Synthetic combinatorial AAV3 capsid library
12188037 ยท 2025-01-07
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2750/14122
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
Abstract
Compositions and methods for producing modified AAV Cap genes and combinatorial libraries of chimeric AAV vectors and virions in an AAV serotype 3 background. Selecting for modified AAV3 virions displaying cell- or tissue-specific tropisms differing from WT AAV3. Using the synthetic combinatorial AAV3 capsid libraries for introducing into a selected target host cells one or more nucleic acid molecules useful in diagnostic and/or therapeutic gene-therapy regimens.
Claims
1. A non-naturally occurring nucleic acid molecule comprising: (a) a first nucleic acid sequence encoding at least one AAV Rep protein from serotype 3; and (b) a second nucleic acid sequence encoding an AAV3B VP1 Cap protein; wherein the AAV3B VP1 Cap protein comprises a variant variable region VII (VR-VII) comprising a plurality of amino acid substitutions relative to the wildtype AAV3B VP1 Cap protein VR-VII sequence set forth in amino acids 306-317 of SEQ ID NO: 4, wherein the variant VR-VII comprises: a first amino acid that corresponds to amino acid 306 of SEQ ID NO: 4 and is E; a second amino acid that corresponds to amino acid 307 of SEQ ID NO: 4 and is independently selected from the group consisting of N, S and D; a third amino acid that corresponds to amino acid 308 of SEQ ID NO: 4 and is independently selected from the group consisting of S, G and A; a fourth amino acid that corresponds to amino acid 309 of SEQ ID NO: 4 and is independently selected from the group consisting of T, K, N, R, S, E, D and A; a fifth amino acid that corresponds to amino acid 310 of SEQ ID NO: 4 and is independently selected from the group consisting of K, T, R, E and G; a sixth amino acid that corresponds to amino acid 311 of SEQ ID NO: 4 and is independently selected from the group consisting of N, T, D, A and G; a seventh amino acid that corresponds to amino acid 312 of SEQ ID NO: 4 and is D; an eighth amino acid that corresponds to amino acid 313 of SEQ ID NO: 4 and is independently selected from the group consisting of A, T and I; a ninth amino acid that corresponds to amino acid 314 of SEQ ID NO: 4 and is independently selected from the group consisting of E and A; a tenth amino acid that corresponds to amino acid 315 of SEQ ID NO: 4 and is independently selected from the group consisting of N, I, D, V, Y and F; an eleventh amino acid that corresponds to amino acid 316 of SEQ ID NO: 4 and is independently selected from the group consisting of E and G; and a twelfth amino acid that corresponds to amino acid 317 of SEQ ID NO: 4 and is independently selected from the group consisting of K, R, S, Q, H, E, D and G.
2. The non-naturally occurring nucleic acid molecule of claim 1, wherein the nucleic acid molecule further comprises a third nucleic acid sequence encoding at least one molecule providing helper function.
3. The non-naturally occurring nucleic acid molecule of claim 2, wherein the third nucleic acid sequence encoding at least one molecule providing helper function is a polynucleotide from a virus selected from the group consisting of adenovirus and herpesvirus.
4. The non-naturally occurring nucleic acid molecule of claim 1, wherein the second nucleic acid sequence comprises the sequence set forth as: TABLE-US-00020 (SEQIDNO:1) TGCCCACTTACAACAACCATCTCTACAAGCAAATC TCCAGCVVMDCAGGAGCTASCAACGACAACCACTACTTTGGCTACAGCAC CCCTTGGGGGTATTTTGACTTTAACAGATTCCACTGCCACTTCTCACCAC GTGACTGGCAGCGACTCATTAACAACAACTGGGGATTCCGGCCCAAGAAA CTCAGCTTCAAGCTCTTCAACATCCAAGTTAGAGGGGTCACGCAGAACGA TGGCACGACGACTATTGCCAATAACCTTACCAGCACGGTTCAAGTGTTTA CGGACTCGGAGTATCAGCTCCCGTACGTGCTCGGGTCGGCGCACCAAGGC TGTCTCCCGCCGTTTCCAGCGGACGTCTTCATGGTCCCTCAGTATGGATA CCTCACCCTGAACAACGGAAGTCAAGCGGTGGGACGCTCATCCTTTTACT GCCTGGAGTACTTCCCTTCGCAGATGCTAAGGACTGGAAATAACTTCCAA TTCAGCTATACCTTCGAGGATGTACCTTTTCACAGCAGCTACGCTCACAG CCAGAGTTTGGATCGCTTGATGAATCCTCTTATTGATCAGTATCTGTACT ACCTGAACAGAACGCAARGCAMCVCNRGCGGAACARCCRVCMHSMRSVVS CTGVNGTTTAGCCAGGCTGGGCCTCAGTCTATGTCTTTGCAGGCCAGAAA TTGGCTACCTGGGCCCTGCTACCGGCAACAGAGACTTTCAAMARYCBMCR VCSRSAACAACAACAGTRASTTTCCTTGGMCAGCGGCCAGCAMATATCAT CTCAATGGCCGCGACTCGCTGGTGAATCCAGGACCAGCTATGGCCAGTCA CRRGGACGATRMSGRSARATTTTTCCCTATGCACGGCAATCTAATATTTG GCAAASAARRCRSCRVSRVARVCRATRYCGMSDWCGRSVRSGTAATGATT ACGGATGAAGAAGAGATTCGTACCACCAATCCTGTGGCAACAGAGCAGTA TGGAACTGTGGCAAATAACTTGCAGRVSVVSMRSRVCVVSCCCACGDHTV VSRNSGTCVMSCATCAGGGGGCCTTACCTGGCATGGTGTGGCAAGATCG T.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
DETAILED DESCRIPTION OF THE INVENTION
(7) Illustrative embodiments of the invention are described below. In the interest of clarity, not all features of an actual implementation are described in this specification. It will of course be appreciated that in the development of any such actual embodiment, numerous implementation-specific decisions must be made to achieve the developers' specific goals, such as compliance with system-related and business-related constraints, which will vary from one implementation to another. Moreover, it will be appreciated that such a development effort might be complex and time-consuming, but would be a routine undertaking for those of ordinary skill in the art having the benefit of this disclosure.
(8) The present invention also provides improved rAAV-based genetic constructs that encode one or more therapeutic agents useful in the preparation of medicaments for the prevention, treatment, and/or amelioration of one or more diseases, disorders or dysfunctions resulting from a deficiency in one or more cellular components. In particular, the invention provides libraries of rAAV-based genetic constructs encoding one or more selected molecules of interest, such as, for example, one or more diagnostic or therapeutic agents (including, e.g., proteins, polypeptides, peptides, antibodies, antigen binding fragments, siRNAs, RNAis, antisense oligo- and poly-nucleotides, ribozymes, and variants and/or active fragments thereof), for use in the diagnosis, prevention, treatment, and/or amelioration of symptoms of mammalian diseases, disorders, dysfunctions, deficiencies, defects, trauma, injury, and such like.
(9) The present invention also provides infectious rAAV virions, as well as nucleic acid molecules and rAAV vectors that encode the novel AAV vectors described herein, as well as nucleic acids encoding one or more selected diagnostic and/or therapeutic agents for delivery to a selected population of mammalian cells.
(10) Preferably, the novel rAAV vectors, express constructs, and infectious virions and viral particles comprising them as disclosed herein preferably have an improved efficiency in transducing one or more of a variety of cells, tissues and organs of interest, when compared to wild-type, unmodified, expression constructs, and to the corresponding rAAV vectors and virions comprising them.
(11) The improved rAAV vectors provided herein may transduce one or more selected host cells at higher-efficiencies (and often much higher efficiencies) than conventional, wild type (i.e., unmodified) rAAV vectors. Likewise, vectors prepared as described herein may be of different AAV serotypes, and the mutation of one or more of the sequences described herein may result in improved viral vectors, which are capable of higher-efficiency transduction than that of the corresponding, non-substituted vectors from which the mutants were prepared.
(12) The development of next-generation rAAV viral vectors may dramatically reduce the number of viral particles needed for a conventional gene therapy regimen. In addition to having improved transduction efficiencies for various mammalian cells, the rAAV vectors prepared as described herein may be more stable, less immunogenic, and/or can be produced at much lower cost, or in a higher titer, than an equivalent wild type viral vector prepared in conventional fashion.
(13) In the practice of the invention, native amino acids normally present in the sequence of a viral capsid protein, may be substituted by one or more non-native amino acids, including, a substitution of one or more amino acids not normally present at a particular residue in the corresponding wild-type protein.
(14) The invention also provides isolated and purified polynucleotides that encode one or more of the disclosed viral vectors as described herein, as well as polynucleotides that encode such vectors. Preferably, the vector constructs of the present invention further include at least promoter capable of expressing the nucleic acid segment in a suitable host cell comprising the vector.
(15) In the practice of the invention, the transduction efficiency of a mutated rAAV vector will be higher than that of the corresponding, unmodified, wild-type vector, and as such, will preferably possess a transduction efficiency in a mammalian cell that is at least 2-fold, at least about 4-fold, at least about 6-fold, at least about 8-fold, at least about 10-fold, or at least about 12-fold or higher in a selected mammalian host cell than that of a virion that comprises a corresponding, unmodified, rAAV vector. In certain embodiments, the transduction efficiency of the rAAV vectors provided herein will be at least about 15-fold higher, at least about 20-fold higher, at least about 25-fold higher, at least about 30-fold higher, or at least about 40, 45, or 50-fold or more greater than that of a virion that comprises a corresponding, wild-type vectors.
(16) The present invention also concerns rAAV vectors, wherein the nucleic acid segment further comprises a promoter, an enhancer, a post-transcriptional regulatory sequence, a polyadenylation signal, or any combination thereof, operably linked to the nucleic acid segment that encodes the selected polynucleotide of interest. Preferably, the promoter is a heterologous promoter, a tissue-specific promoter, a cell-specific promoter, a constitutive promoter, an inducible promoter, or any combination thereof. In certain embodiments, nucleic acid segments cloned into one or more of the novel rAAV expression vectors described herein will preferably express or encode one or more polypeptides, peptides, ribozymes, peptide nucleic acids, siRNAs, RNAis, antisense oligonucleotides, antisense polynucleotides, antibodies, antigen binding fragments, or any combination thereof.
(17) As noted herein, the therapeutic agents useful in the invention may include one or more agonists, antagonists, anti-apoptosis factors, inhibitors, receptors, cytokines, cytotoxins, erythropoietic agents, glycoproteins, growth factors, growth factor receptors, hormones, hormone receptors, interferons, interleukins, interleukin receptors, nerve growth factors, neuroactive peptides, neuroactive peptide receptors, proteases, protease inhibitors, protein decarboxylases, protein kinases, protein kinase inhibitors, enzymes, receptor binding proteins, transport proteins or one or more inhibitors thereof, serotonin receptors, or one or more uptake inhibitors thereof, serpins, serpin receptors, tumor suppressors, diagnostic molecules, chemotherapeutic agents, cytotoxins, or any combination thereof.
