Blood biomarkers and diagnostic methods for small vessel diseases

12188950 ยท 2025-01-07

Assignee

Inventors

Cpc classification

International classification

Abstract

The present subject matter provides, inter alia, compositions, systems, kits, and methods for diagnosing and treating small vessel diseases (SVDs).

Claims

1. A method comprising: providing a test sample from a subject comprising whole blood, plasma, or serum; assaying the sample to determine a level of: (i) Neurogenic Locus Notch Homolog Protein 3 (NOTCH3) extracellular domain (N3ECD), (ii) collagen181/endostatin and (iii), High-Temperature Requirement A Serine Peptidase 1 (HTRA1) in the test sample.

2. The method of claim 1, wherein the subject is suspected of having CADASIL.

3. The method of claim 1, wherein (i) assaying the level of N3ECD comprises detecting the level of a N3ECD protein comprising the amino acid sequence of SEQ ID NO: 5; (ii) assaying the level of collagen181/endostatin comprises detecting the level of a collagen181/endostatin protein comprising the amino acid sequence of SEQ ID NO: 1; and/or (iii) assaying the level of HTRA1 comprises detecting the level of a HTRA1 protein having the amino acid sequence of SEQ ID NO: 9.

4. The method of claim 1, wherein (i) assaying the level of collagen181/endostatin comprises contacting the collagen181/endostatin protein with an anti-collagen181/endostatin antibody; (ii) assaying the level of HTRA1 comprises contacting the HTRA1 protein with an anti-HTRA1 antibody; and/or (iii) assaying the level of N3ECD comprises contacting the N3ECD protein with an anti-N3ECD antibody.

5. The method of claim 1, wherein (i) assaying the level of collagen181/endostatin comprises detecting the level of collagen181/endostatin mRNA; (ii) assaying the level of HTRA1 comprises detecting the level of HTRA1 mRNA; and/or (iii) assaying the level of N3ECD comprises detecting the level of N3ECD mRNA.

6. The method of claim 5, wherein (i) detecting the level of collagen181/endostatin mRNA comprises contacting the collagen181/endostatin mRNA with a probe or a primer that is complementary to SEQ ID NO: 2; (ii) detecting the level of HTRA1 mRNA comprises contacting the HTRA1 mRNA with a probe or a primer that is complementary to SEQ ID NO: 12; and/or (iv) detecting the level of N3ECD mRNA comprises contacting the N3ECD mRNA with a probe or a primer that is complementary to a nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 5.

7. The method of claim 1, wherein the subject does not contain a mutated HTRA1 gene.

8. The method of claim 1, which does not comprise assaying and/or detecting the level of Fas ligand (FasL).

9. The method of claim 1, wherein said subject has diabetes.

10. The method of claim 1, wherein assaying the level of collagen181/endostatin, HTRA1, and N3ECD comprises contacting said collagen181/endostatin, HTRA1, and/or N3ECD with a collagen181/endostatin-specific, HTRA1-specific and/or N3ECD-specific binding agent.

11. The method of claim 10, wherein said binding agent comprises an antibody or a fragment thereof, a polypeptide or a fragment thereof, or a nucleic acid.

12. The method of claim 11, wherein said binding agent comprises an antibody or a fragment thereof.

13. The method of claim 12, wherein said antibody comprises an anti-collagen181/endostatin antibody, an anti-HTRA1 antibody, or an anti-N3ECD antibody.

14. The method of claim 12, wherein said antibody or fragment thereof is attached to a solid support.

15. The method of claim 11, wherein said nucleic acid comprises a probe or a primer that is complementary to mRNA that encodes collagen181/endostatin, HTRA1, and/or N3ECD.

16. The method of claim 1, wherein said assaying comprises an enzyme immunoassay (EIA).

17. The method of claim 1, wherein said assaying comprises an enzyme-linked immunosorbent assay (ELISA), a Western blot, a mass spectrometry assay, a radioimmunoassay, or a fluoroimmunoassay.

18. The method of claim 1, wherein said assaying comprises high-performance liquid chromatography (HPLC), liquid chromatography-mass spectrometry (LC/MS), protein immunoprecipitation, immunoelectrophoresis, or protein immunostaining.

19. The method of claim 1, wherein said assaying comprises a polymerase chain reaction (PCR).

20. The method of claim 1, wherein said assaying comprises quantitative reverse transcription PCR, microarray analysis, RNA sequencing, Northern analysis, a Nuclease Protection Assay, or in situ hybridization.

Description

DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is set of images of dot blots relating to a proteomic screen in CADASIL mice. Dot blots represent levels of specific proteins, in technical duplicate, found in plasma from two male CADASIL mice collected at 100 or 200 days of age (N3KO; C455R+/; SM22-Cre) and two control (N3KO; WT76+/; SM22-Cre). IGFBP-1, SDF-1, and collagen181/endostatin were found to be differentially expressed, as established by a variance analysis.

(2) FIG. 2 is an image of a dot blot relating to a proteomic screen in N3KO mice. Dot blots show levels of specific proteins found in plasma from two male NOTCH3 knockout (N3KO) mice (200 d) or two rescued/control (N3KO; WT76+/; SM22-Cre) in which a wild type human NOTCH3 is expressed in VSMC. Col181/endostatin was found to be differentially expressed, as established by a variance analysis.

(3) FIGS. 3A and B are graphs showing that endostatin is misregulated in CADASIL. FIG. 3A: ELISA detection of endostatin in plasma from mice (200 d) expressing the human NOTCH3 CADASIL mutation (N3KO; C455R+/; SM22-Cre), or control (N3KO; WT76+/; SM22-Cre) showing that there is significantly more endostatin protein circulating in the blood of CADASIL mice. Number of biological replicates is indicated in parenthesis. FIG. 3B: Primary cultures of MEFs from Cre-inducible CADASIL (N3KO; C455R+/+) or control mice (N3KO; WT76+/+) were placed in monocultures or cocultures with cells expressing DLL1 (ROSA26.sup.DLL1+/+), a NOTCH ligand. Monocultures had no significant change in col181 mRNA expression, whereas cocultures with DLL1 significantly increased col181 mRNA expression. Expression was significantly more robust, however, in N3KO; WT76+/+ cocultures compared to N3KO; C455R+/+ cocultures. Asterisks (*) indicate P-value<0.05 (unpaired t-test).

(4) FIG. 4 is a graph showing that the HTRA1 protein is more abundant in the plasma of CADASIL mice. ELISA detection of HTRA1 in the plasma of mice (200 d) expressing the human NOTCH3 CADASIL mutation (N3KO; C455R+/; SM22-Cre), or control (N3KO; WT76+/; SM22-Cre) showing that there is significantly more HTRA1 protein circulating in the blood of CADASIL mice. Number of biological replicates is indicated in parenthesis. Asterisks (*) indicate P-value<0.05 (unpaired t-test).

(5) FIGS. 5A-D are graphs showing the detection of circulating human N3ECD using a custom ELISA. FIG. 5A: Linear range of the N3ECD ELISA was found to range up to 2 g/ml. FIG. 5B: N3ECD in human plasma and serum samples from patients with no known CADASIL mutations was significantly more abundant in human serum than plasma. Number of biological replicates is indicated in parenthesis. FIG. 5C: ELISA detection of human N3ECD in the plasma of mice (200 d) expressing the human NOTCH3 CADASIL mutation (N3KO; C455R+/; SM22-Cre), or control (N3KO; WT76+/; SM22-Cre) showing significantly less N3ECD protein circulating in the blood of CADASIL mice. Number of biological replicates is indicated in parenthesis. FIG. 5D: Primary cultures of MEFs from Cre-inducible CADASIL (N3KO; C455R+/+) or control mice (N3KO; WT76+/+), upon Adeno-Cre induction, expressed their respective transgenes at a similar level, irrespective of monoculture or coculture conditions. Asterisks (*) indicate P-value<0.05 (unpaired t-test).

