others. In certain aspects, steric inhibitors may include peptoids with C--branched side chains, N-Aryl side chains, N-1-naphthylethyl side chains, or other formations capable of forming stable helical structures. An example of a peptoid steric inhibitor is shown in
(61) In other embodiments, a steric inhibitor may comprise a polymer, such as a biocompatible polymer. The polymer may comprise blocks of different polymers, such that the blocks form a desired macroscopic structure, .e.g., a sphere when exposed to an aqueous environment. For example, the copolymer may comprise blocks of hydrophilic and hydrophobic blocks so that the polymer self-assembles into a micellar structure upon addition to water. In some embodiments, the hydrophobic blocks may be selected from polycaprolactones (PCL), polydimethylsiloxanes (PDMS), polymethylmethacrylate (PMMA), or polylactides (PLA). The hydrophilic blocks may include polyethylene glycol (PEG) or other polyalcohol.
(62) In other embodiments, the inhibitor may comprise a nanoparticle of sufficient size to block the activity of a nucleotidyl transferase. Such nanoparticles may comprise, e.g., gold, silver, silicon, cerium oxide, iron oxide, titanium dioxide, silicon nitride, silicon boride, or silica, e.g., mesoporous silica. In other embodiments, the nanoparticles may comprise highly-ordered molecular structures, such as fullerenes, e.g., buckyballs and nanotubes, comprising carbon, or semiconductors.
(63) Steric inhibitors may have no charge or may be positively or negatively charged to provide compatibility with the nucleotide to which it is linked and with the nucleotidyl transferase enzyme so that the inhibitor does not interfere with the incorporation reaction on the 5 end of the NTP analog. Steric inhibitors may incorporate a variety of amino acid residues in order to provide a desired conformation, charge, or attachment site.
(64) An example of a nucleotide analog of the type NTP-linker-inhibitor is shown in
(65) Exemplary schemes for synthesizing dCTP analogs of
(66) ##STR00001##
(67) ##STR00002##
(68) In a fashion analogous to Schemes 1A and 1B, nucleotide analogs of the type NTP-linker-inhibitor can also be formed by attaching the linker-inhibitor moiety to the N6 of adenine (
(69) The invention is not limited to the linking chemistry of Schemes 1A and 1B, however, as carbamate, amide, or other self-eliminating linkages could also be employed. For example, nucleotides can also be prepared with Staudinger linkers, as shown in Scheme 2:
(70) ##STR00003##
(71) A deoxycytidine triphosphate (dCTP) analog created with a Staudinger linker (Scheme 2) to an Asp-Asp blocking group is shown in
(72) The methodologies of Scheme 1A can be used to produce corresponding ribonucleotide analogs, e.g., as shown in
(73) In other embodiments, a 3-O-blocked nucleotide analog can be used along with a modified enzyme capable of incorporating 3-O-blocked nucleotide analogs into an oligonucleotide. Such modified enzymes will allow 3-O-blocked dNTP analogs to be used in a step-by-step method to extend an initiating nucleic acid into a user defined sequence (see
(74) A variety of 3-O-modified dNTPs and NTPs may be used with the disclosed proteins for de novo synthesis. In some embodiments, the preferred removable 3-O-blocking group is a 3-O-amino, a 3-O-allyl or a 3-O-azidomethyl. In other embodiments, the removable 3-O-blocking moiety is selected from the group consisting of O-phenoxyacetyl; O-methoxyacetyl; O-acetyl; O-(p-toluene)-sulfonate; O-phosphate; O-nitrate; O-[4-methoxy]-tetrahydrothiopyranyl; O-tetrahydrothiopyranyl; O-[5-methyl]-tetrahydrofuranyl; O-[2-methyl,4-methoxy]-tetrahydropyranyl; O-[5-methyl]-tetrahydropyranyl; and O-tetrahydrothiofuranyl (see U.S. Pat. No. 8,133,669). In other embodiments the removable blocking moiety is selected from the group consisting of esters, ethers, carbonitriles, phosphates, carbonates, carbamates, hydroxylamine, borates, nitrates, sugars, phosphoramide, phosphoramidates, phenylsulfenates, sulfates, sulfones and amino acids (see Metzker ML et al. Nuc Acids Res. 1994; 22 (20): 4259-67, U.S.P.N. 6,232,465; U.S.P.N. 7,414,116; and U.S.P.N. 7,279,563, all of which are incorporated by reference in their entireties).
(75)
Enzymes
(76) The methods of the invention employ nucleotidyl transferases to assemble the nucleotide analogs into polynucleotides. Nucleotidyl transferases include several families of related transferase and polymerase enzymes. Some nucleotidyl transferases polymerize deoxyribonucleotides more efficiently than ribonucleotides, some nucleotidyl transferases polymerize ribonucleotides more efficiently than deoxyribonucleotides, and some nucleotidyl transferases polymerize ribonucleotides and deoxyribonucleotides at approximately the same rate.
(77) Of particular import to the invention, transferases having polymerase activity, such as terminal deoxynucleotidyl transferase (TdT), are capable of catalyzing the addition of deoxyribonucleotides to the 3 end of a nucleotide chain, thereby increasing chain length in DNA nucleotides. TdT will only catalyze the addition of 1-2 ribonucleotides to the growing end of a DNA strand which could be useful in the construction of site specific DNA-RNA chimeric polynucleotides. In particular, calf thymus TdT, sourced from engineered E. coli, is suitable for use with the invention and available from commercial sources such as Thermo Scientific (Pittsburgh, PA). The amino acid sequence corresponding to calf TdT is listed in Table 1 as SEQ ID NO. 1.