(18) The invention further provides populations and pluralities of such rAAV vectors as prepared herein, as well as virions, infectious viral particles, and mammalian host cells that include one or more nucleic acid segments encoding them.
(19) Preferably, the mammalian host cells will be human host cells, including, for example blood cells, stem cells, hematopoietic cells, CD34 cells, liver cells, cancer cells, vascular cells, pancreatic cells, neural cells, ocular or retinal cells, epithelial or endothelial cells, dendritic cells, fibroblasts, or any other cell of mammalian origin, including, without limitation, hepatic (i.e., liver) cells, lung cells, cardiac cells, pancreatic cells, intestinal cells, diaphragmatic cells, renal (i.e., kidney) cells, neural cells, blood cells, bone marrow cells, retinal cells or any one or more selected tissues of a mammal for which viral-based gene therapy is contemplated.
(20) The invention further provides composition and formulations that include one or more of the proteins nucleic acid segments viral vectors, host cells, or viral particles of the present invention together with one or more pharmaceutically-acceptable buffers, diluents, or excipients. Such compositions may be included in one or more diagnostic or therapeutic kits, for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian disease, injury, disorder, trauma or dysfunction.
(21) The invention further includes a method for providing a mammal in need thereof with a diagnostically- or therapeutically-effective amount of a selected biological molecule, the method comprising providing to a cell, tissue or organ of a mammal in need thereof, an amount of an rAAV vector; and for a time effective to provide the mammal with a diagnostically- or a therapeutically-effective amount of the selected biological molecule.
(22) The invention further provides a method for diagnosing, preventing, treating, or ameliorating at least one or more symptoms of a disease, a disorder, a dysfunction, an injury, an abnormal condition, or trauma in a mammal. In an overall and general sense, the method includes at least the step of administering to a mammal in need thereof one or more of the disclosed rAAV vectors, in an amount and for a time sufficient to diagnose, prevent, treat or ameliorate the one or more symptoms of the disease, disorder, dysfunction, injury, abnormal condition, or trauma in the mammal.
(23) The invention also provides a method of transducing a population of mammalian cells. In an overall and general sense, the method includes at least the step of introducing into one or more cells of the population, a composition that comprises an effective amount of one or more of the rAAV vectors disclosed herein.
(24) In a further embodiment, the invention also provides isolated nucleic acid segments that encode one or more of the mutant viral capsid proteins as described herein, and provides recombinant vectors, virus particles, infectious virions, and isolated host cells that comprise one or more of the improved vector sequences described and tested herein.
(25) Additionally, the present invention provides compositions, as well as therapeutic and/or diagnostic kits that include one or more of the disclosed AAV compositions, formulated with one or more additional ingredients, or prepared with one or more instructions for their use.
(26) The invention also demonstrates methods for making, as well as methods of using the disclosed improved rAAV vectors in a variety of ways, including, for example, ex situ, in vitro and in vivo applications, methodologies, diagnostic procedures, and/or gene therapy regimens. Because many of the improved vectors described herein are also resistant to proteasomal degradation, they possess significantly increased transduction efficiencies in vivo making them particularly well suited for viral vector-based human gene therapy regimens, and in particular, for delivering one or more genetic constructs to selected mammalian cells in vivo and/or in vitro.
(27) In one aspect, the invention provides compositions comprising AAV vectors, virions, viral particles, and pharmaceutical formulations thereof, useful in methods for delivering genetic material encoding one or more beneficial or therapeutic product(s) to mammalian cells and tissues. In particular, the compositions and methods of the invention provide a significant advancement in the art through their use in the treatment, prevention, and/or amelioration of symptoms of one or more mammalian diseases. It is contemplated that human gene therapy will particularly benefit from the present teachings by providing new and improved viral vector constructs for use in the treatment of a number of diverse diseases, disorders, and dysfunctions.
(28) In another aspect, the invention concerns libraries of rAAV vector mutants that demonstrate improved properties useful in the delivery of one or more therapeutic agents to selected mammalian cells, and particularly for use in the prevention, treatment, and/or amelioration of one or more disorders in a mammal into which the vector construct may be introduced.
(29) The rAAV vectors of the present invention may optionally further include one or more enhancer sequences that are each operably linked to the nucleic acid segment. Exemplary enhancer sequences include, but are not limited to, one or more selected from the group consisting of a CMV enhancer, a synthetic enhancer, a liver-specific enhancer, an vascular-specific enhancer, a brain-specific enhancer, a neural cell-specific enhancer, a lung-specific enhancer, a muscle-specific enhancer, a kidney-specific enhancer, a pancreas-specific enhancer, retinal-specific enhancer and an islet cell-specific enhancer.
(30) Exemplary promoters useful in the practice of the invention include, without limitation, one or more heterologous, tissue-specific, constitutive or inducible promoters, including, for example, but not limited to, a promoter selected from the group consisting of a CMV promoter, a I3-actin promoter, an insulin promoter, an enolase promoter, a BDNF promoter, an NGF promoter, an EGF promoter, a growth factor promoter, an axon-specific promoter, a dendrite-specific promoter, a brain-specific promoter, a hippocampal-specific promoter, a kidney-specific promoter, a retinal-specific promoter, an elafin promoter, a cytokine promoter, an interferon promoter, a growth factor promoter, an ai-antitrypsin promoter, a brain cell-specific promoter, a neural cell-specific promoter, a central nervous system cell-specific promoter, a peripheral nervous system cell-specific promoter, an interleukin promoter, a serpin promoter, a hybrid CMV promoter, a hybrid I3-actin promoter, an EF 1 promoter, a U1 a promoter, a U1b promoter, a Tet-inducible promoter, a VP1 6-LexA promoter, or any combination thereof. In exemplary embodiments, the promoter may include a mammalian or avian I3-actin promoter.
(31) The vector-encoding nucleic acid segments may also further include one or more post-transcriptional regulatory sequences or one or more polyadenylation signals, including, for example, but not limited to, a woodchuck hepatitis virus post-transcription regulatory element, a polyadenylation signal sequence, or any combination thereof.
(32) Exemplary diagnostic or therapeutic agents deliverable to host cells by the present vector constructs include, but are not limited to, an agent selected from the group consisting of a polypeptide, a peptide, an antibody, an antigen binding fragment, a ribozyme, a peptide nucleic acid, a siRNA, an RNAi, an antisense oligonucleotide, an antisense polynucleotide, and any combination thereof.
(33) In exemplary embodiments, the rAAV vectors obtained by the disclosed methods will preferably encode at least one diagnostic or therapeutic protein or polypeptide selected from the group consisting of a molecular marker, an adrenergic agonist, an anti-apoptosis factor, an apoptosis inhibitor, a cytokine receptor, a cytokine, a cytotoxin, an erythropoietic agent, a glutamic acid decarboxylase, a glycoprotein, a growth factor, a growth factor receptor, a hormone, a hormone receptor, an interferon, an interleukin, an interleukin receptor, a kinase, a kinase inhibitor, a nerve growth factor, a netrin, a neuroactive peptide, a neuroactive peptide receptor, a neurogenic factor, a neurogenic factor receptor, a neuropilin, a neurotrophic factor, a neurotrophin, a neurotrophin receptor, an N-methyl-D-aspartate antagonist, a plexin, a protease, a protease inhibitor, a protein decarboxylase, a protein kinase, a protein kinsase inhibitor, a proteolytic protein, a proteolytic protein inhibitor, a semaphorin, a semaphorin receptor, a serotonin transport protein, a serotonin uptake inhibitor, a serotonin receptor, a serpin, a serpin receptor, a tumor suppressor, and any combination thereof.
(34) In certain applications, the rAAV vectors of the present invention may include one or more nucleic acid segments that encode a polypeptide selected from the group consisting of BDNF, CNTF, CSF, EGF, FGF, G-SCF, GM-CSF, gonadotropin, IFN, IFG-1, M-CSF, NGF, PDGF, PEDF, TGF, TGF-B2, TNF, VEGF, prolactin, somatotropin, XIAP1, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-10 (I87A), viral IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, and any combination thereof.
(35) In another embodiment, the invention concerns genetically-modified, improved-transduction-efficiency rAAV vectors that include at least a first nucleic acid segment that encodes one or more therapeutic agents that alter, inhibit, reduce, prevent, eliminate, or impair the activity of one or more endogenous biological processes in the cell. In particular embodiments, such therapeutic agents may be those that selectively inhibit or reduce the effects of one or more metabolic processes, dysfunctions, disorders, or diseases. In certain embodiments, the defect may be caused by injury or trauma to the mammal for which treatment is desired. In other embodiments, the defect may be caused the over-expression of an endogenous biological compound, while in other embodiments still; the defect may be caused by the under-expression or even lack of one or more endogenous biological compounds.
(36) The genetically-modified rAAV vectors and expression systems of the present invention may also further optionally include a second distinct nucleic acid segment that comprises, consists essentially of, or consists of, one or more enhancers, one or more regulatory elements, one or more transcriptional elements, or any combination thereof, that alter, improve, regulate, and/or affect the transcription of the nucleotide sequence of interest expressed by the modified rAAV vectors.
(37) For example, the rAAV vectors of the present invention may further include a second nucleic acid segment that comprises, consists essentially of, or consists of, a CMV enhancer, a synthetic enhancer, a cell-specific enhancer, a tissue-specific enhancer, or any combination thereof. The second nucleic acid segment may also further comprise, consist essentially of, or consist of, one or more intron sequences, one or more post-transcriptional regulatory elements, or any combination thereof.
(38) The improved vectors and expression systems of the present invention may also optionally further include a polynucleotide that comprises, consists essentially of, or consists of, one or more polylinkers, restriction sites, and/or multiple cloning region(s) to facilitate insertion (cloning) of one or more selected genetic elements, genes of interest, or therapeutic or diagnostic constructs into the rAAV vector at a selected site within the vector.
(39) In further aspects of the present invention, the exogenous polynucleotide(s) that may be delivered into suitable host cells by the improved, capsid-modified, rAAV vectors disclosed herein are preferably of mammalian origin, with polynucleotides encoding one or more polypeptides or peptides of human, non-human primate, porcine, bovine, ovine, feline, canine, equine, epine, caprine, or lupine origin being particularly preferred.
(40) The exogenous polynucleotide(s) that may be delivered into host cells by the disclosed capsid-modified viral vectors may, in certain embodiments, encode one or more proteins, one or more polypeptides, one or more peptides, one or more enzymes, or one or more antibodies (or antigen-binding fragments thereof), or alternatively, may express one or more siRNAs, ribozymes, antisense oligonucleotides, PNA molecules, or any combination thereof. When combinational gene therapies are desired, two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which may comprise one or more distinct polynucleotides that encode a therapeutic agent.