(6) FIGS. 6A-D are images, and FIG. 6E is a graph, showing the loss of VSMC in the retina of CADASIL mice. FIG. 6A: Representative images of retinas from control mice (N3KO; WT76+/; SM22-Cre) stained with the VSMC marker SMA (red). FIG. 6B: Same image from FIG. 6A, merged with IB4 staining (green). Overlay image shows SMA staining in 81% of the vascularized area. FIG. 6C: Representative images of retinas from CADASIL mice (N3KO; C455R+/; SM22-Cre) stained with the VSMC marker SMA (red). FIG. 6D: Same image from FIG. 6C, merged with IB4 staining (green). Overlay image shows SMA staining in 55% of the total vascularized area. FIG. 6E: Quantification of VSMC coverage in the CADASIL mouse model. Merged images (see FIG. 8) of IB4 and SMA-stained retinas from control (N3KO; WT76+/; SM22-Cre) or CADASIL (N3KO; C455R+/; SM22-Cre) mice were quantified via Image J. To determine VSMC coverage, positive SMA staining was normalized to IB4. The number of biological replicates is indicated in parenthesis. Asterisks (*) indicate P-value<0.05 (unpaired t-test). The scale bar is 50 m.

(7) FIGS. 7A and B are tables showing results from candidate screening for CADASIL biomarkers. FIG. 7A: Relative expression of angiogenesis-related proteins in the plasma of mice expressing the human NOTCH3 CADASIL mutation (N3KO; C455R+/; SM22-Cre), or NOTCH3 knockouts (N3KO), compared to control (N3KO; WT76+/; SM22-Cre). Fold changes considered significant by variance analysis are highlighted in grey. N/D indicates proteins that were not detected. Fold changes are averages of two biological replicates. FIG. 7B: Mass spectrometry data of the aorta proteome from mice expressing the human NOTCH3 CADASIL mutation (N3KO; R1031C+/; SM22-Cre) compared to control (N3KO; WT76+/; SM22-Cre). HTRA1, highlighted in grey, was the highest Z scoring protein.

(8) FIGS. 8A-D are images showing VSMC loss in the retinal vasculature using retinal flat mounts. FIG. 8A: Representative images of retinas from control mice (N3KO; WT76+/; SM22-Cre), expressing the human WT NOTCH3, stained with the VSMC marker SMA (red). Image is centered on the optic nerve and the scale bar is 250 m. FIG. 8B: Same image from FIG. 8A, merged with Isolectin B4 staining (green). Scale bar is 250 m. FIG. 8C: Representative images of retinas from CADASIL mice (N3KO; C455R+/; SM22-Cre), expressing the NOTCH3 CADASIL mutation, stained with the VSMC marker SMA (red). Image is centered on the optic nerve and the scale bar is 250 m. FIG. 8D: Same image from panel A, merged with isolectin B4 staining (green). Scale bar is 250 m.

(9) FIG. 9 is a series of images showing N3ECD expression in the retinal vasculature using retinal flat mounts. NOTCH3 receptor protein was localized in humanized transgenic mice within the superficial retinal vasculature using an antibody that targets the extracellular domain of the human NOTCH3 protein (N3ECD). Vessels were detected using collagen IV antibodies (Col IV). Scale bar is 100 m.

(10) FIG. 10 is a series of images showing endostatin expression in the retinal vasculature using retinal flat mounts. Col181/endostatin protein was detected in the superficial retinal vasculature in N3KO; C455R+/:SM22Cre+ mice and N3KO; WT76+/; SM22Cre+ mice. Scale bar is 100 m.

(11) FIG. 11 is a graph comparing the ratio of the HTRA1 to NOTCH3 (i.e., N3ECD) in mice with a CADASIL mutation compared to mice without the mutation.

DETAILED DESCRIPTION

(12) The present disclosure provides biomarkers that are useful in treatment, diagnostic, and prognostic methods relating to SVD. Methods include body fluid tests (such as blood tests) for the levels of biomarkers associated with SVD. Prior to the present invention, there were no protein biomarkers were available for the diagnosis or prognosis of SVD changes associated with vascular degeneration. Brain SVD is detected using expensive imaging techniques such as magnetic resonance imaging (MRI) or laborious neurological and neuropsychological tests. Retina SVD is detected by retinal imaging of the consequences of vascular damage. There are also no methods for analysis of small vessel degeneration at preclinical stages.

(13) By using a model of a monogenic SVD affecting the brain and the retina, a group of proteins was identified to be biomarkers of SVD associated with progressive vascular degeneration. Measuring these biomarkers in biological fluids including blood, plasma, serum, tears, sweat, saliva, vitreous, cerebrospinal fluid, cerebrospinal fluid, or urine is useful for diagnostic and/or prognosis of SVD. Aspects of the present subject matter relate to the following unexpected discoveries: (i) NOTCH3 is a transmembrane cell surface receptor. It was unexpected that the extracellular domain of the receptor circulates in blood and/or body fluids and that its levels change in SVD. (ii) HTRA1 levels change in CADASIL, a condition that leads to stroke and vascular dementia. (iii) HTRA1 levels, independent of HTRA1 gene mutation status, change in subjects with SVD. (iv) The levels of a fragment of collagen181 known as endostatin change in the presence of SVD (v) The levels of IGFBP-1 change in subject with SVD.

(14) In various embodiments, NOTCH3 binding to itself or another protein (such as collagen181/endostatin, IGFBP-1, and/or HTRA1) is indicative of SVD or a risk of developing a SVD. See, e.g., Arboleda-Velasquez et al. (2005) CADASIL mutations impair Notch3 glycosylation by Fringe Hum Mol Genet. 14(12):1631-9, the entire contents of which are incorporated herein by reference. In some embodiments, a NOTCH3 homodimer is indicative of SVD or a risk thereof. In certain embodiments, a NOTCH heterodimer is indicative of SVD or a risk thereof. In various embodiments, the protein-protein interaction is an aberrant protein-protein interaction. In certain embodiments, the method further comprises diagnosing a subject as having an SVD (such as CADASIL) if NOTCH3 is binding to collagen181/endostatin, IGFBP-1, and/or HTRA1 is detected in the subject (e.g., in a test sample from the subject).

(15) In various embodiments, a mutation in the NOTCH3 gene triggers adult-onset stroke and vascular dementia in, e.g., a subject with a SVD such as CADASIL. In some embodiments, the mutation affects an epidermal growth factor-like (EGF-like) repeat located in the extracellular domain of the NOTCH3 receptor. EGF-like repeats in the NOCTH3 receptor is also the target of sequential complex O-linked glycosylation mediated by protein O-fucosyltransferase 1 and Fringe. In certain embodiments, the mutation does not affect the addition of O-fucose but does impair carbohydrate chain elongation by Fringe. In various embodiments, a subject has aberrant homodimerization of mutant NOTCH3 fragments and/or heterodimerization of mutant NOTCH3 with Lunatic Fringe itself. In certain embodiments, a subject has a complex (such as a dimer) comprising N3ECD and at least one other protein. In various embodiments, the interaction between the components of a homodimer or heterodimer comprising NOTCH3 or a portion thereof (e.g., a mutant NOTCH3 or N3ECD) is enhanced by one or more abnormal disulfide bonds. In some embodiments, a NOTCH3 homodimer comprises one or more disulfide bonds covalently connecting each NOTCH3 monomer.

(16) In various embodiments, a subject comprises a N3ECD homodimer. In some embodiments, the N3ECD homodimer comprises one or more disulfide bonds covalently connecting each NOTCH3 monomer.

(17) Endostatin

(18) Endostatin is a naturally-occurring, 20-kDa C-terminal fragment derived collagen181 (which is encoded by the COL18A1 gene). Endostatin is cleaved off collagen181. It is reported to serve as an anti-angiogenic agent, similar to angiostatin and thrombospondin. Endostatin is a broad-spectrum angiogenesis inhibitor and may interfere with the pro-angiogenic action of growth factors such as basic fibroblast growth factor (bFGF/FGF-2) and vascular endothelial growth factor (VEGF).

(19) A binding agent (e.g., an antibody) that specifically binds endostatin may also bind full-length collagen181. In various embodiments, it is not necessary to distinguish endostatin that is detected from collagen181 (i.e., it is not necessary to rule out or determine that a portion of the endostatin detected is full-length collagen181).