(78) TABLE-US-00001 TABLE1 AminoAcidSeauenceofBovineTdT SEQIDNO.1: MAQQRQHQRLPMDPLCTASSGPRKKRPRQVGASMASPPHD IKFQNLVLFILEKKMGTTRRNFLMELARRKGFRVENELSD SVTHIVAENNSGSEVLEWLQVQNIRASSQLELLDVSWLIE SMGAGKPVEITGKHQLVVRTDYSATPNPGFQKTPPLAVKK ISQYACQRKTTLNNYNHIFTDAFEILAENSEFKENEVSYV TFMRAASVLKSLPFTIISMKDTEGIPCLGDKVKCIIEEII EDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRM GFRSLSKIMSDKTLKFTKMQKAGFLYYEDLVSCVTRAEAE AVGVLVKEAVWAFLPDAFVTMTGGFRRGKKIGHDVDFLIT SPGSAEDEEQLLPKVINLWEKKGLLLYYDLVESTFEKFKL PSRQVDTLDHFQKCFLILKLHHQRVDSSKSNQQEGKTWKA IRVDLVMCPYENRAFALLGWTGSRQFERDIRRYATHERKM MLDNHALYDKTKRVFLKAESEEEIFAHLGLDYIEPWERNA
(79) The nucleotide sequence corresponding to calf TdT is listed in Table 2 as SEQ ID NO. 2.
(80) TABLE-US-00002 TABLE2 NucleicAcidSequenceofBovineTdT SEQIDNO.2: ctcttctggagataccacttgatggcacagcagaggcagc atcagcgtcttcccatggatccgctgtgcacagcctcctc aggccctcggaagaagagacccaggcaggtgggtgcctca atggcctcccctcctcatgacatcaagtttcaaaatttgg tcctcttcattttggagaagaaaatgggaaccacccgcag aaacttcctcatggagctggctcgaaggaaaggtttcagg gttgaaaatgagctcagtgattctgtcacccacattgtag cagaaaacaactctggttcagaggttctcgagtggcttca ggtacagaacataagagccagctcgcagctagaactcctt gatgtctcctggctgatcgaaagtatgggagcaggaaaac cagtggagattacaggaaaacaccagcttgttgtgagaac agactattcagctaccccaaacccaggcttccagaagact ccaccacttgctgtaaaaaagatctcccagtacgcgtgtc aaagaaaaaccactttgaacaactataaccacatattcac ggatgcctttgagatactggctgaaaattctgagtttaaa gaaaatgaagtctcttatgtgacatttatgagagcagctt ctgtacttaaatctctgccattcacaatcatcagtatgaa ggatacagaaggaattccctgcctgggggacaaggtgaag tgtatcatagaggaaattattgaagatggagaaagttctg aagttaaagctgtgttaaatgatgaacgatatcagtcctt caaactctttacttctgtttttggagtgggactgaagaca tctgagaaatggttcaggatggggttcagatctctgagta aaataatgtcagacaaaaccctgaaattcacaaaaatgca gaaagcaggatttctctattatgaagaccttgtcagctgc gtgaccagggccgaagcagaggcggttggcgtgctggtta aagaggctgtgtgggcatttctgccggatgcctttgtcac catgacaggaggattccgcaggggtaagaagattgggcat gatgtagattttttaattaccagcccaggatcagcagagg atgaagagcaacttttgcctaaagtgataaacttatggga aaaaaagggattacttttatattatgaccttgtggagtca acatttgaaaagttcaagttgccaagcaggcaggtggata ctttagatcattttcaaaaatgctttctgattttaaaatt gcaccatcagagagtagacagtagcaagtccaaccagcag gaaggaaagacctggaaggccatccgtgtggacctggtta tgtgcccctacgagaaccgtgcctttgccctgctaggctg gactggctcccggcagtttgagagagacatccggcgctat gccacacacgagcggaagatgatgctggataaccacgctt tatatgacaagaccaagagggtatttctcaaagcggaaag tgaagaagaaatctttgcacatctgggattggactacatt gaaccatgggaaagaaatgcttaggagaaagctgtcaact tttttcttttctgttctttttttcaggttagacaaattat gcttcatattataatgaaagatgccttagtcaagtttggg attctttacattttaccaagatgtagattgcttctagaaa taagtagttttggaaacgtgatcaggcaccccctgggtta tgctctggcaagccatttgcaggactgatgtgtagaactc gcaatgcattttccatagaaacagtgttggaattggtggc tcatttccagggaagttcatcaaagcccactttgcccaca gtgtagctgaaatactgtatacttgccaataaaaatagga aac
(81) While commercially-available TdT is suitable for use with the methods of the invention, modified TdT, e.g., having an amino acid sequence at least 95% in common with SEQ ID NO. 1, e.g., having an amino acid sequence at least 98% in common with SEQ ID NO. 1, e.g., having an amino acid sequence at least 99% in common with SEQ ID NO. 1, may be used with the methods of the invention. An organism that expresses a suitable nucleotidyl transferase may comprise a nucleic acid sequence at least 95% in common with SEQ ID NO. 2, e.g., at least 98% in common with SEQ ID NO. 2, e.g., at least 99% in common with SEQ ID NO. 2. In some instances, a modified TdT will result in more efficient generation of polynucleotides, or allow better control of chain length. Other modifications to the TdT may change the release characteristics of the enzyme, thereby reducing the need for aqueous reducing agents such as TCEP or DTT.