(41) In other embodiments, the invention also provides rAAV vector mutants that are comprised within an infectious adeno-associated viral particle or a virion, as well as pluralities of such virions or infectious particles. Such vectors and virions may be comprised within one or more diluents, buffers, physiological solutions or pharmaceutical vehicles, or formulated for administration to a mammal in one or more diagnostic, therapeutic, and/or prophylactic regimens. The vectors, virus particles, virions, and pluralities thereof of the present invention may also be provided in excipient formulations that are acceptable for veterinary administration to selected livestock, exotics, domesticated animals, and companion animals (including pets and such like), as well as to non-human primates, zoological or otherwise captive specimens, and such like.
(42) The invention also concerns host cells that comprise at least one of the disclosed rAAV expression vectors, or one or more virus particles or virions that comprise such an expression vector. Such host cells are particularly mammalian host cells, with human host cells being particularly highly preferred, and may be either isolated, in cell or tissue culture. In the case of genetically modified animal models, the transformed host cells may even be comprised within the body of a non-human animal itself.
(43) In certain embodiments, the creation of recombinant non-human host cells, and/or isolated recombinant human host cells that comprise one or more of the disclosed rAAV vectors is also contemplated to be useful for a variety of diagnostic, and laboratory protocols, including, for example, means for the production of large-scale quantities of the rAAV vectors described herein. Such virus production methods are particularly contemplated to be an improvement over existing methodologies including in particular, those that require very high titers of the viral stocks in order to be useful as a gene therapy tool. The inventors contemplate that one very significant advantage of the present methods will be the ability to utilize lower titers of viral particles in mammalian transduction protocols, yet still retain transfection rates at a suitable level.
(44) Compositions comprising one or more of the disclosed rAAV vectors, expression systems, infectious AAV particles, or host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in therapy, and for use in the manufacture of medicaments for the treatment of one or more mammalian diseases, disorders, dysfunctions, or trauma. Such pharmaceutical compositions may optionally further comprise one or more diluents, buffers, liposomes, a lipid, a lipid complex; or the tyrosine-modified rAAV vectors may be comprised within a microsphere or a nanoparticle.
(45) Pharmaceutical formulations suitable for intramuscular, intravenous, or direct injection into an organ or tissue or a plurality of cells or tissues of a human or other mammal are particularly preferred, however, the compositions disclosed herein may also find utility in administration to discreet areas of the mammalian body, including for example, formulations that are suitable for direct injection into one or more organs, tissues, or cell types in the body. Such injection sites include, but are not limited to, the brain, a joint or joint capsule, a synovium or subsynovium tissue, tendons, ligaments, cartilages, bone, peri-articular muscle or an articular space of a mammalian joint, as well as direct administration to an organ such as the heart, liver, lung, pancreas, intestine, brain, bladder, kidney, or other site within the patient's body, including, for example, introduction of the viral vectors via intraabdominal, intrathoracic, intravascular, or intracerebroventricular delivery.
(46) Other aspects of the invention concern recombinant adeno-associated virus virion particles, compositions, and host cells that comprise, consist essentially of, or consist of, one or more of the rAAV vectors disclosed herein, such as for example pharmaceutical formulations of the vectors intended for administration to a mammal through suitable means, such as, by intramuscular, intravenous, intra-articular, or direct injection to one or more cells, tissues, or organs of a selected mammal. Typically, such compositions may be formulated with pharmaceutically-acceptable excipients as described hereinbelow, and may comprise one or more liposomes, lipids, lipid complexes, microspheres or nanoparticle formulations to facilitate administration to the selected organs, tissues, and cells for which therapy is desired.
(47) Kits comprising one or more of the disclosed rAAV vectors (as well as one or more virions, viral particles, transformed host cells or pharmaceutical compositions comprising such vectors); and instructions for using such kits in one or more therapeutic, diagnostic, and/or prophylactic clinical embodiments are also provided by the present invention. Such kits may further comprise one or more reagents, restriction enzymes, peptides, therapeutics, pharmaceutical compounds, or means for delivery of the composition(s) to host cells, or to an animal (e.g., syringes, injectables, and the like). Exemplary kits include those for treating, preventing, or ameliorating the symptoms of a disease, deficiency, dysfunction, and/or injury, or may include components for the large-scale production of the viral vectors themselves, such as for commercial sale, or for use by others, including e.g., virologists, medical professionals, and the like.
(48) Another important aspect of the present invention concerns methods of use of the disclosed rAAV vectors, virions, expression systems, compositions, and host cells described herein in the preparation of medicaments for diagnosing, preventing, treating or ameliorating at least one or more symptoms of a disease, a dysfunction, a disorder, an abnormal condition, a deficiency, injury, or trauma in an animal, and in particular, in a vertebrate mammal. Such methods generally involve administration to a mammal in need thereof, one or more of the disclosed vectors, virions, viral particles, host cells, compositions, or pluralities thereof, in an amount and for a time sufficient to diagnose, prevent, treat, or lessen one or more symptoms of such a disease, dysfunction, disorder, abnormal condition, deficiency, injury, or trauma in the affected animal. The methods may also encompass prophylactic treatment of animals suspected of having such conditions, or administration of such compositions to those animals at risk for developing such conditions either following diagnosis, or prior to the onset of symptoms.
(49) As described above, the exogenous polynucleotide will preferably encode one or more proteins, polypeptides, peptides, ribozymes, or antisense oligonucleotides, or a combination of these. In fact, the exogenous polynucleotide may encode two or more such molecules, or a plurality of such molecules as may be desired. When combinational gene therapies are desired, two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which will provide unique heterologous polynucleotides encoding at least two different such molecules.
(50) Compositions comprising one or more of the disclosed rAAV vectors, expression systems, infectious AAV particles, host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in the manufacture of medicaments and methods involving therapeutic administration of such rAAV vectors. Such pharmaceutical compositions may optionally further comprise liposomes, a lipid, a lipid complex; or the rAAV vectors may be comprised within a microsphere or a nanoparticle. Pharmaceutical formulations suitable for intramuscular, intravenous, or direct injection into an organ or tissue of a human are particularly preferred.
(51) Use of rAAV Vectors in Prophylaxis, Diagnosis, or Therapy
(52) The present invention provides compositions including one or more of the disclosed rAAV vectors comprised within a kit for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian disease, injury, disorder, trauma or dysfunction. Such kits may be useful in the diagnosis, prophylaxis, and/or therapy or a human disease, and may be particularly useful in the treatment, prevention, and/or amelioration of one or more symptoms of wet age-related macular degeneration, dry age-related macular degeneration, glaucoma, retinitis pigmentosa, diabetic retinopathy, orphan ophthalmological diseases, cancer, diabetes, autoimmune disease, kidney disease, cardiovascular disease, pancreatic disease, intestinal disease, liver disease, neurological disease, neuromuscular disorder, neuromotor deficit, neuroskeletal impairment, neurological disability, neurosensory dysfunction, stroke, ischemia, a 1-antitrypsin (AAT) deficiency, Batten's disease, Alzheimer's disease, sickle cell disease, f3-thalassamia, Huntington's disease, Parkinson's disease, skeletal disease, trauma, pulmonary disease in a human.
(53) The invention also provides for the use of a composition disclosed herein in the manufacture of a medicament for treating, preventing or ameliorating the symptoms of a disease, disorder, dysfunction, injury or trauma, including, but not limited to, the treatment, prevention, and/or prophylaxis of a disease, disorder or dysfunction, and/or the amelioration of one or more symptoms of such a disease, disorder or dysfunction.
(54) The invention also provides a method for treating or ameliorating the symptoms of such a disease, injury, disorder, or dysfunction in a mammal. Such methods generally involve at least the step of administering to a mammal in need thereof, one or more of the rAAV vectors as disclosed herein, in an amount and for a time sufficient to treat or ameliorate the symptoms of such a disease, injury, disorder, or dysfunction in the mammal. Such treatment regimens are particularly contemplated in human therapy, via administration of one or more compositions either intramuscularly, intravenously, subcutaneously, intrathecally, intraperitoneally, or by direct injection into an organ or a tissue of the mammal under care.
(55) The invention also provides a method for providing to a mammal in need thereof, a therapeutically-effective amount of an rAAV composition of the present invention, in an amount, and for a time effective to provide the patient with a therapeutically-effective amount of the desired therapeutic agent(s) encoded by one or more nucleic acid segments comprised within the rAAV vector. Exemplary therapeutic agents include, but are not limited to, a polypeptide, a peptide, an antibody, an antigen-binding fragment, a ribozyme, a peptide nucleic acid, an siRNA, an RNAi, an antisense oligonucleotide, an antisense polynucleotide, or a combination thereof.
(56) Pharmaceutical Compositions
(57) The genetic constructs of the present invention may be prepared in a variety of compositions, and may also be formulated in appropriate pharmaceutical vehicles for administration to human or animal subjects.
(58) The invention also provides compositions comprising one or more of the disclosed rAAV vectors, expression systems, virions, viral particles, mammalian cells, or combinations thereof. In certain embodiments, the present invention provides pharmaceutical formulations of one or more rAAV vectors disclosed herein for administration to a cell or an animal, either alone or in combination with one or more other modalities of therapy, and in particular, for therapy of human cells, tissues, and diseases affecting man. Formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, intra-articular, intramuscular administration and formulation.
(59) Library Design and Construction
(60) Comparison of the AAV VP3 structure among various serotypes has revealed highly homologous sequences interspersed with more evolutionary divergent areas. These amino acid stretches are commonly designated as VRs I through IX (variable regions I-IX; also known as loops). VRs are localized at the surface of the assembled capsid and are assumed to be responsible for the capsid interaction with cell surface receptors and other host factors. Because of their location, VRs are also predicted to be less critical for capsid assembly. Therefore, the guiding principle of the library's design was to modify only surface VRs while keeping the backbone sequence unchanged to maintain the integrity of the assembling scaffold. All candidate positions for mutagenesis, in the AAV3 background, were selected from the alignment of known variants, which can be evaluated on a three dimensional model of the AAV3 capsid. The amino acid diversity of VR-I, VR-IV, VR-V, VR-VI, VR-VII and VR-VIII is shown in
(61) The library was built in three steps: first, VR parent sub-libraries were prepared each containing mutations in only one VR (B: VR-IV, C: VR-VII, D: VR-VIII) or a subset of VRs (A: VR-I+VR-V+VR-VI), then, structurally compatible sequences were combined to generate master libraries (A+B+C: VRs I, IV, V, VI, VII) and (D: VR-VIII), and finally the master libraries were packaged. See Examples, Example 2 and
(62) Tissue-Specific or Cell-Specific Virions
(63) The master libraries can be used to select virions having capsids containing degenerate or otherwise modified Cap protein (i.e., Cap protein that differs from wildtype serotype 3 at least at one amino acid position) that are targeted to particular tissue or cell types. For example, virions made according to the invention include those that exhibit a new tropism, e.g., those capable of infecting cells normally non-permissive to AAV infection in general or at least non-permissive to AAV3 infection, as well as those that exhibit an increased or decreased ability to infect a particular cell or tissue type. As another example, virions made according to the invention include those that lack the ability to infect cells normally permissive to AAV infection in general or at least normally permissive to AAV3 infection. To select for virions having a particular cell- or tissue-specific tropism, a packaged master library is introduced into a target cell. Preferably, the target cell is also infected with a helper virus (e.g. Ad). The target cell is cultured under conditions that allow for the production of virions, resulting in a population of virions that are harvested from the target cell. This population of virions has been selected for having a tropism for that target cell.