(20) An amino acid sequence for human endostatin is publically available in the UniProt database as positions 1572-1754 of accession number P39060 (SEQ ID NO: 1) and is as follows:

(21) TABLE-US-00001 HSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFL SSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARI FSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQAS SLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

(22) A nucleotide sequence that encodes human endostatin is publically available in the GenBank database as positions 4021-4569 of accession number NM 030582.3 (SEQ ID NO: 2) and is as follows:

(23) TABLE-US-00002 CACAGCCACCGCGACTTCCAGCCGGTGCTCCACCTGGTTG CGCTCAACAGCCCCCTGTCAGGCGGCATGCGGGGCATCCG CGGGGCCGACTTCCAGTGCTTCCAGCAGGCGCGGGCCGTG GGGCTGGCGGGCACCTTCCGCGCCTTCCTGTCCTCGCGCC TGCAGGACCTGTACAGCATCGTGCGCCGTGCCGACCGCGC AGCCGTGCCCATCGTCAACCTCAAGGACGAGCTGCTGTTT CCCAGCTGGGAGGCTCTGTTCTCAGGCTCTGAGGGTCCGC TGAAGCCCGGGGCACGCATCTTCTCCTTTGACGGCAAGGA CGTCCTGAGGCACCCCACCTGGCCCCAGAAGAGCGTGTGG CATGGCTCGGACCCCAACGGGCGCAGGCTGACCGAGAGCT ACTGTGAGACGTGGCGGACGGAGGCTCCCTCGGCCACGGG CCAGGCCTCCTCGCTGCTGGGGGGCAGGCTCCTGGGGCAG AGTGCCGCGAGCTGCCATCACGCCTACATCGTGCTCTGCA TTGAGAACAGCTTCATGACTGCCTCCAAG
NOTCH3

(24) The NOTCH3 gene encodes the third discovered human homologue of the Drosophila melanogaster type I membrane protein notch. In Drosophila, notch's interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in humans, but precise interactions between these ligands and the human notch homologues remains to be determined. NOTCH3 functions as a receptor for membrane-bound ligands JAGGED1, JAGGED2 and DELTA-LIKE1, DELTA-LIKE3, and DELTA-LIKE4 to regulate cell-fate determination. NOTCH3 has been proposed to affect the implementation of differentiation, proliferation and apoptotic programs.

(25) Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). NOTCH3 mutations (including mutations that result in amino acid changes other than cysteine substitutions in the extracellular domain) are also associated with SVDs other than CADASIL. NOTCH3 loss of function-associated SVD is distinct from CADASIL because it lacks the characteristic accumulation of NOTCH3 extracellular domain in vessels and it lacks granular osmiophilic deposits (GOMs). In embodiments, a subject with such a SVD has symptoms that are similar to CADASIL. See, e.g., Moccia et al., (2015) Hypomorphic NOTCH3 mutation in an Italian family with CADASIL features. Neurobiol Aging 36(1):547.e5-11; and Fouillade et al., (2008) Activating NOTCH3 mutation in a patient with small-vessel-disease of the brain. Hum Mutat. 29(3):452, the entire contents of each of which are incorporated herein by reference. In various embodiments, the subject has migraines. In some embodiments, the subject has migraines with aura. In certain embodiments, the skin of the subject comprises vascular damage. A non-limiting example of a mutation that may result in a SVD symptoms similar to CADASIL is a C to U substitution at position 307 of the open reading frame of NOTCH3-encoding mRNA (a cDNA sequence is provided as SEQ ID NO: 4), which results in a truncation of the protein such that amino acids from position R103 to the wild-type C-terminus are missing. Another non-limiting example includes a L1515P substitution.

(26) In some embodiments, the subject comprises a R103X substitution mutation. In certain embodiments, the mutation results in a substitution or a truncation within an Epidermal Growth-Factor-like Repeat of NOTCH3. In various embodiments, the mutation is within one of exons 2-24 of the NOTCH3 gene. In some embodiments, the mutation is a missense mutation in exon 25 of NOTCH3. In certain embodiments, the mutation comprises a substitution or mutation within the heterodimerization domain of NOTCH3. In various embodiments, the mutation results in a L1515P substitution. In some embodiments, the substitution is not a conservative substitution. In certain embodiments, the subject comprises an autosomal mutation in NOTCH3. In some embodiments, the mutation results in reduced NOTCH3 function. In various embodiments, the mutation results in increased NOTCH3 function. In some embodiments, the mutation comprises substitution in the extracellular domain of NOTCH3 that adds or removes a cysteine compared to wild-type NOTCH3. In certain embodiments, the mutation comprises a truncation beginning in the extracellular domain of the NOTCH3 protein. In embodiments, the subject is heterozygous for the mutation. In embodiments, the subject is homozygous for the mutation.

(27) In certain embodiments, the subject expresses NOTCH3 with any of the following CADASIL mutations: C43G, C49F, C49Y, R54C, 560C, C65S, C67Y, W71C, C76R, C76W, 77-82del, 80-84del, C87R, C87Y, R90C, C93F, C93Y, C106W, C108W, C108Y, R110C, 114-120del, C117F, S118C, C123F, C123Y, C128Y, R133C, C134W, R141C, F142C, C1445, C144Y, 5145C, C146R, G149C, Y150C, 153-155del, R153C, C1555, C1625, R169C, G171C, C174F, C174R, C174Y, S180C, R182C, C183F, C183R, C1835, C185G, C185R, Y189C, C194F, C194R, C1945, C194Y, C201Y, C206Y, R207C, C2125, R213K, C222G, C222Y, C224Y, C233S, C233Y, 239-253del, C240S, C245R, C251R, Y258C, C260Y, C311G, A319C, R332C, 5335C, Y337C, C349S, C379S, C395R, G420C, R421C, C428S, C428Y, C440G, C440R, C446S, R449C, C455R, C484F, C484Y, C495Y, C511R, C542Y, R544C, C549Y, R558C, R578C, R587C, R607C, C608Y, C624S, R635C, R640C, R717C, Y710C, R728C, C775S, G942C, R951C, G953C, F984C, R985C, R1006C, C1015R, Y1021C, R1031C, R1143C, D1063C, R1190C, R1201C, C1202S, R1210C, C1222G, R1231C, R1242C, C1261R, and C1261Y. In certain embodiments, the subject expresses NOTCH3 with a mutation that results in an extracellular domain of NOTCH3 having an odd number of cysteines according to the formula CnX or XnC where C stands for cysteine, n for an amino acid number in the NOTCH3 extracellular domain and X any amino replacing cysteine (for CnX) or replaced by cysteine (for XnC). In certain embodiments, n is the amino acid number (i.e., position) of any amino acid in the extracellular domain of NOTCH3. In certain embodiments, n is any one of positions 40-1643 of SEQ ID NO: 10. In certain embodiments, n is any one of positions 40-100, 100-250, 250-500, 500-750, 750-1000, 1000-1250, 1250-1500, or 1500-1643 of SEQ ID NO: 3. In certain embodiments, the subject express NOTCH3 with cysteine-sparing mutations either of the following: R61W, R75P, D80G 88-91del. See, e.g., Wollenweber et al., (2015) Cysteine-sparing CADASIL mutations in NOTCH3 show proaggregatory properties in vitro. Stroke 46(3):786-92, the entire content of which is incorporated herein by reference. In certain embodiments, the subject carries loss of function mutations in NOTCH 3 including frame shift, premature stop codon, out of frame insertions or deletions, or splicing mutations including any of the following mutations: p.R113Ter, p.R103Ter, p.R156Ter, p.Y220Ter, c.1951+2delT, p.C729Ter, p.R735Ter, p.C966Ter, p.G2035RfsTer60, p.T1816ITer3, c.2566+1G>C, p.C1110Ter, p.E1125Ter, p.Y1453Ter, p.R1851VfsTer60, c.5667+1G>A, p.R1893Ter, c.5914-2_5914-linsT, p.G2035RfsTer60, p.G2035VfsTer50. See, e.g., Pippucci et al., (2015) Homozygous NOTCH3 null mutation and impaired NOTCH3 signaling in recessive early-onset arteriopathy and cavitating leukoencephalopathy. EMBO Mol Med. 7(6):848-58; Moccia et al., (2015) Hypomorphic NOTCH3 mutation in an Italian family with CADASIL features. Neurobiol Aging 36(1):547.e5-11, the entire contents of each of which are incorporated herein by reference.