(82) For the synthesis of RNA polynucleotides, a nucleotidyl transferase like E. coli poly(A) polymerase can be used to catalyze the addition of ribonucleotides to the 3 end of a ribonucleotide initiator. In other embodiments, E. coli poly(U) polymerase may be more suitable for use with the methods of the invention. Both E. coli poly(A) polymerase and E. coli poly(U) polymerase are available from New England Biolabs (Ipswich, MA). These enzymes may be used with 3unblocked reversible terminator ribonuclotide triphosphates (rNTPs) to synthesize RNA. In certain embodiments, RNA may be synthesized using 3blocked, 2blocked, or 2-3blocked rNTPs and poly(U) polymerase or poly(A) polymerase. The amino acid and nucleotide sequences for E. coli Poly(A) polymerase and E. coli Poly(U) polymerase are reproduced below. Modified E. coli Poly(A) polymerase or E. coli Poly(U) polymerase may be suitable for use with the methods of the invention. For example, an enzyme, having an amino acid sequence at least 95% in common with SEQ ID NO. 3, e.g., having an amino acid sequence at least 98% in common with SEQ ID NO. 3, e.g., having an amino acid sequence at least 99% in common with SEQ ID NO. 3, may be used with the methods of the invention. An organism that expresses a suitable enzyme may comprise a nucleic acid sequence at least 95% in common with SEQ ID NO. 4, e.g., at least 98% in common with SEQ ID NO. 4, e.g., at least 99% in common with SEQ ID NO. 4. Alternatively, an enzyme having an amino acid sequence at least 95% in common with SEQ ID NO. 5, e.g., having an amino acid sequence at least 98% in common with SEQ ID NO. 5, e.g., having an amino acid sequence at least 99% in common with SEQ ID NO. 5, may be used with the methods of the invention. An organism that expresses a suitable enzyme may comprise a nucleic acid sequence at least 95% in common with SEQ ID NO. 6, e.g., at least 98% in common with SEQ ID NO. 6, e.g., at least 99% in common with SEQ ID NO. 6.
(83) TABLE-US-00003 TABLE3 AminoAcidSequenceofE.coliPolv(A) polymerase SEQIDNO.3: MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAIS RKDISENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKD FDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEV ATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQR RDFTINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPET RYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLND IPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTIT RYFTENGDSPMERIIEQVLKNTDTRIHNDMRVNPAFLFAA MFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSL AIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAA YDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNE LDEEPSPRRRTRRPRKRAPRREGTA
(84) The nucleotide sequence corresponding to E. coli poly(A) polymerase is listed in Table 4 as SEQ ID NO. 4.
(85) TABLE-US-00004 TABLE4 NucleotideSequenceofE.coli Polv(A)polymerase SEQIDNO.4: atttttacccgagtcgctaatttttgccgcaaggtgctaa gccgcgaggaaagcgaggctgaacaggcagtcgcccgtcc acaggtgacggtgatcccgcgtgagcagcatgctatttcc cgcaaagatatcagtgaaaatgccctgaaggtaatgtaca ggctcaataaagcgggatacgaagcctggctggttggcgg cggcgtgcgcgacctgttacttggcaaaaagccgaaagat tttgacgtaaccactaacgccacgcctgagcaggtgcgca aactgttccgtaactgccgcctggtgggtcgccgtttccg tctggctcatgtaatgtttggcccggagattatcgaagtt gcgaccttccgtggacaccacgaaggtaacgtcagcgacc gcacgacctcccaacgcgggcaaaacggcatgttgctgcg cgacaacattttcggctccatcgaagaagacgcccagcgc cgcgatttcactatcaacagcctgtattacagcgtagcgg attttaccgtccgtgattacgttggcggcatgaaggatct gaaggacggcgttatccgtctgattggtaacccggaaacg cgctaccgtgaagatccggtacgtatgctgcgcgcggtac gttttgccgccaaattgggtatgcgcatcagcccggaaac cgcagaaccgatccctcgcctcgctaccctgctgaacgat atcccaccggcacgcctgtttgaagaatcgcttaaactgc tacaagcgggctacggttacgaaacctataagctgttgtg tgaatatcatctgttccagccgctgttcccgaccattacc cgctacttcacggaaaatggcgacagcccgatggagcgga tcattgaacaggtgctgaagaataccgatacgcgtatcca taacgatatgcgcgtgaacccggcgttcctgtttgccgcc atgttctggtacccactgctggagacggcacagaagatcg cccaggaaagcggcctgacctatcacgacgctttcgcgct ggcgatgaacgacgtgctggacgaagcctgccgttcactg gcaatcccgaaacgtctgacgacattaacccgcgatatct ggcagttgcagttgcgtatgtcccgtcgtcagggtaaacg cgcatggaaactgctggagcatcctaagttccgtgcggct tatgacctgttggccttgcgagctgaagttgagcgtaacg ctgaactgcagcgtctggtgaaatggtggggtgagttcca ggtttccgcgccaccagaccaaaaagggatgctcaacgag ctggatgaagaaccgtcaccgcgtcgtcgtactcgtcgtc cacgcaaacgcgcaccacgtcgtgagggtaccgcatga
(86) TABLE-US-00005 TABLE5 AminoAcidSequenceofE.coliPolv(U) polymerase SEQIDNO.5: GSHMSYQKVPNSHKEFTKFCYEVYNEIKISDKEFKEKRAA LDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLM DSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSD TKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPM VLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKP PVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSL GSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTS ATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLY RIRGEFMAASRLLNSRSYPIPYDSLFEEA
(87) The nucleotide sequence corresponding to E. coli poly(U) polymerase is listed in Table 6 as SEQ ID NO. 6.