(64) As controls in a typical experiment in which virions having a particular tropism are selected, cells in different flasks or dishes can be simultaneously infected with WT AAV3 or rAAV using the same conditions as used for the library. After a suitable time post-infection, cells can be harvested, washed and the virions purified using a suitable purification method (See Gao et al., Hum. Gene Ther. 9:2353-62, 1998; U.S. Pat. No. 6,146,874; and Zolotukhin et al., Gene Ther. 6:973-85, 1999). AAV and helper virions (e.g., Ad) from each infection can be tittered, by real-time PCT for example, and the AAV virions can then be further propagated, resulting in a stock of selected virions.
(65) Once the selected population of virions having a desired tropism is isolated, nucleic acid from the virions is isolated and the sequence of the nucleotide sequence encoding the at least one AAV Cap protein is determined. Virions made and selected according to the invention that can specifically target diseased cells or tissues over non-diseased cells or tissues are particularly useful.
(66) Alternatively tissue- or cell-specific virions can be selected using an in vivo approach. For example, mice (or other suitable host) can be injected with a suitable amount viral preparation (e.g., 110.sup.10 to 110.sup.11 vg in the case of mice) via the tail vein. More than one round of selection can be performed by injecting original master library for the first round and target-enriched libraries in subsequent rounds. Hosts are euthanized after an incubation period (3 to 4 days for mice), and episomal DNA is purified from the target cells or tissue and used as a template to amplify capsid DNA sequences. Target-enriched libraries can then be generated, purified and quantified. After several rounds of selection, amplified capsid DNA can be inserted into an appropriate vector for cloning and random clones can be analyzed by sequencing.
Exemplary Definitions
(67) Unless otherwise defined, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Commonly understood definitions of molecular biology terms can be found in Rieger et al., (1991); Lewin (1994). Commonly understood definitions of virology terms can be found in Granoff and Webster (1999) and Tidona and Darai (2002). Commonly understood definitions of microbiology can be found in Singleton and Sainsbury (2002).
(68) In accordance with long standing patent law convention, the words a and an when used in this application, including the claims, denotes one or more.
(69) The terms about and approximately as used herein, are interchangeable, and should generally be understood to refer to a range of numbers around a given number, as well as to all numbers in a recited range of numbers (e.g., about 5 to 15 means about 5 to about 15 unless otherwise stated). Moreover, all numerical ranges herein should be understood to include each whole integer within the range.
(70) As used herein, the term carrier is intended to include any solvent(s), dispersion medium, coating(s), diluent(s), buffer(s), isotonic agent(s), solution(s), suspension(s), colloid(s), inert(s) or such like, or a combination thereof, that is pharmaceutically acceptable for administration to the relevant animal. The use of one or more delivery vehicles for chemical compounds in general, and chemotherapeutics in particular, is well known to those of ordinary skill in the pharmaceutical arts. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the diagnostic, prophylactic, and therapeutic compositions is contemplated. One or more supplementary active ingredient(s) may also be incorporated into, or administered in association with, one or more of the disclosed chemotherapeutic compositions.
(71) As used herein, the term chimeric rcAAV refers to a replication-competent AAV-derived nucleic acid containing at least one nucleotide sequence that 1) encodes an AAV protein and 2) differs from the corresponding native nucleotide sequence in one or more bases.
(72) As used herein, the term DNA segment refers to a DNA molecule that has been isolated free of total genomic DNA of a particular species. Therefore, a DNA segment obtained from a biological sample using one of the compositions disclosed herein refers to one or more DNA segments that have been isolated away from, or purified free from, total genomic DNA of the particular species from which they are obtained. Included within the term DNA segment, are DNA segments and smaller fragments of such segments, as well as recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like.
(73) The term e.g., as used herein, is used merely by way of example, without limitation intended, and should not be construed as referring only those items explicitly enumerated in the specification.
(74) As used herein, an effective amount would be understood by those of ordinary skill in the art to provide a therapeutic, prophylactic, or otherwise beneficial effect against the organism, its infection, or the symptoms of the organism or its infection, or any combination thereof.
(75) The phrase expression control sequence refers to any genetic element (e.g., polynucleotide sequence) that can exert a regulatory effect on the replication or expression (transcription or translation) of another genetic element. Common expression control sequences include promoters, polyadenylation (polyA) signals, transcription termination sequences, upstream regulatory domains, origins of replication, internal ribosome entry sites (IRES), enhancers, and the like. A tissue specific expression control sequence is one that exerts a regulatory effect on the replication or expression (transcription or translation) of another genetic element in only one type of tissue or a small subset of tissues.
(76) The phrase helper function is meant as a functional activity performed by a nucleic acid or polypeptide that is derived from a virus such as Adenovirus (Ad) or herpesvirus and that facilitates AAV replication in a host cell.
(77) As used herein, a heterologous is defined in relation to a predetermined referenced gene sequence. For example, with respect to a structural gene sequence, a heterologous promoter is defined as a promoter which does not naturally occur adjacent to the referenced structural gene, but which is positioned by laboratory manipulation. Likewise, a heterologous gene or nucleic acid segment is defined as a gene or segment that does not naturally occur adjacent to the referenced promoter and/or enhancer elements.
(78) As used herein, the term homology refers to a degree of complementarity between two or more polynucleotide or polypeptide sequences. The word identity may substitute for the word homology when a first nucleic acid or amino acid sequence has the exact same primary sequence as a second nucleic acid or amino acid sequence. Sequence homology and sequence identity can be determined by analyzing two or more sequences using algorithms and computer programs known in the art. Such methods may be used to assess whether a given sequence is identical or homologous to another selected sequence.
(79) As used herein, homologous means, when referring to polynucleotides, sequences that have the same essential nucleotide sequence, despite arising from different origins. Typically, homologous nucleic acid sequences are derived from closely related genes or organisms possessing one or more substantially similar genomic sequences. By contrast, an analogous polynucleotide is one that shares the same function with a polynucleotide from a different species or organism, but may have a significantly different primary nucleotide sequence that encodes one or more proteins or polypeptides that accomplish similar functions or possess similar biological activity. Analogous polynucleotides may often be derived from two or more organisms that are not closely related (e.g., either genetically or phylogenetically).
(80) The terms identical or percent identity, in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (or other algorithms available to persons of ordinary skill) or by visual inspection.
(81) As used herein, the phrase in need of treatment refers to a judgment made by a caregiver such as a physician or veterinarian that a patient requires (or will benefit in one or more ways) from treatment. Such judgment may made based on a variety of factors that are in the realm of a caregiver's expertise, and may include the knowledge that the patient is ill as the result of a disease state that is treatable by one or more compound or pharmaceutical compositions such as those set forth herein.
(82) The phrases isolated or biologically pure refer to material that is substantially, or essentially, free from components that normally accompany the material as it is found in its native state. Thus, isolated polynucleotides in accordance with the invention preferably do not contain materials normally associated with those polynucleotides in their natural, or in situ, environment.
(83) As used herein, the term kit may be used to describe variations of the portable, self-contained enclosure that includes at least one set of components to conduct one or more of the diagnostic or therapeutic methods of the invention.
(84) Link or join refers to any method known in the art for functionally connecting one or more proteins, peptides, nucleic acids, or polynucleotides, including, without limitation, recombinant fusion, covalent bonding, disulfide bonding, ionic bonding, hydrogen bonding, electrostatic bonding, and the like.
(85) The term library refers to a collection of elements that differ from one another in at least one aspect. For example, a vector library is a collection of at least two vectors that differ from one another by at least one nucleotide. As another example, a virion library is a collection of at least two virions that differ from one another by at least one nucleotide or at least one capsid protein.
(86) As used herein, the term master library or combined library refers to a pool of rAAV virions composed of chimeric rcAAV vectors encapsidated in cognate chimeric capsids (e.g., capsids containing a degenerate or otherwise modified Cap protein).
(87) As used herein, the term parent sub-library refers to a pool of rAAV virions composed of chimeric rcAAV vectors encapsidated in cognate chimeric capsids (e.g., capsids containing degenerate or otherwise modified Cap protein). More than one parent sub-library can be combined to create a master library or combined library.
(88) When referring to a nucleic acid molecule or polypeptide, the term native refers to a naturally-occurring (e.g., a WT) nucleic acid or polypeptide.
(89) The term naturally occurring as used herein as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by the hand of man in a laboratory is naturally-occurring. As used herein, laboratory strains of rodents that may have been selectively bred according to classical genetics are considered naturally occurring animals.
(90) As used herein, the phrase nucleic acid means a chain of two or more nucleotides such as RNA (ribonucleic acid) and DNA (deoxyribonucleic acid). Conventional nomenclature exists in the art for polynucleotide and polypeptide structures. For example, one-letter abbreviations are widely employed to describe nucleotides: Adenine (A), Guanine (G), Cytosine (C), Thymine (T), Uracil (U), Purine, i.e. A or G (R), Pyrimidine, i.e. C or T (Y), any nucleotide (N), Weak, i.e. A or T (W), Strong, i.e. G or C (S), Amino, i.e. A or C (M), Keto, i.e. G or T (K), not A, i.e. G or C or T (B), not G, i.e. A or C or T (H), not C, i.e. A or G or T (D) and not T, i.e. A or G or C (V).
(91) The phrases cap nucleic acid, cap gene, and capsid gene as used herein mean a nucleic acid that encodes a Cap protein. Examples of cap nucleic acids include wild-type (WT) Cap-encoding nucleic acid sequences from AAV serotypes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13; a native form cap cDNA; a nucleic acid having sequences from which a cap cDNA can be transcribed; and/or allelic variants and homologs of the foregoing.
(92) VR, VRs, variable region or variable regions refer to amino acid stretches of capsid protein that do not have a high degree of homology between AAV variants. These amino acid stretches are commonly designated as VRs I through IX (also known as loops). VRs are localized at the surface of the assembled capsid and interact with host cell surface receptors and other host factors.
(93) As used herein, the term patient (also interchangeably referred to as host or subject) refers to any host that can receive one or more of the pharmaceutical compositions disclosed herein. Preferably, the subject is a vertebrate animal, which is intended to denote any animal species (and preferably, a mammalian species such as a human being). In certain embodiments, a patient refers to any animal host including without limitation any mammalian host. Preferably, the term refers to any mammalian host, the latter including but not limited to, human and non-human primates, bovines, canines, caprines, cavines, corvines, epines, equines, felines, hircines, lapines, leporines, lupines, murines, ovines, porcines, ranines, racines, vulpines, and the like, including livestock, zoological specimens, exotics, as well as companion animals, pets, and any animal under the care of a veterinary practitioner.