(28) An amino acid sequence for human NOTCH3 is publically available in the UniProt database under accession number Q9UM47 (SEQ ID NO: 3) is as follows (exemplary sites that may be substituted in subjects with SVD including CADASIL, cysteine-sparing mutations and NOTCH3 loss of function mutations are bolded and underlined):

(29) TABLE-US-00003 MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCA NGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAG TARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGY QGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVP CAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGT CVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCH LDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGAN PCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRI GQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFS GSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCS PDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFT GPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCA HEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCS SDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQ GWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDI NDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLC RPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTL VDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVR LEQLCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCR GYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPP GTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPC ESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPV GVPCQQTPRGPRCACPPGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSC RPAPLAPFFRCACAQGWTGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQR CDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPA CLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAH GQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHC FPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPSVPLLPLLVAG AVLLLVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQD ALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQW TQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYA RADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLD ARMADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVN NVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREI TDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFL PGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGR QPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGT PVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPE SPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSL AQAQTQLGPQPEVTPKRQVLA

(30) A nucleotide sequence that encodes human NOTCH3 is publically available in the GenBank database under accession number NM 000435.2 and is as follows (the start and stop codons are underlined and bolded):

(31) TABLE-US-00004 (SEQIDNo.13) GCGGCGCGGAGGCTGGCCCGGGACGCGCCCGGAGCCCAGGGAAGGAGGGA GGAGGGGAGGGTCGCGGCCGGCCGCCATGGGGCCGGGGGCCCGTGGCCGC CGCCGCCGCCGTCGCCCGATGTCGCCGCCACCGCCACCGCCACCCGTGCG GGCGCTGCCCCTGCTGCTGCTGCTAGCGGGGCCGGGGGCTGCAGCCCCCC CTTGCCTGGACGGAAGCCCGTGTGCAAATGGAGGTCGTTGCACCCAGCTG CCCTCCCGGGAGGCTGCCTGCCTGTGCCCGCCTGGCTGGGTGGGTGAGCG GTGTCAGCTGGAGGACCCCTGTCACTCAGGCCCCTGTGCTGGCCGTGGTG TCTGCCAGAGTTCAGTGGTGGCTGGCACCGCCCGATTCTCATGCCGGTGC CCCCGTGGCTTCCGAGGCCCTGACTGCTCCCTGCCAGATCCCTGCCTCAG CAGCCCTTGTGCCCACGGTGCCCGCTGCTCAGTGGGGCCCGATGGACGCT TCCTCTGCTCCTGCCCACCTGGCTACCAGGGCCGCAGCTGCCGAAGCGAC GTGGATGAGTGCCGGGTGGGTGAGCCCTGCCGCCATGGTGGCACCTGCCT CAACACACCTGGCTCCTTCCGCTGCCAGTGTCCAGCTGGCTACACAGGGC CACTATGTGAGAACCCCGCGGTGCCCTGTGCACCCTCACCATGCCGTAAC GGGGGCACCTGCAGGCAGAGTGGCGACCTCACTTACGACTGTGCCTGTCT TCCTGGGTTTGAGGGTCAGAATTGTGAAGTGAACGTGGACGACTGTCCAG GACACCGATGTCTCAATGGGGGGACATGCGTGGATGGCGTCAACACCTAT AACTGCCAGTGCCCTCCTGAGTGGACAGGCCAGTTCTGCACGGAGGACGT GGATGAGTGTCAGCTGCAGCCCAACGCCTGCCACAATGGGGGTACCTGCT TCAACACGCTGGGTGGCCACAGCTGCGTGTGTGTCAATGGCTGGACAGGC GAGAGCTGCAGTCAGAATATCGATGACTGTGCCACAGCCGTGTGCTTCCA TGGGGCCACCTGCCATGACCGCGTGGCTTCTTTCTACTGTGCCTGCCCCA TGGGCAAGACTGGCCTCCTGTGTCACCTGGATGACGCCTGTGTCAGCAAC CCCTGCCACGAGGATGCTATCTGTGACACAAATCCGGTGAACGGCCGGGC CATTTGCACCTGTCCTCCCGGCTTCACGGGTGGGGCATGTGACCAGGATG TGGACGAGTGCTCTATCGGCGCCAACCCCTGCGAGCACTTGGGCAGGTGC GTGAACACGCAGGGCTCCTTCCTGTGCCAGTGCGGTCGTGGCTACACTGG ACCTCGCTGTGAGACCGATGTCAACGAGTGTCTGTCGGGGCCCTGCCGAA ACCAGGCCACGTGCCTCGACCGCATAGGCCAGTTCACCTGTATCTGTATG GCAGGCTTCACAGGAACCTATTGCGAGGTGGACATTGACGAGTGTCAGAG TAGCCCCTGTGTCAACGGTGGGGTCTGCAAGGACCGAGTCAATGGCTTCA GCTGCACCTGCCCCTCGGGCTTCAGCGGCTCCACGTGTCAGCTGGACGTG GACGAATGCGCCAGCACGCCCTGCAGGAATGGCGCCAAATGCGTGGACCA GCCCGATGGCTACGAGTGCCGCTGTGCCGAGGGCTTTGAGGGCACGCTGT GTGATCGCAACGTGGACGACTGCTCCCCTGACCCATGCCACCATGGTCGC TGCGTGGATGGCATCGCCAGCTTCTCATGTGCCTGTGCTCCTGGCTACAC GGGCACACGCTGCGAGAGCCAGGTGGACGAATGCCGCAGCCAGCCCTGCC GCCATGGCGGCAAATGCCTAGACCTGGTGGACAAGTACCTCTGCCGCTGC CCTTCTGGGACCACAGGTGTGAACTGCGAAGTGAACATTGACGACTGTGC CAGCAACCCCTGCACCTTTGGAGTCTGCCGTGATGGCATCAACCGCTACG ACTGTGTCTGCCAACCTGGCTTCACAGGGCCCCTTTGTAACGTGGAGATC AATGAGTGTGCTTCCAGCCCATGCGGCGAGGGAGGTTCCTGTGTGGATGG GGAAAATGGCTTCCGCTGCCTCTGCCCGCCTGGCTCCTTGCCCCCACTCT GCCTCCCCCCGAGCCATCCCTGTGCCCATGAGCCCTGCAGTCACGGCATC TGCTATGATGCACCTGGCGGGTTCCGCTGTGTGTGTGAGCCTGGCTGGAG TGGCCCCCGCTGCAGCCAGAGCCTGGCCCGAGACGCCTGTGAGTCCCAGC CGTGCAGGGCCGGTGGGACATGCAGCAGCGATGGAATGGGTTTCCACTGC ACCTGCCCGCCTGGTGTCCAGGGACGTCAGTGTGAACTCCTCTCCCCCTG CACCCCGAACCCCTGTGAGCATGGGGGCCGCTGCGAGTCTGCCCCTGGCC AGCTGCCTGTCTGCTCCTGCCCCCAGGGCTGGCAAGGCCCACGATGCCAG CAGGATGTGGACGAGTGTGCTGGCCCCGCACCCTGTGGCCCTCATGGTAT CTGCACCAACCTGGCAGGGAGTTTCAGCTGCACCTGCCATGGAGGGTACA