(88) TABLE-US-00006 TABLE6 NucleotideSequenceofE.coli Polv(A)polymerase SEQIDNO.6: ggcagccatatgagctatcagaaagtgccgaacagccata aagaatttaccaaattttgctatgaagtgtataacgaaat taaaattagcgataaagaatttaaagaaaaacgcgcggcg ctggataccctgcgcctgtgcctgaaacgcattagcccgg atgcggaactggtggcgtttggcagcctggaaagcggcct ggcgctgaaaaacagcgatatggatctgtgcgtgctgatg gatagccgcgtgcagagcgataccattgcgctgcagtttt atgaagaactgattgcggaaggctttgaaggcaaatttct gcagcgcgcgcgcattccgattattaaactgaccagcgat accaaaaacggctttggcgcgagctttcagtgcgatattg gctttaacaaccgcctggcgattcataacaccctgctgct gagcagctataccaaactggatgcgcgcctgaaaccgatg gtgctgctggtgaaacattgggcgaaacgcaaacagatta acagcccgtattttggcaccctgagcagctatggctatgt gctgatggtgctgtattatctgattcatgtgattaaaccg ccggtgtttccgaacctgctgctgagcccgctgaaacagg aaaaaattgtggatggctttgatgtgggctttgatgataa actggaagatattccgccgagccagaactatagcagcctg ggcagcctgctgcatggcttttttcgcttttatgcgtata aatttgaaccgcgcgaaaaagtggtgacctttcgccgccc ggatggctatctgaccaaacaggaaaaaggctggaccagc gcgaccgaacataccggcagcgcggatcagattattaaag atcgctatattctggcgattgaagatccgtttgaaattag ccataacgtgggccgcaccgtgagcagcagcggcctgtat cgcattcgcggcgaatttatggcggcgagccgcctgctga acagccgcagctatccgattccgtatgatagcctgtttga agaagcg
(89) As discussed above, the inhibitor coupled to the nucleotide analog will cause the transferase, e.g., TdT, to not release from the polynucleotide or prevent other analogs from being incorporated into the growing chain. A charged moiety results in better inhibition, however, research suggests that the specific chemical nature of the inhibitor is not particularly important. For example, both phosphates and acidic peptides can be used to inhibit enzymatic activity. See, e.g., Bowers et al., Nature Methods, vol. 6, (2009) p. 593-95, and U.S. Pat. No. 8,071,755, both of which are incorporated herein by reference in their entireties. In some embodiments, the inhibitor will include single amino acids or dipeptides, like-(Asp).sub.2, however the size and charge on the moiety can be adjusted, as needed, based upon experimentally determined rates of first nucleotide incorporation and second nucleotide incorporation. That is, other embodiments may use more or different charged amino acids or other biocompatible charged molecule.
(90) Other methods of nucleotide synthesis may be used to build de novo oligonucleotides in a template independent fashion using nucleotidyl transferases or modified nucleotidyl transferases. In one embodiment, the polymerase/transferase enzymes can be modified so that they cease nucleotide addition when they encounter a modification to the phosphate of a 3-unmodified dNTP analog. This scheme would require a deblocking reagent/reaction that modifies the phosphate end of the nucleotide analog, which frees up the nascent strand for subsequent nucleotide incorporation. Preferred embodiments of this approach would use nucleotide analogs modified only at the phosphates (alpha, beta or gamma) although modifications of the purine/pyrimidine base of the nucleotide are allowed.
(91) In some embodiments, it may be advantageous to use a 3 exonuclease to remove oligonucleotides that have not been properly terminated with an inhibitor prior to subsequent nucleotide analog addition. In particular, the inhibitor of the nucleotide analog can be chosen to inhibit the activity of nucleotidyl transferase and 3 exonucleases, such that only properly terminated oligonucleotides would be built up. Using this quality control technique, the purity of the resulting oligonucleotide sequences would be improved. In some embodiments, use of such quality control measures can negate the need for post-synthesis purification. This technique is represented schematically in
(92) Another embodiment for using non-template dependent polymerase/transferase enzymes would be to using protein engineering or protein evolution to modify the enzyme to remain tightly bound and inactive to the nascent strand after each single nucleotide incorporation, thus preventing any subsequent incorporation until such time as the polymerase/transferase is released from the strand by use of a releasing reagent/condition. Such modifications would be selected to allow the use of natural unmodified dNTPs instead of reversible terminator dNTPs. Releasing reagents could be high salt buffers, denaturants, etc. Releasing conditions could be high temperature, agitation, etc. For instance, mutations to the Loop1 and SDI regions of TdT have been shown to dramatically alter the activity from a template-independent activity to more of a template dependent activity. Specific mutations of interest include but are not limited to 43384/391/392, del loop1 (386.fwdarw.398), L398A, D339A, F401A, and Q402K403C404.fwdarw.E402R403S404. Other means of accomplishing the goal of a post-incorporation tight binding (i.e., single turnover) TdT enzyme could include mutations to the residues responsible for binding the three phosphates of the initiator strand including but not limited to K261, R432, and R454.