(94) The phrase pharmaceutically-acceptable refers to molecular entities and compositions that preferably do not produce an allergic or similar untoward reaction when administered to a mammal, and in particular, when administered to a human. As used herein, pharmaceutically acceptable salt refers to a salt that preferably retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects. Examples of such salts include, without limitation, acid addition salts formed with inorganic acids (e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid, and the like); and salts formed with organic acids including, without limitation, acetic acid, oxalic acid, tartaric acid, succinic acid, maleic acid, fumaric acid, gluconic acid, citric acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic (embonic) acid, alginic acid, naphthoic acid, polyglutamic acid, naphthalenesulfonic acids, naphthalenedisulfonic acids, polygalacturonic acid; salts with polyvalent metal cations such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, cadmium, and the like; salts formed with an organic cation formed from N,N-dibenzylethylenediamine or ethylenediamine; and combinations thereof.
(95) The term pharmaceutically acceptable salt as used herein refers to a compound of the present disclosure derived from pharmaceutically acceptable bases, inorganic or organic acids. Examples of suitable acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycollic, lactic, salicyclic, succinic, toluene-p-sulfonic, tartaric, acetic, citric, methanesulfonic, formic, benzoic, malonic, naphthalene-2-sulfonic, trifluoroacetic and benzenesulfonic acids. Salts derived from appropriate bases include, but are not limited to, alkalis such as sodium and ammonia.
(96) As used herein, the term plasmid or vector refers to a genetic construct that is composed of genetic material (i.e., nucleic acids). Typically, a plasmid or a vector contains an origin of replication that is functional in bacterial host cells, e.g., Escherichia coli, and selectable markers for detecting bacterial host cells including the plasmid. Plasmids and vectors of the present invention may include one or more genetic elements as described herein arranged such that an inserted coding sequence can be transcribed and translated in a suitable expression cells. In addition, the plasmid or vector may include one or more nucleic acid segments, genes, promoters, enhancers, activators, multiple cloning regions, or any combination thereof, including segments that are obtained from or derived from one or more natural and/or artificial sources.
(97) As used herein, the term polypeptide is intended to encompass a singular polypeptide as well as plural polypeptides, and includes any chain or chains of two or more amino acids. Thus, as used herein, terms including, but not limited to peptide, dipeptide, tripeptide, protein, enzyme, amino acid chain, and contiguous amino acid sequence are all encompassed within the definition of a polypeptide, and the term polypeptide can be used instead of, or interchangeably with, any of these terms. The term further includes polypeptides that have undergone one or more post-translational modification(s), including for example, but not limited to, glycosylation, acetylation, phosphorylation, amidation, derivatization, proteolytic cleavage, post-translation processing, or modification by inclusion of one or more non-naturally occurring amino acids. Conventional nomenclature exists in the art for polynucleotide and polypeptide structures. For example, one-letter and three-letter abbreviations are widely employed to describe amino acids: Alanine (A; Ala), Arginine (R; Arg), Asparagine (N; Asn), Aspartic Acid (D; Asp), Cysteine (C; Cys), Glutamine (Q; Gln), Glutamic Acid (E; Glu), Glycine (G; Gly), Histidine (H; His), Isoleucine (I; Ile), Leucine (L; Leu), Methionine (M; Met), Phenylalanine (F; Phe), Proline (P; Pro), Serine (S; Ser), Threonine (T; Thr), Tryptophan (W; Trp), Tyrosine (Y; Tyr), Valine (V; Val), and Lysine (K; Lys). Additional conventions include: Asn or Asp (B; Asx), Gln or Glu (Z; Glx), Leu or Ile (J; Xle), Selenocysteine (U; Sec), Pyrrolysine (O; Pyl) and Unknown (X; Unk). Amino acid residues described herein are preferred to be in the L isomeric form. However, residues in the D isomeric form may be substituted for any L-amino acid residue provided the desired properties of the polypeptide are retained.
(98) As used herein, the terms prevent, preventing, prevention, suppress, suppressing, and suppression as used herein refer to administering a compound either alone or as contained in a pharmaceutical composition prior to the onset of clinical symptoms of a disease state so as to prevent any symptom, aspect or characteristic of the disease state. Such preventing and suppressing need not be absolute to be deemed medically useful.
(99) The term promoter, as used herein refers to a region or regions of a nucleic acid sequence that regulates transcription.
(100) Protein is used herein interchangeably with peptide and polypeptide, and includes both peptides and polypeptides produced synthetically, recombinantly, or in vitro and peptides and polypeptides expressed in vivo after nucleic acid sequences are administered into a host animal or human subject. The term polypeptide is preferably intended to refer to any amino acid chain length, including those of short peptides from two to about 20 amino acid residues in length, oligopeptides from about 10 to about 100 amino acid residues in length, and longer polypeptides including those of about 100 or more amino acid residues in length. Furthermore, the term is also intended to include enzymes, i.e., functional biomolecules including at least one amino acid polymer. Polypeptides and proteins of the present invention also include polypeptides and proteins that are or have been post-translationally modified, and include any sugar or other derivative(s) or conjugate(s) added to the backbone amino acid chain.
(101) The term pseudotyped is meant a nucleic acid or genome derived from a first AAV serotype that is encapsidated (packaged) into an AAV capsid containing at least one AAV Cap protein of a second serotype differing from the first serotype.
(102) As used herein, the term rcAAV vector refers to a replication-competent AAV-derived nucleic acid capable of DNA replication in a cell without any additional AAV genes or gene products.
(103) The term recombinant indicates that the material (e.g., a polynucleotide or a polypeptide) has been artificially or synthetically (non-naturally) altered by human intervention. The alteration can be performed on the material within or removed from, its natural environment or state. Specifically, e.g., a promoter sequence is recombinant when it is produced by the expression of a nucleic acid segment engineered by the hand of man. For example, a recombinant nucleic acid is one that is made by recombining nucleic acids, e.g., during cloning, DNA shuffling or other procedures, or by chemical or other mutagenesis; a recombinant polypeptide or recombinant protein is a polypeptide or protein which is produced by expression of a recombinant nucleic acid; and a recombinant virus, e.g., a recombinant AAV virus, is produced by the expression of a recombinant nucleic acid.
(104) The term regulatory element, as used herein, refers to a region or regions of a nucleic acid sequence that regulates transcription. Exemplary regulatory elements include, but are not limited to, enhancers, post-transcriptional elements, transcriptional control sequences, and such like.
(105) The term RNA segment refers to an RNA molecule that has been isolated free of total cellular RNA of a particular species. Therefore, RNA segments can refer to one or more RNA segments (either of native or synthetic origin) that have been isolated away from, or purified free from, other RNAs. Included within the term RNA segment, are RNA segments and smaller fragments of such segments.
(106) The terms substantially corresponds to, substantially homologous, or substantial identity, as used herein, denote a characteristic of a nucleic acid or an amino acid sequence, wherein a selected nucleic acid or amino acid sequence has at least about 70 or about 75 percent sequence identity as compared to a selected reference nucleic acid or amino acid sequence. More typically, the selected sequence and the reference sequence will have at least about 76, 77, 78, 79, 80, 81, 82, 83, 84 or even 85 percent sequence identity, and more preferably, at least about 86, 87, 88, 89, 90, 91, 92, 93, 94, or 95 percent sequence identity. More preferably still, highly homologous sequences often share greater than at least about 96, 97, 98, or 99 percent sequence identity between the selected sequence and the reference sequence to which it was compared.
(107) The percentage of sequence identity may be calculated over the entire length of the sequences to be compared, or may be calculated by excluding small deletions or additions which total less than about 25 percent or so of the chosen reference sequence. The reference sequence may be a subset of a larger sequence, such as a portion of a gene or flanking sequence, or a repetitive portion of a chromosome. However, in the case of sequence homology of two or more polynucleotide sequences, the reference sequence will typically comprise at least about 18-25 nucleotides, more typically at least about 26 to 35 nucleotides, and even more typically at least about 40, 50, 60, 70, 80, 90, or even 100 or so nucleotides.
(108) When highly-homologous fragments are desired, the extent of percent identity between the two sequences will be at least about 80%, preferably at least about 85%, and more preferably about 90% or 95% or higher, as readily determined by one or more of the sequence comparison algorithms well-known to those of skill in the art, such as e.g., the FASTA program analysis described by Pearson and Lipman (1988).
(109) As used herein, the term structural gene is intended to generally describe a polynucleotide, such as a gene, that is expressed to produce an encoded peptide, polypeptide, protein, ribozyme, catalytic RNA molecule, or antisense molecule.
(110) The term subject, as used herein, describes an organism, including a mammal such as a human primate, to which treatment with one or more of the disclosed compositions may be provided. Mammalian species that may benefit from the disclosed treatment methods include, without limitation, humans, non-human primates such as apes; chimpanzees; monkeys, and orangutans, domesticated animals, including dogs and cats, as well as livestock such as horses, cattle, pigs, sheep, and goats, or other mammalian species including, without limitation, mice, rats, guinea pigs, rabbits, hamsters, and the like.
(111) As used herein, the terms terminal repeat or TR mean a nucleic acid sequence derived from an AAV that is required in cis for replication and packaging of AAV.
(112) Transcriptional regulatory element refers to a polynucleotide sequence that activates transcription alone or in combination with one or more other nucleic acid sequences. A transcriptional regulatory element may include, for example, one or more promoters, one or more response elements, one or more negative regulatory elements, one or more enhancers, or any combination thereof
(113) As used herein, a transcription factor recognition site and a transcription factor binding site refer to a polynucleotide sequence(s) or sequence motif(s) that are identified as being sites for the sequence-specific interaction of one or more transcription factors, frequently taking the form of direct protein-DNA binding. Typically, transcription factor binding sites can be identified by DNA footprinting, gel mobility shift assays, and the like, and/or can be predicted based on known consensus sequence motifs, or by other methods known to one of ordinary skill in the relevant molecular biological and virology arts.
(114) Transcriptional unit refers to a polynucleotide sequence that comprises at least a first structural gene operably linked to at least a first cis-acting promoter sequence and optionally linked operably to one or more other cis-acting nucleic acid sequences necessary for efficient transcription of the structural gene sequences, and at least a first distal regulatory element as may be required for the appropriate tissue-specific and developmental transcription of the structural gene sequence operably positioned under the control of the promoter and/or enhancer elements, as well as any additional cis sequences that are necessary for efficient transcription and translation (e.g., polyadenylation site(s), mRNA stability controlling sequence(s), etc.
(115) As used herein, the term transformed cell is intended to mean a host cell whose nucleic acid complement has been altered by the introduction of one or more exogenous polynucleotides into that cell.
(116) As used herein, the term transformation is intended to generally describe a process of introducing an exogenous polynucleotide sequence (e.g., a viral vector, a plasmid, or a recombinant DNA or RNA molecule) into a host cell or protoplast in which the exogenous polynucleotide is incorporated into at least a first chromosome or is capable of autonomous replication within the transformed host cell. Transfection, electroporation, and naked nucleic acid uptake all represent examples of techniques used to transform a host cell with one or more polynucleotides.