CTGGCCCTTCCTGCGATCAGGACATCAATGACTGTGACCCCAACCCATGC CTGAACGGTGGCTCGTGCCAAGACGGCGTGGGCTCCTTTTCCTGCTCCTG CCTCCCTGGTTTCGCCGGCCCACGATGCGCCCGCGATGTGGATGAGTGCC TGAGCAACCCCTGCGGCCCGGGCACCTGTACCGACCACGTGGCCTCCTTC ACCTGCACCTGCCCGCCAGGCTACGGAGGCTTCCACTGCGAACAGGACCT GCCCGACTGCAGCCCCAGCTCCTGCTTCAATGGCGGGACCTGTGTGGACG GCGTGAACTCGTTCAGCTGCCTGTGCCGTCCCGGCTACACAGGAGCCCAC TGCCAACATGAGGCAGACCCCTGCCTCTCGCGGCCCTGCCTACACGGGGG CGTCTGCAGCGCCGCCCACCCTGGCTTCCGCTGCACCTGCCTCGAGAGCT TCACGGGCCCGCAGTGCCAGACGCTGGTGGATTGGTGCAGCCGCCAGCCT TGTCAAAACGGGGGTCGCTGCGTCCAGACTGGGGCCTATTGCCTTTGTCC CCCTGGATGGAGCGGACGCCTCTGTGACATCCGAAGCTTGCCCTGCAGGG AGGCCGCAGCCCAGATCGGGGTGCGGCTGGAGCAGCTGTGTCAGGCGGGT GGGCAGTGTGTGGATGAAGACAGCTCCCACTACTGCGTGTGCCCAGAGGG CCGTACTGGTAGCCACTGTGAGCAGGAGGTGGACCCCTGCTTGGCCCAGC CCTGCCAGCATGGGGGGACCTGCCGTGGCTATATGGGGGGCTACATGTGT GAGTGTCTTCCTGGCTACAATGGTGATAACTGTGAGGACGACGTGGACGA GTGTGCCTCCCAGCCCTGCCAGCACGGGGGTTCATGCATTGACCTCGTGG CCCGCTATCTCTGCTCCTGTCCCCCAGGAACGCTGGGGGTGCTCTGCGAG ATTAATGAGGATGACTGCGGCCCAGGCCCACCGCTGGACTCAGGGCCCCG GTGCCTACACAATGGCACCTGCGTGGACCTGGTGGGTGGTTTCCGCTGCA CCTGTCCCCCAGGATACACTGGTTTGCGCTGCGAGGCAGACATCAATGAG TGTCGCTCAGGTGCCTGCCACGCGGCACACACCCGGGACTGCCTGCAGGA CCCAGGCGGAGGTTTCCGTTGCCTTTGTCATGCTGGCTTCTCAGGTCCTC GCTGTCAGACTGTCCTGTCTCCCTGCGAGTCCCAGCCATGCCAGCATGGA GGCCAGTGCCGTCCTAGCCCGGGTCCTGGGGGTGGGCTGACCTTCACCTG TCACTGTGCCCAGCCGTTCTGGGGTCCGCGTTGCGAGCGGGTGGCGCGCT CCTGCCGGGAGCTGCAGTGCCCGGTGGGCGTCCCATGCCAGCAGACGCCC CGCGGGCCGCGCTGCGCCTGCCCCCCAGGGTTGTCGGGACCCTCCTGCCG CAGCTTCCCGGGGTCGCCGCCGGGGGCCAGCAACGCCAGCTGCGCGGCCG CCCCCTGTCTCCACGGGGGCTCCTGCCGCCCCGCGCCGCTCGCGCCCTTC TTCCGCTGCGCTTGCGCGCAGGGCTGGACCGGGCCGCGCTGCGAGGCGCC CGCCGCGGCACCCGAGGTCTCGGAGGAGCCGCGGTGCCCGCGCGCCGCCT GCCAGGCCAAGCGCGGGGACCAGCGCTGCGACCGCGAGTGCAACAGCCCA GGCTGCGGCTGGGACGGCGGCGACTGCTCGCTGAGCGTGGGCGACCCCTG GCGGCAATGCGAGGCGCTGCAGTGCTGGCGCCTCTTCAACAACAGCCGCT GCGACCCCGCCTGCAGCTCGCCCGCCTGCCTCTACGACAACTTCGACTGC CACGCCGGTGGCCGCGAGCGCACTTGCAACCCGGTGTACGAGAAGTACTG CGCCGACCACTTTGCCGACGGCCGCTGCGACCAGGGCTGCAACACGGAGG AGTGCGGCTGGGATGGGCTGGATTGTGCCAGCGAGGTGCCGGCCCTGCTG GCCCGCGGCGTGCTGGTGCTCACAGTGCTGCTGCCGCCAGAGGAGCTACT GCGTTCCAGCGCCGACTTTCTGCAGCGGCTCAGCGCCATCCTGCGCACCT CGCTGCGCTTCCGCCTGGACGCGCACGGCCAGGCCATGGTCTTCCCTTAC CACCGGCCTAGTCCTGGCTCCGAACCCCGGGCCCGTCGGGAGCTGGCCCC CGAGGTGATCGGCTCGGTAGTAATGCTGGAGATTGACAACCGGCTCTGCC TGCAGTCGCCTGAGAATGATCACTGCTTCCCCGATGCCCAGAGCGCCGCT GACTACCTGGGAGCGTTGTCAGCGGTGGAGCGCCTGGACTTCCCGTACCC ACTGCGGGACGTGCGGGGGGAGCCGCTGGAGCCTCCAGAACCCAGCGTCC CGCTGCTGCCACTGCTAGTGGCGGGCGCTGTCTTGCTGCTGGTCATTCTC GTCCTGGGTGTCATGGTGGCCCGGCGCAAGCGCGAGCACAGCACCCTCTG GTTCCCTGAGGGCTTCTCACTGCACAAGGACGTGGCCTCTGGTCACAAGG GCCGGCGGGAACCCGTGGGCCAGGACGCGCTGGGCATGAAGAACATGGCC AAGGGTGAGAGCCTGATGGGGGAGGTGGCCACAGACTGGATGGACACAGA GTGCCCAGAGGCCAAGCGGCTAAAGGTAGAGGAGCCAGGCATGGGGGCTG AGGAGGCTGTGGATTGCCGTCAGTGGACTCAACACCATCTGGTTGCTGCT GACATCCGCGTGGCACCAGCCATGGCACTGACACCACCACAGGGCGACGC AGATGCTGATGGCATGGATGTCAATGTGCGTGGCCCAGATGGCTTCACCC CGCTAATGCTGGCTTCCTTCTGTGGGGGGGCTCTGGAGCCAATGCCAACT GAAGAGGATGAGGCAGATGACACATCAGCTAGCATCATCTCCGACCTGAT CTGCCAGGGGGCTCAGCTTGGGGCACGGACTGACCGTACTGGCGAGACTG CTTTGCACCTGGCTGCCCGTTATGCCCGTGCTGATGCAGCCAAGCGGCTG CTGGATGCTGGGGCAGACACCAATGCCCAGGACCACTCAGGCCGCACTCC CCTGCACACAGCTGTCACAGCCGATGCCCAGGGTGTCTTCCAGATTCTCA TCCGAAACCGCTCTACAGACTTGGATGCCCGCATGGCAGATGGCTCAACG GCACTGATCCTGGCGGCCCGCCTGGCAGTAGAGGGCATGGTGGAAGAGCT CATCGCCAGCCATGCTGATGTCAATGCTGTGGATGAGCTTGGGAAATCAG CCTTACACTGGGCTGCGGCTGTGAACAACGTGGAAGCCACTTTGGCCCTG CTCAAAAATGGAGCCAATAAGGACATGCAGGATAGCAAGGAGGAGACCCC CCTATTCCTGGCCGCCCGCGAGGGCAGCTATGAGGCTGCCAAGCTGCTGT TGGACCACTTTGCCAACCGTGAGATCACCGACCACCTGGACAGGCTGCCG CGGGACGTAGCCCAGGAGAGACTGCACCAGGACATCGTGCGCTTGCTGGA TCAACCCAGTGGGCCCCGCAGCCCCCCCGGTCCCCACGGCCTGGGGCCTC TGCTCTGTCCTCCAGGGGCCTTCCTCCCTGGCCTCAAAGCGGCACAGTCG GGGTCCAAGAAGAGCAGGAGGCCCCCCGGGAAGGCGGGGCTGGGGCCGCA GGGGCCCCGGGGGCGGGGCAAGAAGCTGACGCTGGCCTGCCCGGGCCCCC TGGCTGACAGCTCGGTCACGCTGTCGCCCGTGGACTCGCTGGACTCCCCG CGGCCTTTCGGTGGGCCCCCTGCTTCCCCTGGTGGCTTCCCCCTTGAGGG GCCCTATGCAGCTGCCACTGCCACTGCAGTGTCTCTGGCACAGCTTGGTG GCCCAGGCCGGGCGGGTCTAGGGCGCCAGCCCCCTGGAGGATGTGTACTC AGCCTGGGCCTGCTGAACCCTGTGGCTGTGCCCCTCGATTGGGCCCGGCT GCCCCCACCTGCCCCTCCAGGCCCCTCGTTCCTGCTGCCACTGGCGCCGG GACCCCAGCTGCTCAACCCAGGGACCCCCGTCTCCCCGCAGGAGCGGCCC CCGCCTTACCTGGCAGTCCCAGGACATGGCGAGGAGTACCCGGCGGCTGG GGCACACAGCAGCCCCCCAAAGGCCCGCTTCCTGCGGGTTCCCAGTGAGC ACCCTTACCTGACCCCATCCCCCGAATCCCCTGAGCACTGGGCCAGCCCC TCACCTCCCTCCCTCTCAGACTGGTCCGAATCCACGCCTAGCCCAGCCAC TGCCACTGGGGCCATGGCCACCACCACTGGGGCACTGCCTGCCCAGCCAC TTCCCTTGTCTGTTCCCAGCTCCCTTGCTCAGGCCCAGACCCAGCTGGGG CCCCAGCCGGAAGTTACCCCCAAGAGGCAAGTGTTGGCCTGAGACGCTCG TCAGTTCTTAGATCTTGGGGGCCTAAAGAGACCCCCGTCCTGCCTCCTTT CTTTCTCTGTCTCTTCCTTCCTTTTAGTCTTTTTCATCCTCTTCTCTTTC CACCAACCCTCCTGCATCCTTGCCTTGCAGCGTGACCGAGATAGGTCATC AGCCCAGGGCTTCAGTCTTCCTTTATTTATAATGGGTGGGGGCTACCACC CACCCTCTCAGTCTTGTGAAGAGTCTGGGACCTCCTTCTTCCCCACTTCT CTCTTCCCTCATTCCTTTCTCTCTCCTTCTGGCCTCTCATTTCCTTACAC TCTGACATGAATGAATTATTATTATTTTTATTTTTCTTTTTTTTTTTACA TTTTGTATAGAAACAAATTCATTTAAACAAACTTATTATTATTATTTTTT ACAAAATATATATATGGAGATGCTCCCTCCCCCTGTGAACCCCCCAGTGC CCCCGTGGGGCTGAGTCTGTGGGCCCATTCGGCCAAGCTGGATTCTGTGT ACCTAGTACACAGGCATGACTGGGATCCCGTGTACCGAGTACACGACCCA GGTATGTACCAAGTAGGCACCCTTGGGCGCACCCACTGGGGCCAGGGGTC GGGGGAGTGTTGGGAGCCTCCTCCCCACCCCACCTCCCTCACTTCACTGC ATTCCAGATGGGACATGTTCCATAGCCTTGCTGGGGAAGGGCCCACTGCC AACTCCCTCTGCCCCAGCCCCACCCTTGGCCATCTCCCTTTGGGAACTAG GGGGCTGCTGGTGGGAAATGGGAGCCAGGGCAGATGTATGCATTCCTTTG TGTCCCTGTAAATGTGGGACTACAAGAAGAGGAGCTGCCTGAGTGGTACT TTCTCTTCCTGGTAATCCTCTGGCCCAGCCTCATGGCAGAATAGAGGTAT TTTTAGGCTATTTTTGTAATATGGCTTCTGGTCAAAATCCCTGTGTAGCT GAATTCCCAAGCCCTGCATTGTACAGCCCCCCACTCCCCTCACCACCTAA TAAAGGAATAGTTAACACTCAAAAAAAAAAAAAAAAAAA