(93) Another embodiment for using non-template dependent polymerase/transferase enzymes is to use protein engineering or protein evolution to modify the enzyme to accept 3-blocked reversible terminators with high efficiency. Naturally occurring polymerase/transferase enzymes will not incorporate 3-blocked reversible terminators due to steric constraints in the active site of the enzyme. Modifying either single or several amino acids in the active site of the enzyme can allow the highly-efficient incorporation of 3-blocked reversible terminators into a support bound initiator in a process completely analogous to that described above. After incorporation, the 3-reversible terminator is removed with a deblocking reagent/condition thus generating a completely natural (scarless) single strand molecule ready for subsequent controlled extension reactions. The enzyme contains amino acids close to the 3-OH of the incoming dNTP which explains the propensity of TdT for incorporating ribonucleotide triphosphates as readily as deoxyribonucleotide triphosphates; amino acids including but not limited to those between 1 and 2 especially R334, Loop1, and those between 13 and 14, especially R454, are likely targets for mutagenesis to accommodate the bulk of 3-reversible terminator groups and allow their efficient incorporation. In certain embodiments additional amino acid changes may be required to compensate for alterations made in order to accommodate a 3-reversible terminator. Another embodiment for using template-dependent polymerases is to use the either 3blocked or 3unblocked dNTP analogs with a plurality of primer-template pairs attached to a solid support where the template is a nucleic acid analog that supports polymerase mediated primer extension of any of the four bases as specified by the user.
(94) In some embodiments, an engineered TdT is used to achieve stepwise synthesis with 3-O-blocked nucleotide analogs. It is possible to model the active site of the TdT protein using Auto Dock (Molecular Graphics Laboratory, Scripps Research Institute, La Jolla, CA). Based upon this calculation, it is predicted that modified TdTs, having changes at Arg336 and Arg454 may have enzymatic activity against 3-O-blocked nucleotide analogs. It is thought that Gly452 and Ser453 exist in a cis-peptide bond conformation (see Delarue et al., EMBO J., 2002; 21 (3): 427-39, incorporated herein by reference in its entirety) and that the guanidinium group of Arg336 assists in the stabilization of this conformation. The stability provided by Arg336 may help explain why substitutions at this position have a negative impact on the reactivity of modified TdT proteins. In some instances, the instability created by modifying position 336 may be overcome by using proline to stabilize cis-peptide bond conformation. However, if Arg336 is substituted, e.g., with alanine or glycine, the entire TGSR motif (positions 451, 452, 435, 454) may also have to be modified to compensate for this change. For example, the TGSR motif may be modified to TPSR or TGPR. In another embodiment, substitutions at Arg454 to accommodate the steric bulk of a 3-O-blocking group may require additional modifications to the 14 region to compensate for substitutions of glycine or alanine at Arg454. In other embodiments, substitutions for other amino acids in the all region may be required to compensate for substitution to Arg336 either instead of, or in addition to, modification of the GSR motif.
(95) While modification to Arg336 and Arg454 may change the binding interactions of 3-O-modified dNTPs, it may also be necessary to explore substitutions that would result in improved steric interactions of 3-O-modified dNTPs with TdT. Such steric modifications can also be explored computationally. Residues Gly332, Gly333, Gly452, Thr451 and Ser453 are also potential targets for substitution to allow the extra steric bulk of a 3-blocking group like 3-O-azidomethyl or 3-O-allyl. Residues that are within 1.2 nm of the 3-OH such as Glu457, Ala510, Asp509, Arg508, Lys199, Ser196 Met192, or Leu161 may also potentially interfere with the substrate utilization of a 3-O-blocked dNTP and are thus targets for substitution in addition to or in combination with Arg336 and Arg454. In addition to amino acid substitutions at positions 508, 509 and 510, it may be necessary to delete amino acids in order to remove interference with a 3-O-blocking group. Since those amino acids are located near the C-terminus of the protein, and exist in a relatively unstructured region, they may be deleted singly or altogether, either instead of or in combination with the modifications described above.
(96) Another embodiment for using non-template dependent polymerase/transferase enzymes can use protein engineering or protein evolution to modify the enzyme to optimize the use of each of the four different nucleotides or even different modified nucleotide analogs in an analog specific manner. Nucleotide specific or nucleotide analog specific enzyme variants could be engineered to possess desirable biochemical attributes like reduced K.sub.m or enhanced addition rate which would further reduce the cost of the synthesis of desired polynucleotides.