(117) As used herein, the terms treat, treating, and treatment refer to the administration of one or more compounds (either alone or as contained in one or more pharmaceutical compositions) after the onset of clinical symptoms of a disease state so as to reduce, or eliminate any symptom, aspect or characteristic of the disease state. Such treating need not be absolute to be deemed medically useful. As such, the terms treatment, treat, treated, or treating may refer to therapy, or to the amelioration or the reduction, in the extent or severity of disease, of one or more symptom thereof, whether before or after its development afflicts a patient.
(118) As used herein, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked, e.g., a plasmid. One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication. Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked. An rAAV vector is a recombinant AAV-derived nucleic acid containing at least one terminal repeat (TR) sequence.
(119) The use of virion is meant to describe a virus particle that contains a nucleic acid and a protein coat (capsid). An rAAV virion is a virion that includes nucleic acid sequences and/or proteins derived from a rAAV vector.
(120) As used herein, the term tropism refers to the cells and/or tissues of a host which support growth of a particular serotype of AAV. Some serotypes may have a broad tissue tropism and can infect many types of cells and tissues. Other serotypes may infect primarily a single tissue or cell type.
(121) The term a sequence essentially as set forth in SEQ ID NO: X means that the sequence substantially corresponds to a portion of SEQ ID NO: X and has relatively few nucleotides (or amino acids in the case of polypeptide sequences) that are not identical to, or a biologically functional equivalent of, the nucleotides (or amino acids) of SEQ ID NO: X. The term biologically functional equivalent is well understood in the art, and is further defined in detail herein. Accordingly, sequences that have about 85% to about 90%; or more preferably, about 91% to about 95%; or even more preferably, about 96% to about 99%; of nucleotides that are identical or functionally equivalent to one or more of the nucleotide sequences provided herein are particularly contemplated to be useful in the practice of the invention.
(122) Suitable standard hybridization conditions for the present invention include, for example, hybridization in 50% formamide, 5Denhardt's solution, 5 SSC, 25 mM sodium phosphate, 0.1% SDS and 100 g/ml of denatured salmon sperm DNA at 42 C. for 16 h followed by 1 hr sequential washes with 0.1 SSC, 0.1% SDS solution at 60 C. to remove the desired amount of background signal. Lower stringency hybridization conditions for the present invention include, for example, hybridization in 35% formamide, 5Denhardt's solution, 5 SSC, 25 mM sodium phosphate, 0.1% SDS and 100 g/ml denatured salmon sperm DNA or E. coli DNA at 42 C. for 16 h followed by sequential washes with 0.8 SSC, 0.1% SDS at 55 C. Those of skill in the art will recognize that conditions can be readily adjusted to obtain the desired level of stringency.
(123) Naturally, the present invention also encompasses nucleic acid segments that are complementary, essentially complementary, and/or substantially complementary to at least one or more of the specific nucleotide sequences specifically set forth herein. Nucleic acid sequences that are complementary are those that are capable of base-pairing according to the standard Watson-Crick complementarity rules. As used herein, the term complementary sequences means nucleic acid sequences that are substantially complementary, as may be assessed by the same nucleotide comparison set forth above, or as defined as being capable of hybridizing to one or more of the specific nucleic acid segments disclosed herein under relatively stringent conditions such as those described immediately above.
(124) As described above, the probes and primers of the present invention may be of any length. By assigning numeric values to a sequence, for example, the first residue is 1, the second residue is 2, etc., an algorithm defining all probes or primers contained within a given sequence can be proposed: n to n+y, where n is an integer from 1 to the last number of the sequence and y is the length of the probe or primer minus one, where n+y does not exceed the last number of the sequence. Thus, for a 25-basepair probe or primer (i.e., a 25-mer), the collection of probes or primers correspond to bases 1 to 25, bases 2 to 26, bases 3 to 27, bases 4 to 28, and so on over the entire length of the sequence. Similarly, for a 35-basepair probe or primer (i.e., a 35-mer), exemplary primer or probe sequence include, without limitation, sequences corresponding to bases 1 to 35, bases 2 to 36, bases 3 to 37, bases 4 to 38, and so on over the entire length of the sequence. Likewise, for 40-mers, such probes or primers may correspond to the nucleotides from the first basepair to bp 40, from the second bp of the sequence to bp 41, from the third bp to bp 42, and so forth, while for 50-mers, such probes or primers may correspond to a nucleotide sequence extending from bp 1 to bp 50, from bp 2 to bp 51, from bp 3 to bp 52, from bp 4 to bp 53, and so forth.
(125) In certain embodiments, it will be advantageous to employ one or more nucleic acid segments of the present invention in combination with an appropriate detectable marker (i.e., a label,), such as in the case of employing labeled polynucleotide probes in determining the presence of a given target sequence in a hybridization assay. A wide variety of appropriate indicator compounds and compositions are known in the art for labeling oligonucleotide probes, including, without limitation, fluorescent, radioactive, enzymatic or other ligands, such as avidin/biotin, etc., which are capable of being detected in a suitable assay. In particular embodiments, one may also employ one or more fluorescent labels or an enzyme tag such as urease, alkaline phosphatase or peroxidase, instead of radioactive or other environmentally less-desirable reagents. In the case of enzyme tags, colorimetric, chromogenic, or fluorigenic indicator substrates are known that can be employed to provide a method for detecting the sample that is visible to the human eye, or by analytical methods such as scintigraphy, fluorimetry, spectrophotometry, and the like, to identify specific hybridization with samples containing one or more complementary or substantially complementary nucleic acid sequences. In the case of so-called multiplexing assays, where two or more labeled probes are detected either simultaneously or sequentially, it may be desirable to label a first oligonucleotide probe with a first label having a first detection property or parameter (for example, an emission and/or excitation spectral maximum), which also labeled a second oligonucleotide probe with a second label having a second detection property or parameter that is different (i.e., discreet or discernable from the first label. The use of multiplexing assays, particularly in the context of genetic amplification/detection protocols are well-known to those of ordinary skill in the molecular genetic arts.
(126) In accordance with the present invention, polynucleotides, nucleic acid segments, nucleic acid sequences, and the like, include, but are not limited to, DNAs (including and not limited to genomic or extragenomic DNAs), genes, peptide nucleic acids (PNAs) RNAs (including, but not limited to, rRNAs, mRNAs and tRNAs), nucleosides, and suitable nucleic acid segments either obtained from natural sources, chemically synthesized, modified, or otherwise prepared or synthesized in whole or in part by the hand of man.
EXAMPLES
(127) The following examples are included to demonstrate illustrative embodiments of the invention. It should be appreciated by those of ordinary skill in the art that the techniques disclosed in these examples represent techniques discovered to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of ordinary skill in the art should, in light of the present disclosure appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1
(128) Step 1: Sub-Libraries Assembly.
(129) Using pITR3-R3C3-AatII as a template, the following ten PCR reactions were conducted:
(130) TABLE-US-00003 PCR Primers fragment size A3CL-A (VRs-I, V, VI): 1. A3CL-F + A3CL-A1R (before VR-I) 86 bp 2. A3CL-A1F + A3CL-A2R (VR-I to most of VR-V) 747 bp 3. A3CL-A2F + A3CL-A3R (part of VR-V to VR-VI) 136 bp 4. A3CL-A3F + A3CL-R (after VR-VI) 281 bp A3CL-B (VR-IV): 5. A3CL-F + A3CL-B1R (before VR-IV) 647 bp 6. A3CL-B1F + A3CL-R (VR-IV to end) 556 bp A3CL-C (VR-VII): 7. A3CL-F + A3CL-C1R (before VR-VII) 935 bp 8. A3CL-C1F + A3CL-R (VR-VII to end) 266 bp A3CL-D (VR-VIII): 9. A3CL-F + A3CL-D1R (before VR-VIII) 1055 bp 10. A3CL-D1F + A3CL-R (VR-VIII to end) 147 bp
(131) The respective PCR fragments were eluted from the agarose gel, mixed at equimolar ratios as indicated above for sub-libraries A, B, C, and D, and subjected to 15 cycles of overlap extension (OE) without primers, followed by 20 cycles of PCR using A3CL-F forward and A3CL-R reverse primers. The resulting fragments of 1140 bp for each of the A (I+V+VI), B (IV), C (VII), or D (VIII) sub-libraries were purified on agarose gel and eluted in small volume H.sub.2O. Using isothermal DNA assembly protocol, the respective fragments were individually sub-cloned into gel-purified pTR3-R3C3-AatII digested with AatII+ApaI. Four plasmid libraries A, B, C, and D, incorporating the respective VRs were derived. The estimated plasmid libraries' complexities were the following: A4.410.sup.7; B1.710.sup.7; C110.sup.8; D110.sup.8.
(132) Step 2: Pre-Selecting Structurally Compatible Parent Viral Libraries.
(133) Using plasmid libraries from Step 1, viral sub-libraries A, B, C, and D were packaged, AAV virus from each preparation was purified using iodixanol density gradients, and the viral DNAs were isolated. Next, using viral DNAs as templates, the following PCR reactions were conducted: 1. VR-I, primers A3CL-F+VR-I_IV-R, template A, size 644 bp. 2. VR-IV, primers VR-I_IV-F+VR-IV_V-R, template B, size 145 bp. 3. VR-V+VI, primers VR-IV_V-F+VR-VI_VII-R, template A, size 194 bp. 4. VR-VII, primers VR-VI_VR-VII-F+A3CL-R, template C, size 274 bp. 5. VR-VIII, primers A3CL-F and A3CL-R, template D, size 1140 bp.
(134) The respective PCR fragments were gel-purified and used as the templates in the OE/PCR to derive two PCR fragments, each of 1140 bp: A+B+C (VR-I, IV, V, VI, VII) and D (VR-VIII).
(135) Step 3: Packaging Master Libraries.