(32) In a NOTCH3-encoding mRNA sequence, each T in the sequence above would be a U.

(33) Another amino acid sequence for human NOTCH3 is publically available in the GenBank database under accession number AAB91371.1 and is as follows:

(34) TABLE-US-00005 (SEQIDNo.14) MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCA NGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAG TARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGY QGRSCRSDVDECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAVP CAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCLNGGT CVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCH LDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGAN PCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRI GQFTCICMAGFTGTYCEVDIDECQSSPCVNGGVCKDRVNGFSCTCPSGFS GSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLCDRNVDDCS PDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFT GPLCNVEINECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCA HEPCSHGICYDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCRAGGTCS SDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQ GWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDI NDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLC RPGYTGAHCQHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTL VDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVR LEQLCQAGGQCVDEDSSHYCVCPEGRTGSHCEQEVDPCLAQPCQHGGTCR GYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPP GTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPC ESQPCQHGGQCRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPV GVPCQQTPRGPRCACPPGLSGPSCRSFPGSPPGASNASCAAAPCLHGGSC RPAPLAPFFRCACAQGWTGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQR CDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPA CLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAH GQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHC FPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPSVPLLPLLVAG AVLLLVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGRREPVGQD ALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQW TQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYA RADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLD ARMADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVN NVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFANREI TDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFL PGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGR QPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGT PVSPQERPPPYLAVPGHGEEYPVAGAHSSPPKARFLRVPSEHPYLTPSPE SPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSL AQAQTQLGPQPEVTPKRQVLA

(35) A nucleotide sequence that encodes human NOTCH3 is publically available in the GenBank database under accession number U97669.1 (SEQ ID NO: 4) and is as follows (the start and stop codons are underlined and bolded):