Solid State Synthesis
(97) The methods of the invention can be practiced under a variety of reaction conditions, however the orderly construction and recovery of desired polynucleotides will, in most cases, require a solid support on which the polynucleotides can be extended. When used in conjunction with the NTP, linker, and inhibitor analogs discussed above, it is possible to construct specific polynucleotide sequences of DNA, as well as RNA, by using, for example, TdT or poly(A) polymerase in an aqueous environment. As shown in
(98) In certain embodiments, an additional quality control step may be incorporated in which the oligonucleotide or polynucleotide is exposed to 3 exonuclease after the nucleotidyl transferase-mediated nucleotide analog extension step and before inhibitor cleavage. A 3 exonuclease degrades oligonucleotide or polynucleotide strands with an unblocked 3 OH. An uncleaved inhibitor (e.g., a steric inhibitor) may physically block the 3 exonuclease from degrading a strand to which an uncleaved nucleotide analog has been successfully incorporated. Such a quality control step degrades only the oligonucleotides or polynucleotides that have unsuccessfully incorporated the desired nucleotide analog in the prior addition step, thereby eliminating any errors in the finished synthesized sequence. After 3 exonuclease exposure, the enzyme may be washed away before carrying on with the inhibitor cleavage step.
(99) The 3 exonuclease acts by shortening or completely degrading strands that have not successfully added the desired nucleotide analog. Strands that fail to be enzymatically extended at a given cycle will not have a terminal macromolecule-dNMP conjugate prior to the linker cleavage step. If a 3-exonuclease is introduced at this stage, the full length strand could be protected from degradation while failure strands will be shorted in length or potentially degraded completely to mononucleotide phosphates. The yield of long (>500 bases) synthetic DNA is dependent on highly efficient reactions occurring at each and every cycle; both the enzymatic extension and the deblocking/self-elimination steps must occur at near quantitative yields. The introduction of a 3-exonuclease after the enzymatic extension step but before the macromolecule terminator cleavage step has a positive impact on the nascent strand purity if the extension efficiency is low (i.e., there are strands that are not extended and therefore possess a natural unmodified terminal nucleotide).
(100) Conversely, a 3-exonuclease step would have no impact on the quality of the synthesis if the deblocking/elimination step is less than quantitative because those strands would still be protected by the macromolecule terminator and fail to extend during the next extension step. Thus the actual improvement of the quality of the synthesis with the addition of a 3-exonuclease step can only be experimentally determined and then an assessment made if it is worth the additional cost and cycle time.
(101) At the conclusion of n cycles of extension-remove-deblocking-wash, the finished full-length, single-strand polynucleotide is complete and is cleaved from the solid support and recovered for subsequent use in applications such as DNA sequencing or PCR. Alternatively, the finished, full-length, single-strand polynucleotide can remain attached to the solid support for subsequent use in applications such as hybridization analysis, protein or DNA affinity capture. In other embodiments, partially double-stranded DNA can be used as an initiator, resulting in the synthesis of double-stranded polynucleotides.
(102) In some embodiments, a nucleic acid initiator will include a 3 moiety that will release the synthesized oligonucleotide when in the presence of a releasing agent. This feature is illustrated, generally, in
(103) In an embodiment, the initiator is a nucleic acid hexamer and the 3 moiety is a ribonucleotide, such as adenosine. Once the oligonucleotide synthesis is complete, e.g., using nucleotides comprising a cleavable terminator linked at the N-4 position, or nucleotides having a 3-O-blocked position, the oligonucleotide can be released by exposing the bound oligonucleotide to an ammonium hydroxide solution of a pH around 8. The basic solution containing the synthesized oligonucleotides can then be separated from the solid substrate comprising the hexamer initiator. The solid substrate is then washed and/or neutralized to prepare the initiator and 3 moiety for fabrication of a new oligonucleotide. In some embodiments, the terminal ribonucleotide is regenerated prior to oligonucleotide synthesis with the use of a phosphatase or the 3 phosphatase activity of T4 polynucleotide kinase.
(104) In some embodiments, the solid support and nucleic acid initiator including the 3 moiety will be reusable, thereby allowing the initiator coupled to the solid support to be used again and again for the rapid synthesis of oligonucleotides. Solid supports suitable for use with the methods of the invention may include glass and silica supports, including beads, slides, pegs, or wells. In some embodiments, the support may be tethered to another structure, such as a polymer well plate or pipette tip. In some embodiments, the solid support may have additional magnetic properties, thus allowing the support to be manipulated or removed from a location using magnets. In other embodiments, the solid support may be a silica coated polymer, thereby allowing the formation of a variety of structural shapes that lend themselves to automated processing.
(105) The selection of substrate material and covalent linkage chemistry between initiator and substrate is limited only by the ability of the construct to withstand the synthesis conditions without loss of initiator. Preferred embodiments utilize substrates and linkers of greater chemical stability than the initiator so that the overall construct stability is that of the attached oligonucleotide and not dependent on the substrate. In some embodiments, initiators may be synthesized in a 5 to 3-direction from a material presenting surface hydroxyl groups, though in preferred embodiments the initiator is instead grafted to the substrate so that density and initiator quality can be precisely controlled.
(106) The covalent linkage between the initiator and the substrate may be any bond which does not compromise the stability of the construct. Preferred embodiments may utilize couplings between oligonucleotides containing either 5-amine, 5-hydroxyl, 5-phosphate, 5-sulfhydryl, or 5-benzaldehyde groups and surfaces or resins containing formyl, chloromethyl, epoxide, amine, thiol, alkene, or terminal C-F bonds on the substrate.