(136) Using isothermal DNA assembly protocol, the respective fragments were individually sub-cloned into gel-purified pTR3-R3C3-AatII digested with AatII+ApaI. The estimated plasmid library A+B+C complexity was 2.510.sup.7, plasmid library D complexity was 410.sup.7. Using these plasmid libraries, two final master viral libraries were packaged: ABC, with the titer of 5.710.sup.12 drp/ml, and D, with the titer of 8.710.sup.12 drp/ml. The assembly flowchart is shown in
(137) TABLE-US-00004 TABLE 1 Theoretical (calculated) complexities of A3CL for individual VRs and combinations of VRs. The VRs and VRs combinations constructed as sub-libraries are shown in bold font. VR Complexity I 72 IV 2.1 10.sup.6 V 27,648 VI 144 VII 4 10.sup.7 VIII 5.44 10.sup.8 I + V 1.99 10.sup.6 I + VI 1.04 10.sup.4 I + V + VI 2.87 10.sup.8 V + VI 3.98 10.sup.6 I + IV + V + VI + VII .sup.2.37 10.sup.22 I + IV + V + VI + VII + VIII .sup.1.29 10.sup.31
(138) TABLE-US-00005 TABLE 2 Theoretical (calculated) complexities of constructed sub-libraries A, B, C, and D. Sub-library VRs Complexity A3CL-A I V VI 2.9 10.sup.8 A3CL-B IV .sup.2 10.sup.6 A3CL-C VII .sup.4 10.sup.7 A3CL-D VIII 5.4 10.sup.8
(139) TABLE-US-00006 TABLE3 SyntheticoligonucleotidesusedtoassembletheAAV3Bcapsidlibrary Name Sequence A3CL-F GGCTGGGCGACAGAGTCATC (SEQIDNO:6) A3CL-A1R GCTGGAGATTTGCTTGTAGAGATG (SEQIDNO:7) A3CL-A1F CATCTCTACAAGCAAATCTCCAGCVVMDCAGGAGCTASCAACGACAACCACTACTTTGGC (SEQIDNO:8) A3CL-A2R CCAAGGAAASTYACTGTTGTTGTTSYSGBYGKVGRYTKTTGAAAGTCTCTGTTGCC (SEQIDNO:9) A3CL-A2F AACAACAACAGTRASTTTCCTTGGMCAGCGGCCAGCAMATATCATCTCAATG (SEQIDNO:10) A3CL-A3R GATTGCCGTGCATAGGGAAAAATYTSYCSKYATCGTCCYYGTGACTGGCCATAGCTGG (SEQIDNO:11) A3CL-A3F ATTTTTCCCTATGCACGGCAATC (SEQIDNO:12) A3CL-R CATCCGTGTGAGGAATCTTTGC (SEQIDNO:13) A3CL-B1R TTGCGTTCTGTTCAGGTAGTACAGA (SEQIDNO:14) A3CL-B1F CTGTACTACCTGAACAGAACGCAAARGCAMCVCNRGCGGAACARCCRVCMHSMRSVVSCTG VNGTTTAGCCAGGCTGGGCC (SEQIDNO:15) A3CL-C1R TTTGCCAAATATTAGATTGCC (SEQIDNO:16) A3CL-C1F CGGCAATCTAATATTTGGCAAASAARRCRSCRVSRVARVCRATRYCGMSDWCGRSVRS GTAATGATTACGGATGAAGAAG (SEQIDNO:17) A3CL-D1R CTGCAAGTTATTTGCCACAGTTC (SEQIDNO:18) A3CL-D1F GAACTGTGGCAAATAACTTGCAGRVSVVSMRSRVCVVSCCCACGDHTVVSRNSGTC VMSCATCAGGGGGCCTTACCTG (SEQIDNO:19) VR-I_IV-F CAGTATCTGTACTACCTGAACAGAACGC (SEQIDNO:20) VR-I_IV-R GCGTTCTGTTCAGGTAGTACAGATACTG (SEQIDNO:21) VR-IV_V-F CCTGGGCCCTGCTACCGGCAACAGAG (SEQIDNO:22) VR-IV_V-R CTCTGTTGCCGGTAGCAGGGCCCAGG (SEQIDNO:23) VR-VI_VII-F CCCTATGCACGGCAATCTAATATTTGGC (SEQIDNO:24) VR-VI_VII-R GCCAAATATTAGATTGCCGTGCATAGGG (SEQIDNO:25)
NGS Sequencing. Number of sequences processed: 1817050 Number of distinct sequences (complexity): 1708473 (0.94)
(140) TABLE-US-00007 Copy number distribution Copy number Number of sequences 1 1603700 2 101430 3 3257 4 83 5 2 377 1
(141) TABLE-US-00008 TABLE4 ExamplesofthemostrepresentativevariantswithinVRsIV,V,VI,andVIIfrom themastervirallibraryABCasdeducedfromtheNGSsequencing(thedotsineach ofsequences1-86correspondingtoSEQIDNOs:26and27-112below representaminoacidresiduesthatareidenticaltothose listedinwildtypeasshownbelow). 450491528546 cn % Wildtype GTTSGTTNQSRLLKTANDNNNSNFPWTAASKKDDEEKEGTTASNAELDN 1 ................................................. 377 0.0 2 .N.G...SP...R.IYDR............TG..TGRQ..GEG.V.VGK 5 0.0 3 S......G.RK.A.AYGH....D...P...TG...DRQDSGENDVAIGR 5 0.0 4 ..A....AN.N.K..YS..............G..DDR...DGA.V.I.R 4 0.0 5 ..P...AAHKT.E..SAE.............G..AGR.DAEGGD.AIGG 4 0.0 6 S.AG..AT.KA.T.VHAH.............E..TGRQDA.R..VAFEE 4 0.0 7 .NP....GLRG.TT.D.E........P.......AG.Q..DGN.IAFGE 4 0.0 8 .N.....SKRP.MT...E............TE..N.R.DAKGTDT.F.R 4 0.0 9 SNA....GIHQ.KTAPDR....E........E..NGRQNGATADT.VER 4 0.0 10 SN.G...AMRE.E.AP........K.....TE..TG..S.AETDV.DGR 4 0.0 11 SNA...AGLQ..K.IPDQ................NG.QSGG.ADIDNG. 4 0.0 12 .NP....APH...TIH.G........P...T...DGRQDGGT..IDI.G 4 0.0 13 ..P....DLRE.A.IP..............TE...DR............ 4 0.0 14 SNP...A.PRT.M.IDAH....E...P...TE..NG.QSS.TGDV.D.D 4 0.0 15 .NA....DTK..T.ASGG............T...DD...SNRDD..V.R 4 0.0 16 .N.G...DIR..R..HSE....E.......T...N.RQD.RETDVAI.R 4 0.0 17 .NA...AGMRE.M.A..H.............E...D..SGS.DDVAIGR 4 0.0 18 SN.G..ATPKQ.Q.ASAH....E.............R..S.RNDIANEH 4 0.0 19 SN.G..A.IKE.T..S..............TR..ND.QSASKNDI.YEQ 4 0.0 20 SNAG...SNRE.RT.SSQ............TR..DDRQDAGGNDV.VGD 4 0.0 21 SN....ATT.A.K..YGH.............G..T..Q.GS.N.V.VES 4 0.0 22 SNAG..AATN....IYDR............TR...D...GEKG.VDI.R 4 0.0 23 S.P....ATKG.TTAHTG.............G..DG...S..TDVAIGS 4 0.0 24 .N.G...DLR..MT.D.H....E...P...TG..KGR.NGAKNDIAFEG 4 0.0 25 S......TLKA.QIP.R.............TG...DR.NSKGA.T.I.E 4 0.0 26 .......DPKD.VT.HG.....D.......T...DD..D.A.D.V.FGR 4 0.0 27 S.AG...TIKD.V.VPD.....K........E..D.RQDSG.T.V.FGR 4 0.0 28 ...G...TMRK.G.VYGG............TE..A.RQSSGRNDV.YGD 4 0.0 29 .N.G..ASTR..T.IPDQ........P....E...GRQSAEKGDI.YGR 4 0.0 30 .N.....ATHT.A.IHSR....D...P....E..AG.Q.A..G.IDVEQ 4 0.0 31 SNPG...SIRG.QTIP.R........P...TR..TD.Q.GG.G.TDF.H 4 0.0 32 S.....AAPRG.VTVYGH....E............GR..AG...VAIEE 4 0.0 33 .NA...ATKQG.M.VP.Q....D...........DDRQSSDKN...D.S 4 0.0 34 SNAG..ATT.Q.RTAPAE........P...TR..ADR.SGRGD.VDFEK 4 0.0 35 SN.G..AGIRA.Q.VDTG....D.......TE..T...NSARND.DIGR 4 0.0 36 .NA...AA.NG.R.IP.E....K.......T....G..SSSGDD..FGG 4 0.0 37 SN....AGPQQ.R..HAQ.............E..TG...AR.NDIAF.Q 4 0.0 38 S.P....SMRT.E.APAR....E.......TR..AG.Q.SRENDT.F.G 4 0.0 39 S.AG...ALKG.KTI.DH....E...P...TR..K...DS.GA.IAD.R 4 0.0 40 S.P...ASTRT.M..H.H....E.......T....D....E.T.VAIGG 4 0.0 41 .NPG....NQA.R.IHGQ....D.......TR..ND...SARGDVAYEK 4 0.0 42 SNA....DTRE.VTI.D.....E.......TR..TD.Q.SAGADV.VEK 4 0.0 43 SNPG....LRE.RTIHTE....E.......TR..KDRQ.GGGT.V.IGS 4 0.0 44 ...G..A.NNT...I.SG............T...KGR..AEKNDTAVG. 4 0.0 45 .......DKQQ.M..H.G....D........E..TG.QSAEGN.VAY.G 4 0.0 46 ..AG..ATL.T.V.ISAG....D........G..NG.QNS...DVAI.G 4 0.0 47 SN....AGLRT.T.ADA.....D...P...TG..NG..DASGN.V.DGR 4 0.0 48 SNA...ATP.T.R..DTH....E...P....R..NDR..ARG..IDVGD 4 0.0 49 S.A...ASLRA.M.VP.R............TG..ND..NAR..D..V.R 4 0.0 50 ..A...ATTKG...ISTQ.............E..AD.Q.GETD.VDVGD 4 0.0 51 ..A...AALKQ.A.ADS.............TE..ADRQ.GETG.I.Y.G 4 0.0 52 .NA...ATT.N.M.ADDR............T....DRQ.AKR.DTAVEE 4 0.0 53 ..AG..A.MKD.RT..SE....D.......TE..KD...ANGGDVAIGQ 4 0.0 54 S.PG...TIRD.KTVST.....D...P...T...DDR..SGRN.VAVEE 4 0.0 55 S.P...A.INT.R..P.R............TE...GRQSA.KDDVDIGG 4 0.0 56 .N.G..AGLQK.M..HGG........P...T...DG.QSSRGNDVAV.D 4 0.0 57 .N.....TPRT.A.IPSH....E..............Q.SNG..I.FGS 4 0.0 58 SNAG..AGLRQ.T.APAE....D.......TE..AG...GGGA.IAVEE 4 0.0 59 ..A...AAK.T.V.ISTR............TE........SKNDV.VE. 4 0.0 60 .......TTR..MIYGG.............TE..AGRQ..ATA.V.VES 4 0.0 61 ..AG..AGMRE.ATIYTG.................GR..SSTGD.DVGR 4 0.0 62 S..G..A.PKE.RTA..H....E.......TE...D.Q.AGE..VAI.G 4 0.0 63 .......GT.T.R..DTG.............G....R..AGTAD.AV.G 4 0.0 64 .NAG....KRD..TAYTR....D.......T...D..Q..GKTD.DNGG 4 0.0 65 .NA....DMKH.T.ISDR........P...TR..N.RQS.RGG...I.G 4 0.0 66 SN.G..ADLRD..TIPTQ....E...........NDRQSAK.NDV.V.R 4 0.0 67 S.A....ATQQ.VT.DSQ....E.......TR..NDR.NAEGG.V.IGQ 4 0.0 68 .NAG...ANKT.M.I.AH....E.......TR..DG.QDSS.D.I.YGK 4 0.0 69 .NAG...GTKE.RTI..E............T...D...DAKRN.VDY.G 4 0.0 70 SNP....GK.S.K..S.E................NG..DSR.GD.DFEK 4 0.0 71 .N....ASIRQ.Q..PDG....K........R..NGR..S.EG.I.IEG 4 0.0 72 .N.G...TL.A.GTAHTQ.............R..ND.QSS.GGDTAF.G 4 0.0 73 SNP....TTQ..Q..D......D...P...TR..TDR..S.GGD..IER 4 0.0 74 SNA....TMRK.GTISSG........P....G..N..QDSSENDVADER 4 0.0 75 S.AG..ATMQ..MT.DTG............TR..N.RQ.GEGGDI.D.R 4 0.0 76 ..AG..ATTRD.QT.DDH....D...........NGRQ.GRGA.TAYEG 4 0.0 77 ...G..AAM.A.RT.DDG....K...P...........DGGT...AIGD 4 0.0 78 .N.....TNRE.M.IP..............TR...D..D.GRADV.VGR 4 0.0 79 SNAG..ADKQD.VTAHSE.............E..DDRQ.AAGGDI.VGS 4 0.0 80 .NA...AATHE..T.HDH....D........R..A.R..GAK.DVDFGS 4 0.0 81 SNA...ADTRH.MT.PGE....D...P...TG..TG.Q.SATTDI.YGE 4 0.0 82 SN.....A..K.Q.IH.R....D.......TR..DDRQ.AEG.DVAVGD 4 0.0 83 .NP...AD.RA.Q.IPTG....D.......TR..T..Q..GG.DI.IGG 4 0.0 84 SNA...AGLNA.K.AYTH....D.......TG..D.R.NAK.G..AI.G 4 0.0 85 .NP.....LQ..M.IDDQ........P...T....D..SGGTADVAV.K 4 0.0 86 ......ASIQ..Q..YA.....E.......T....D..SAAG.DT.V.G 4 0.0
Calculated plasmid library complexity based on colony count (2.5107) and NGS sequencing (0.94 of unique sequences) is 2.35107. WT AAV3 contamination is 0.02%.