(36) TABLE-US-00006 ACGCGGCGCGGAGGCTGGCCCGGGACGCGCCCGGAGCCCAGGGAAGGAGG GAGGAGGGGAGGGTCGCGGCCGGCCGCCATGGGGCCGGGGGCCCGTGGCC GCCGCCGCCGCCGTCGCCCGATGTCGCCGCCACCGCCACCGCCACCCGTG CGGGCGCTGCCCCTGCTGCTGCTGCTAGCGGGGCCGGGGGCTGCAGCCCC CCCTTGCCTGGACGGAAGCCCGTGTGCAAATGGAGGTCGTTGCACCCAGC TGCCCTCCCGGGAGGCTGCCTGCCTGTGCCCGCCTGGCTGGGTGGGTGAG CGGTGTCAGCTGGAGGACCCCTGTCACTCAGGCCCCTGTGCTGGCCGTGG TGTCTGCCAGAGTTCAGTGGTGGCTGGCACCGCCCGATTCTCATGCCGGT GCCCCCGTGGCTTCCGAGGCCCTGACTGCTCCCTGCCAGATCCCTGCCTC AGCAGCCCTTGTGCCCACGGTGCCCGCTGCTCAGTGGGGCCCGATGGACG CTTCCTCTGCTCCTGCCCACCTGGCTACCAGGGCCGCAGCTGCCGAAGCG ACGTGGATGAGTGCCGGGTGGGTGAGCCCTGCCGCCATGGTGGCACCTGC CTCAACACACCTGGCTCCTTCCGCTGCCAGTGTCCAGCTGGCTACACAGG GCCACTATGTGAGAACCCCGCGGTGCCCTGTGCGCCCTCACCATGCCGTA ACGGGGGCACCTGCAGGCAGAGTGGCGACCTCACTTACGACTGTGCCTGT CTTCCTGGGTTTGAGGGTCAGAATTGTGAAGTGAACGTGGACGACTGTCC AGGACACCGATGTCTCAATGGGGGGACATGCGTGGATGGCGTCAACACCT ATAACTGCCAGTGCCCTCCTGAGTGGACAGGCCAGTTCTGCACGGAGGAC GTGGATGAGTGTCAGCTGCAGCCCAACGCCTGCCACAATGGGGGTACCTG CTTCAACACGCTGGGTGGCCACAGCTGCGTGTGTGTCAATGGCTGGACAG GTGAGAGCTGCAGTCAGAATATCGATGACTGTGCCACAGCCGTGTGCTTC CATGGGGCCACCTGCCATGACCGCGTGGCTTCTTTCTACTGTGCCTGCCC CATGGGCAAGACTGGCCTCCTGTGTCACCTGGATGACGCCTGTGTCAGCA ACCCCTGCCACGAGGATGCTATCTGTGACACAAATCCGGTGAACGGCCGG GCCATTTGCACCTGTCCTCCCGGCTTCACGGGTGGGGCATGTGACCAGGA TGTGGACGAGTGCTCTATCGGCGCCAACCCCTGCGAGCACTTGGGCAGGT GCGTGAACACGCAGGGCTCCTTCCTGTGCCAGTGCGGTCGTGGCTACACT GGACCTCGCTGTGAGACCGATGTCAACGAGTGTCTGTCGGGGCCCTGCCG AAACCAGGCCACGTGCCTCGACCGCATAGGCCAGTTCACCTGTATCTGTA TGGCAGGCTTCACAGGAACCTATTGCGAGGTGGACATTGACGAGTGTCAG AGTAGCCCCTGTGTCAACGGTGGGGTCTGCAAGGACCGAGTCAATGGCTT CAGCTGCACCTGCCCCTCGGGCTTCAGCGGCTCCACGTGTCAGCTGGACG TGGACGAATGCGCCAGCACGCCCTGCAGGAATGGCGCCAAATGCGTGGAC CAGCCCGATGGCTACGAGTGCCGCTGTGCCGAGGGCTTTGAGGGCACGCT GTGTGATCGCAACGTGGACGACTGCTCCCCTGACCCATGCCACCATGGTC GCTGCGTGGATGGCATCGCCAGCTTCTCATGTGCCTGTGCTCCTGGCTAC ACGGGCACACGCTGCGAGAGCCAGGTGGACGAATGCCGCAGCCAGCCCTG CCGCCATGGCGGCAAATGCCTAGACCTGGTGGACAAGTACCTCTGCCGCT GCCCTTCTGGGACCACAGGTGTGAACTGCGAAGTGAACATTGACGACTGT GCCAGCAACCCCTGCACCTTTGGAGTCTGCCGTGATGGCATCAACCGCTA CGACTGTGTCTGCCAACCTGGCTTCACAGGGCCCCTTTGTAACGTGGAGA TCAATGAGTGTGCTTCCAGCCCATGCGGCGAGGGAGGTTCCTGTGTGGAT GGGGAAAATGGCTTCCGCTGCCTCTGCCCGCCTGGCTCCTTGCCCCCACT CTGCCTCCCCCCGAGCCATCCCTGTGCCCATGAGCCCTGCAGTCACGGCA TCTGCTATGATGCACCTGGCGGGTTCCGCTGTGTGTGTGAGCCTGGCTGG AGTGGCCCCCGCTGCAGCCAGAGCCTGGCCCGAGACGCCTGTGAGTCCCA GCCGTGCAGGGCCGGTGGGACATGCAGCAGCGATGGAATGGGTTTCCACT GCACCTGCCCGCCTGGTGTCCAGGGACGTCAGTGTGAACTCCTCTCCCCC TGCACCCCGAACCCCTGTGAGCATGGGGGCCGCTGCGAGTCTGCCCCTGG CCAGCTGCCTGTCTGCTCCTGCCCCCAGGGCTGGCAAGGCCCACGATGCC AGCAGGATGTGGACGAGTGTGCTGGCCCCGCACCCTGTGGCCCTCATGGT ATCTGCACCAACCTGGCAGGGAGTTTCAGCTGCACCTGCCATGGAGGGTA CACTGGCCCTTCCTGTGATCAGGACATCAATGACTGTGACCCCAACCCAT GCCTGAACGGTGGCTCGTGCCAAGACGGCGTGGGCTCCTTTTCCTGCTCC TGCCTCCCTGGTTTCGCCGGCCCACGATGCGCCCGCGATGTGGATGAGTG CCTGAGCAACCCCTGCGGCCCGGGCACCTGTACCGACCACGTGGCCTCCT TCACCTGCACCTGCCCGCCGGGCTACGGAGGCTTCCACTGCGAACAGGAC CTGCCCGACTGCAGCCCCAGCTCCTGCTTCAATGGCGGGACCTGTGTGGA CGGCGTGAACTCGTTCAGCTGCCTGTGCCGTCCCGGCTACACAGGAGCCC ACTGCCAACATGAGGCAGACCCCTGCCTCTCGCGGCCCTGCCTACACGGG GGCGTCTGCAGCGCCGCCCACCCTGGCTTCCGCTGCACCTGCCTCGAGAG CTTCACGGGCCCGCAGTGCCAGACGCTGGTGGATTGGTGCAGCCGCCAGC CTTGTCAAAACGGGGGTCGCTGCGTCCAGACTGGGGCCTATTGCCTTTGT CCCCCTGGATGGAGCGGACGCCTCTGTGACATCCGAAGCTTGCCCTGCAG GGAGGCCGCAGCCCAGATCGGGGTGCGGCTGGAGCAGCTGTGTCAGGCGG GTGGGCAGTGTGTGGATGAAGACAGCTCCCACTACTGCGTGTGCCCAGAG GGCCGTACTGGTAGCCACTGTGAGCAGGAGGTGGACCCCTGCTTGGCCCA GCCCTGCCAGCATGGGGGGACCTGCCGTGGCTATATGGGGGGCTACATGT GTGAGTGTCTTCCTGGCTACAATGGTGATAACTGTGAGGACGACGTGGAC GAGTGTGCCTCCCAGCCCTGCCAGCACGGGGGTTCATGCATTGACCTCGT GGCCCGCTATCTCTGCTCCTGTCCCCCAGGAACGCTGGGGGTGCTCTGCG AGATTAATGAGGATGACTGCGGCCCAGGCCCACCGCTGGACTCAGGGCCC CGGTGCCTACACAATGGCACCTGCGTGGACCTGGTGGGTGGTTTCCGCTG CACCTGTCCCCCAGGATACACTGGTTTGCGCTGCGAGGCAGACATCAATG AGTGTCGCTCAGGTGCCTGCCACGCGGCACACACCCGGGACTGCCTGCAG GACCCAGGCGGAGGTTTCCGTTGCCTTTGTCATGCTGGCTTCTCAGGTCC TCGCTGTCAGACTGTCCTGTCTCCCTGCGAGTCCCAGCCATGCCAGCATG GAGGCCAGTGCCGTCCTAGCCCGGGTCCTGGGGGTGGGCTGACCTTCACC TGTCACTGTGCCCAGCCGTTCTGGGGTCCGCGTTGCGAGCGGGTGGCGCG CTCCTGCCGGGAGCTGCAGTGCCCGGTGGGCGTCCCATGCCAGCAGACGC CCCGCGGGCCGCGCTGCGCCTGCCCCCCAGGGTTGTCGGGACCCTCCTGC CGCAGCTTCCCGGGGTCGCCGCCGGGGGCCAGCAACGCCAGCTGCGCGGC CGCCCCCTGTCTCCACGGGGGCTCCTGCCGCCCCGCGCCGCTCGCGCCCT TCTTCCGCTGCGCTTGCGCGCAGGGCTGGACCGGGCCGCGCTGCGAGGCG CCCGCCGCGGCACCCGAGGTCTCGGAGGAGCCGCGGTGCCCGCGCGCCGC CTGCCAGGCCAAGCGCGGGGACCAGCGCTGCGACCGCGAGTGCAACAGCC CAGGCTGCGGCTGGGACGGCGGCGACTGCTCGCTGAGCGTGGGCGACCCC TGGCGGCAATGCGAGGCGCTGCAGTGCTGGCGCCTCTTCAACAACAGCCG