(107) In some embodiments, the initiator may contain elements for sequence-specific cleavage strategies, such as those utilizing restriction enzymes, uracil specific excision reagent (USER), or any variety of sequence-specific nuclease. In other embodiments, these elements may instead be enzymatically synthesized or added to the initiator after it has been coupled to a resin. Such a scenario may be preferred when, for example, the initiator is comprised of entirely thymidine in order to minimize potential side reactions with surface functional groups during the coupling process.
(108)
(109)
(110)
(111) After cleavage of the synthesized sequence, the resin may then be used in another cycle of cleavage site installation, synthesis, product removal, and regeneration.
(112) In other embodiments, the cleavage site installation may be used to homogenize the enzymatic accessibility of the initiator oligonucleotides. Each enzyme used during the enzymatic synthesis cycle has its own steric footprint with potentially distinct optimal loadings and spacing from the surface. This can produce unexpected behavior in regard to the kinetics of stepwise addition and yield from the enzymatic cleavage process. In some embodiments, repeated cycles of cleavage site installation, cleavage, and regeneration may be conducted prior to the oligonucleotide synthesis so that the cleavage enzyme and the template-independent polymerase are accessing the same population of surface oligonucleotides.
(113) Some embodiments may install multiple different cleavage sites throughout a strand during synthesis. Upon digestion, a complex library of the strands located between the cleavage sites may be released from the resin. Such sequences can then be further amplified and used for enzymatic assembly processes by a skilled artisan. This approach may be uniquely suited to parallel synthesis schemes in order to produce greater varieties of sequence fragments with relatively few distinct locations on a surface, or to avoid the synthesis of contiguous strands which risk secondary structure formation during synthesis.
(114) In other embodiments, cleavage site installation may be used immediately after each cycle of enzymatic extension to assist in the removal of unreacted initiator sequences, analogous to the acetylation used in phosphoramidite-based oligonucleotide synthesis. Strands which are unextended during the addition cycle act as substrates for a poly-U tract, while extended initiators bearing a chain terminator do not. At the end of the synthesis cycle, a single USER digestion is conducted so that the oligonucleotides are released from the support, and sequences containing failed additions are simultaneously digested to a shorter length than the full-sized product. Failure sequences are also alike in that they are now phosphorylated at their 3-ends, rendering them unreactive to further enzymatic extension. The full-length sequences may then undergo extension to append any element which will enable selective capture, isolation, or enrichment. Such elements may either be additional homopolymer tracts, such as further poly-U tracts, which can be isolated by hybridization-based approaches and subsequently digested, or biotinylated elements for non-covalent capture. This approach compensates for the lack of suitable chromatographic techniques suitable for long (150 nt+oligonucleotides), low sample quantities, or complex mixtures of sequences of varied lengths.
(115) Further embodiments may employ cleavage site installations to assist in the recycling of highly-indexed DNA-based data recording media. An example is shown in
Synthesizers
(116) To capitalize on the efficiency of the disclosed methods, an aqueous phase DNA synthesizer can be constructed to produce desired polynucleotides in substantial quantities. In one embodiment, a synthesizer will include four wells of the described NTP analog reagents, i.e., dCTP, dATP, dGTP, and dTTP, as well as TdT at concentrations sufficient to effect polynucleotide growth. A plurality of initiating sequences can be attached to a solid support that is designed to be repeatedly dipped into each of the four wells, e.g., using a laboratory robot. The robot could be additionally programmed to rinse the solid support in wash buffer between nucleotide additions, cleave the linking group by exposing the support to a deblocking agent, and wash the solid support a second time prior to moving the solid support to the well of the next desired nucleotide. With simple programming, it is possible to create useful amounts of desired nucleotide sequences in a matter of hours, and with substantial reductions hazardous waste. Ongoing synthesis under carefully controlled conditions will allow the synthesis of polynucleotides with lengths in the thousands of base pairs. Upon completion, the extension products are released from the solid support, whereupon they can be used as finished nucleotide sequences.
(117) A highly parallel embodiment could consist of a series of initiator-solid supports on pegs in either 96 or 384 well formats that could be individually retracted or lowered so that the pegs can be indexed to contact the liquids in the wells in a controlled fashion. The synthesizer could thus consist of the randomly addressable peg device, four enzyme-dNTP analog reservoirs in the same format as the peg device (96 or 384 spacing), additional reagent reservoirs (washing, deblocking, etc.) in the same format as the peg device (96 or 384 spacing), and a transport mechanism (e.g., a laboratory robot) for moving the peg device from one reservoir to another in a user programmable controlled but random access fashion. Care must be taken to avoid contaminating each of the four enzyme-dNTP reservoirs since the contents arc reused throughout the entire synthesis process to reduce the cost of each polynucleotide synthesis.