Example 2
(142) Q5 PCR:
(143) 50 l: 10 p 5B Q5 0.4 l 25 mM dNTPs 2.5 l F 2.5 l R 1 l (1 ng) pITR3-R3C3-AatII 0.5 l Q5 Pol H.sub.2O up to 50 l
(144) TABLE-US-00009 98 C. 30 sec 30 cycles 98 C. 10 sec 65 C. 20 sec 72 C. 30 sec 72 C. 2 min
See
(145) TABLE-US-00010 TABLE 5 Size Conc. l/5 10.sup.9 Fragment (bp) (g/ml) nM copies A 1 86 10.4 186 2.2 I + V + VI 2 747 33.3 69 6 3 136 13.2 149 2.8 4 281 35.4 194 2.1 B 5 647 48 114 3.6 IV 6 556 29.4 81 5.1 C 7 935 22.5 37 11.2 VII 8 266 11.2 65 6.4 D 9 1055 38.8 57 7.3 VIII 10 147 35.9 376 1.1
(146) TABLE-US-00011 TABLE 6 OE Q5 PCR 1 2 3 4 5 6 7 8 9 10 5xB dNTP A3CL-F A3CL-R Q5 H.sub.2O A 2.2 6 2.8 2.1 10 0.4 2.5 2.5 0.5 26 B 3.6 5.1 10 0.4 2.5 2.5 0.5 30.4 C 11.2 6.4 10 0.4 2.5 2.5 0.5 21.5 D 7.3 1.1 10 0.4 2.5 2.5 0.5 30.7 1. Assays A, B, C, and D are assembled without primers, substituting H.sub.2O for the primers' volumes (5 l) and subjected to the following overlap extension:
(147) TABLE-US-00012 98 C. 30 sec 15 cycles 98 C. 10 sec 65 C. 20 sec 72 C. 60 sec 72 C. 2 min 2. 40 l each A, B, C, and D from Step 1 transferred to 10 l containing:
(148) TABLE-US-00013 X5 2.5 l A3CL-F 12.5 2.5 l A3CL-R 12.5 2 l 5 B Q5 10 0.08 l dNTPs 0.4 0.1 l Q5 0.5 2.82 l H.sub.2O 14.1
Assays are subjected to the following PCRs:
(149) TABLE-US-00014 98 C. 30 sec 20 cycles 98 C. 10 sec 59 C. 20 sec 72 C. 60 sec 72 C. 2 min
See
(150) TABLE-US-00015 TABLE 7 pmoles/40 Size Conc. Molarity Conc. l/40 l l assay (bp) (ng/l) (nM) (pmoles/l) assay (3:1) A 1091 47.5 67 0.067 2.1 0.144 (100 ng) B 1091 58.3 82 0.082 1.8 0.144 (100 ng) C 1091 49.9 70 0.07 2.1 0.144 (100 ng) D 1091 60.9 86 0.086 1.7 0.144 (100 ng) pITR3-R3C3- 6594 54.3 13 0.013 3.7 0.048 AatlI AatIl-Apal (200 ng) cut
(151) TABLE-US-00016 40 l assay: 20 l 2xGibson Master Mix (NEB) + A B C D pITR3 H.sub.2O 2.1 3.7 14.2 A 1.8 3.7 14.5 B 2.1 3.7 14.2 C 1.7 3.7 14.6 D
Large-Scale IDA for the Loop A 300 l assay: 150 l 2Gibson Master Mix 27.6 l pITR3-R3C3-AatII AatII-ApaI cut (1.5 g) 15.8 l A (0.75 g) 106.6 l H.sub.2O
(152) Incubated 2 h, 50 C., Zymo-purified, eluted in 100 l H.sub.2O, combined with 47.5 l of A from the pilot IDA above. Total1.7 g of vector plasmid DNA.
(153) Lucigen competent cells were prepared from 4 L LB, resuspended in 8.5 ml H.sub.2O final volume. The cell density (10 l in 3 ml H.sub.2O) was A.sub.550=0.79.
(154) Combined DNA (147.5 l) was mixed with the whole volume of competent cells and aliquoted (385 l/aliquot, 10 ng plasmid DNA/50 l competent cells) into electroporation cuvettes (total of 20, with outside tall electrodes) and zapped at 2.9 KV.
(155) Cells were transferred into 1 L LB, incubated shaking at 37 C. for 1 h. Carbenicillin was added up 100 g/ml, cell were grown at 30 C., o/n.
(156) Total complexity from the large-scale IDA/transformation is 4.410.sup.7 clones.
(157) Repeat IDA for the Loop C
(158) 100 l assay: 50 l 2Gibson Master Mix 9.25 l pITR3-R3C3-AatII AatII-ApaI cut (0.5 g) 5.25 l C (0.25 g) 35.5 l H.sub.2O Zymo, 50 l H.sub.2O.
(159) Competent cells were prepared from 4 L LB (grown to A.sub.550=0.6) and resuspended in a final volume 8 ml H.sub.2O. The cell density (10 l in 3 ml H.sub.2O) was A.sub.550=1.46.
(160) 180 ng vector with fragment B from the pilot IDA were electroporated with 1 ml of comp. cells, whereas 0.68 g with fragment Cwith 3 ml of cells.
(161) After electroporation the complexity of B was 1.710.sup.7 (5 times over theoretical complexity), while C 110.sup.8 (2.5 times over theoretical complexity).
(162) TABLE-US-00017 TABLE 8 Pilot Large-scale A B C D A B C D Complexity total 0.9 10.sup.5 0.7 10.sup.5 1.4 10.sup.5 0.9 10.sup.5 4.4 10.sup.7 1.7 10.sup.7 1 10.sup.8 1 10.sup.8 Volume (l) 400 400 400 400 1000 100 500 1000 Complexity/l 225 175 525 225 4.4 10.sup.4 1.7 10.sup.5 2 10.sup.5 10.sup.5 DNA concentration 342 220 241 334 1690 1100 2100 2000 (ng/l) Copies/l 4.2 10.sup.10 2.6 10.sup.10 2.9 10.sup.10 4 10.sup.10 2 10.sup.11 1.3 10.sup.11 2.5 10.sup.11 2.4 10.sup.11 Representation 1.9 10.sup.8 1.5 10.sup.8 0.6 10.sup.8 1.8 10.sup.8 4.5 10.sup.6 7.6 10.sup.5 1.3 10.sup.6 2.4 10.sup.6 (copies/variant/l) Dilution factor 42.2 197.4 46.2 75 Final DNA 0.55 1.1 1 concentration after mixing equal volumes (g/l) Viral DNA 27.6 22.8 23.2 85.5 concentration, 80 l (g/ml) Titer (copies/l) 4.5 10.sup.9 4.6 10.sup.9 1.6 10.sup.10
Q5 PCR of Viral DNA
(163) Conditions, as above, except: 50 ng viral DNA/50 l assay, 20 PCR cycles 5 l out of 50 1. Loop I, primers A3CL-F+VR-I_IV-R, template A, size 644 bp 2. Loop IV, primers VR-I_IV-F+VR-IV_V-R, template B, size 145 bp 3. Loops V+VI, primers VR-IV_V-F+VR-VI_VII-R, tempi A, size 194 bp 4. Loop VII, primers VR-VI_VR-VII-F+A3CL-R, template C, size 274 bp
Remaining 45 l were purified using preparative gel, all four gel cutouts were pooled in one tube and purified using one column, final volume 50 l H.sub.2O.
See
Overlap Extension
(164) Full-length fragment was assembled without primers, substituting H.sub.2O for the primers' volumes (5 l) and subjected to the following overlap extension: 50 l: 10 l 5B Q5 0.4 l 25 mM dNTPs 25 l (out of 50 l) individual overlap 4 fragments mix (p. 12) 0.5 l Q5 Pol 14.1 l H.sub.2O
(165) TABLE-US-00018 98 C. 30 sec 15 cycles 98 C. 10 sec 65 C. 20 sec 72 C. 60 sec 72 C. 2 min
(166) After primer-less extension, the assay was split into 225 l assays supplemented with A3CL-F, and A3CL-R primers, DNTPs, and fresh Q5, total volume 50 l each.
(167) Assays are subjected to the following PCRs:
(168) TABLE-US-00019 98 C. 30 sec 20 cycles 98 C. 10 sec 59 C. 20 sec 72 C. 60 sec 72 C. 2 min ABC fragment was eluted in 50 l, concentration 60 ng/l (0.085 pmoles/l). D fragment was eluted in 50 l, concentration 46 ng/l (0.065 pmoles/l).
See
IDA Using NE Builder Master Mix Total volume200 l, plasmid 1.5 g (0.348 pmoles), insert0.5 g (0.7 pmoles), total DNA amount 1 pmole/200 l assay. Reaction 60 min @ 50 C. Lucigen electrocompetent E. coli cells, 8 ml, final density 0.8 A550. Library's complexity 2.510.sup.7.