(118) In alternative embodiments, the reagents (e.g., nucleotide analogs, enzymes, buffers) will be moved between solid supports, allowing the reagents to be recycled. For example a system of reservoirs and pumps can move four different nucleotide analog solutions, wash buffers, and/or reducing agent solutions between one or more reactors in which the oligonucleotides will be formed. The reactors and pumps can be conventional, or the devices may be constructed using microfluidics. Because of the non-anhydrous (aqueous) nature of the process, no special care needs to be taken in the design of the hardware used to eliminate exposure to water. The synthesis process can take place with only precautions to control evaporative loss. A highly parallel embodiment could consist of a monolithic series of initiator-solid supports on pegs in either 96 or 384 well format that can be interfaced to a series of wells in the same matching format. Each well would actually be a reaction chamber that is fed by four enzyme-dNTP analog reservoirs and additional reagent reservoirs (washing, deblocking, etc.) with appropriate valves. Provisions would be made in the fluidics logic to recover the enzyme-dNTP reactants in a pristine fashion after each extension reaction since they are reused throughout the entire synthesis process to reduce the cost of each polynucleotide synthesis. In other embodiments, a system of pipetting tips could be used to add and remove reagents.
(119) In certain aspects, polynucleotides may be synthesized using microfluidic devices and/or inkjet printing technology. An exemplary microfluidic polynucleotide synthesis device is shown in
(120) In certain instances, reagents may be recycled, particularly the NTP analog-enzyme reagents. Reagents may be drawn back into their respective reservoirs 253 from the reaction chamber 251 via the same channels 255 through which they entered by inducing reverse flow using gates, valves, pressure regulators or other means. Alternatively, reagents may be returned from the reaction chamber 251 to their respective reservoirs 253 via independent return channels. The microfluidic device may include a controller capable of operating the gates, valves, pressure, or other regulators 257 described above.
(121) An exemplary microfluidic polynucleotide synthesis reaction may include flowing a desired enzyme-NTP analog reagent into the reaction chamber 251; after a set amount of time, removing the enzyme-NTP analog reagent from the reaction chamber 251 via an outlet channel 259 or a return channel; flowing a wash reagent into the reaction chamber 251; removing the wash reagent from the reaction chamber 251 through an outlet channel 259; flowing a de-blocking or cleavage reagent into the reaction chamber 251; removing the de-blocking or cleavage reagent from the reaction chamber 251 via an outlet channel 259 or a return channel; flowing a wash reagent into the reaction chamber 251; removing the wash reagent from the reaction chamber 251 through an outlet channel 259; flowing the enzyme-NTP analog reagent including the next NTP in the desired sequence to be synthesized into the reaction chamber 251; and repeating until the desired polynucleotide has been synthesized. After the desired polynucleotide has been synthesized, it may be released from the reaction chamber anchor or substrate and collected via an outlet channel 259 or other means.
(122) In certain aspects, reagents and compounds, including NTP analogs, TdT and/or other enzymes, and reagents for linker/inhibitor cleavage and/or washing may be deposited into a reaction chamber using inkjet printing technology or piezoelectric drop-on-demand (DOD) inkjet printing technology. Inkjet printing technology can be used to form droplets, which can be deposited, through the air, into a reaction chamber. Reagent droplets may have volumes in the picoliter to nanoliter scale. Droplets may be introduced using inkjet printing technology at a variety of frequencies including 1 Hz, 10, Hz, 100 Hz, 1 kHz, 2 kHz, and 2.5 kHz. Various reagents may be stored in separate reservoirs within the inkjet printing device and the inkjet printing device may deliver droplets of various reagents to various discrete locations including, for example, different reaction chambers or wells within a chip. In certain embodiments, inkjet and microfluidic technologies may be combined wherein certain reagents and compounds are delivered to the reaction chamber via inkjet printing technology while others are delivered via microfluidic channels or tubes. An inkjet printing device may be controlled by a computing device comprising at least a non-transitory, tangible memory coupled to a processor. The computing device may be operable to receive input from an input device including, for example, a touch screen, mouse, or keyboard and to control when and where the inkjet printing device deposits a droplet of reagent, the reagent it deposits, and/or the amount of reagent deposited.
(123) In certain instances, a desired polynucleotide sequence may be entered into the computing device through an input device wherein the computing device is operable to perform the necessary reactions to produce the desired polynucleotide sequence by sequentially depositing the appropriate NTP analog, enzyme, cleavage reagent, and washing reagent, in the appropriate order as described above.
(124) After synthesis, the released extension products can to be analyzed by high resolution PAGE to determine if the initiators have been extended by the anticipated number of bases compared to controls. A portion of the recovered synthetic DNA may also be sequenced to determine if the synthesized polynucleotides are of the anticipated sequence.
(125) Because the synthesizers are relatively simple and do not require the toxic components needed for phosphoramidite synthesis, synthesizers of the invention will be widely accessible for research institutions, biotechnology companies, and hospitals. Additionally, the ability to reuse/recycle reagents will reduce the waste produced and help reduce the costs of consumables. The inventors anticipate that the methods and systems will be useful in a number of applications, such as DNA sequencing, PCR, and synthetic biology.
INCORPORATION BY REFERENCE
(126) References and citations to other documents, such as patents, patent applications, patent publications, journals, books, papers, web contents, have been made throughout this disclosure. All such documents are hereby incorporated herein by reference in their entirety for all purposes.
EQUIVALENTS
(127) Various modifications of the invention and many further embodiments thereof, in addition to those shown and described herein, will become apparent to those skilled in the art from the full contents of this document, including references to the scientific and patent literature cited herein. The subject matter herein contains important information, exemplification and guidance that can be adapted to the practice of this invention in its various embodiments and equivalents thereof.