CTGCGACCCCGCCTGCAGCTCGCCCGCCTGCCTCTACGACAACTTCGACT GCCACGCCGGTGGCCGCGAGCGCACTTGCAACCCGGTGTACGAGAAGTAC TGCGCCGACCACTTTGCCGACGGCCGCTGCGACCAGGGCTGCAACACGGA GGAGTGCGGCTGGGATGGGCTGGATTGTGCCAGCGAGGTGCCGGCCCTGC TGGCCCGCGGCGTGCTGGTGCTCACAGTGCTGCTGCCGCCGGAGGAGCTA CTGCGTTCCAGCGCCGACTTTCTGCAGCGGCTCAGCGCCATCCTGCGCAC CTCGCTGCGCTTCCGCCTGGACGCGCACGGCCAGGCCATGGTCTTCCCTT ACCACCGGCCTAGTCCTGGCTCCGAACCCCGGGCCCGTCGGGAGCTGGCC CCCGAGGTGATCGGCTCGGTAGTAATGCTGGAGATTGACAACCGGCTCTG CCTGCAGTCGCCTGAGAATGATCACTGCTTCCCCGATGCCCAGAGCGCCG CTGACTACCTGGGAGCGTTGTCAGCGGTGGAGCGCCTGGACTTCCCGTAC CCACTGCGGGACGTGCGGGGGGAGCCGCTGGAGCCTCCAGAACCCAGCGT CCCGCTGCTGCCACTGCTAGTGGCGGGCGCTGTCTTGCTGCTGGTCATTC TCGTCCTGGGTGTCATGGTGGCCCGGCGCAAGCGCGAGCACAGCACCCTC TGGTTCCCTGAGGGCTTCTCACTGCACAAGGACGTGGCCTCTGGTCACAA GGGCCGGCGGGAACCCGTGGGCCAGGACGCGCTGGGCATGAAGAACATGG CCAAGGGTGAGAGCCTGATGGGGGAGGTGGCCACAGACTGGATGGACACA GAGTGCCCAGAGGCCAAGCGGCTAAAGGTAGAGGAGCCAGGCATGGGGGC TGAGGAGGCTGTGGATTGCCGTCAGTGGACTCAACACCATCTGGTTGCTG CTGACATCCGCGTGGCACCAGCCATGGCACTGACACCACCACAGGGCGAC GCAGATGCTGATGGCATGGATGTCAATGTGCGTGGCCCAGATGGCTTCAC CCCGCTAATGCTGGCTTCCTTCTGTGGGGGGGCTCTGGAGCCAATGCCAA CTGAAGAGGATGAGGCAGATGACACATCAGCTAGCATCATCTCCGACCTG ATCTGCCAGGGGGCTCAGCTTGGGGCACGGACTGACCGTACTGGCGAGAC TGCTTTGCACCTGGCTGCCCGTTATGCCCGTGCTGATGCAGCCAAGCGGC TGCTGGATGCTGGGGCAGACACCAATGCCCAGGACCACTCAGGCCGCACT CCCCTGCACACAGCTGTCACAGCCGATGCCCAGGGTGTCTTCCAGATTCT CATCCGAAACCGCTCTACAGACTTGGATGCCCGCATGGCAGATGGCTCAA CGGCACTGATCCTGGCGGCCCGCCTGGCAGTAGAGGGCATGGTGGAAGAG CTCATCGCCAGCCATGCTGATGTCAATGCTGTGGATGAGCTTGGGAAATC AGCCTTACACTGGGCTGCGGCTGTGAACAACGTGGAAGCCACTTTGGCCC TGCTCAAAAATGGAGCCAATAAGGACATGCAGGATAGCAAGGAGGAGACC CCCCTATTCCTGGCCGCCCGCGAGGGCAGCTATGAGGCTGCCAAGCTGCT GTTGGACCACTTTGCCAACCGTGAGATCACCGACCACCTGGACAGGCTGC CGCGGGACGTAGCCCAGGAGAGACTGCACCAGGACATCGTGCGCTTGCTG GATCAACCCAGTGGGCCCCGCAGCCCCCCCGGTCCCCACGGCCTGGGGCC TCTGCTCTGTCCTCCAGGGGCCTTCCTCCCTGGCCTCAAAGCGGCACAGT CGGGGTCCAAGAAGAGCAGGAGGCCCCCCGGGAAGGCGGGGCTGGGGCCG CAGGGGCCCCGGGGGCGGGGCAAGAAGCTGACGCTGGCCTGCCCGGGCCC CCTGGCTGACAGCTCGGTCACGCTGTCGCCCGTGGACTCGCTGGACTCCC CGCGGCCTTTCGGTGGGCCCCCTGCTTCCCCTGGTGGCTTCCCCCTTGAG GGGCCCTATGCAGCTGCCACTGCCACTGCAGTGTCTCTGGCACAGCTTGG TGGCCCAGGCCGGGCAGGTCTAGGGCGCCAGCCCCCTGGAGGATGTGTAC TCAGCCTGGGCCTGCTGAACCCTGTGGCTGTGCCCCTCGATTGGGCCCGG CTGCCCCCACCTGCCCCTCCAGGCCCCTCGTTCCTGCTGCCACTGGCGCC GGGACCCCAGCTGCTCAACCCAGGGACCCCCGTCTCCCCGCAGGAGCGGC CCCCGCCTTACCTGGCAGTCCCAGGACATGGCGAGGAGTACCCGGTGGCT GGGGCACACAGCAGCCCCCCAAAGGCCCGCTTCCTGCGGGTTCCCAGTGA GCACCCTTACCTGACCCCATCCCCCGAATCCCCTGAGCACTGGGCCAGCC CCTCACCTCCCTCCCTCTCAGACTGGTCCGAATCCACGCCTAGCCCAGCC ACTGCCACTGGGGCCATGGCCACCACCACTGGGGCACTGCCTGCCCAGCC ACTTCCCTTGTCTGTTCCCAGCTCCCTTGCTCAGGCCCAGACCCAGCTGG GGCCCCAGCCGGAAGTTACCCCCAAGAGGCAAGTGTTGGCCTGAGACGCT CGTCAGTTCTTAGATCTTGGGGGCCTAAAGAGACCCCCGTCCTGCCTCCT TTCTTTCTCTGTCTCTTCCTTCCTTTTAGTCTTTTTCATCCTCTTCTCTT TCCACCAACCCTCCTGCATCCTTGCCTTGCAGCGTGACCGAGATAGGTCA TCAGCCCAGGGCTTCAGTCTTCCTTTATTTATAATGGGTGGGGGCTACCA CCCACCCTCTCAGTCTTGTGAAGAGTCTGGGACCTCCTTCTTCCCCACTT CTCTCTTCCCTCATTCCTTTCTCTCTCCTTCTGGCCTCTCATTTCCTTAC ACTCTGACATGAATGAATTATTATTATTTTTCTTTTTCTTTTTTTTTTTA CATTTTGTATAGAAACAAATTCATTTAAACAAACTTATTATTATTATTTT TTACAAAATATATATATGGAGATGCTCCCTCCCCCTGTGAACCCCCCAGT GCCCCCGTGGGGCTGAGTCTGTGGGCCCATTCGGCCAAGCTGGATTCTGT GTACCTAGTACACAGGCATGACTGGGATCCCGTGTACCGAGTACACGACC CAGGTATGTACCAAGTAGGCACCCTTGGGCGCACCCACTGGGGCCAGGGG TCGGGGGAGTGTTGGGAGCCTCCTCCCCACCCCACCTCCCTCACTTCACT GCATTCCAGATTGGACATGTTCCATAGCCTTGCTGGGGAAGGGCCCACTG CCAACTCCCTCTGCCCCAGCCCCACCCTTGGCCATCTCCCTTTGGGAACT AGGGGGCTGCTGGTGGGAAATGGGAGCCAGGGCAGATGTATGCATTCCTT TATGTCCCTGTAAATGTGGGACTACAAGAAGAGGAGCTGCCTGAGTGGTA CTTTCTCTTCCTGGTAATCCTCTGGCCCAGCCTTATGGCAGAATAGAGGT ATTTTTAGGCTATTTTTGTAATATGGCTTCTGGTCAAAATCCCTGTGTAG CTGAATTCCCAAGCCCTGCATTGTACAGCCCCCCACTCCCCTCACCACCT AATAAAGGAATAGTTAACACTCAAAAAAAAAAAAAAAAAAA

(37) In a NOTCH3-encoding mRNA sequence, each T in the sequence above would be a U.

(38) The human NOTCH3 ectodomain sequence comprises amino acid positions 40 to 1571 of accession number Q9UM47. With respect to embodiments relating to CADASIL, the ectodomain comprises the extracellular domain until the furin cleavage site. This excludes the signal peptide from positions 1 to 39 and also excludes the 1572 to 2321 amino acid region encompassing a small portion that is extracellular, the transmembrane domain, and the intracellular domain.

(39) An amino acid sequence for human N3ECD is:

(40) TABLE-US-00007 (SEQIDNO:5) APPCLDGSPCANGGRCTQLPSREAACLCPPGWVGERCQLE DPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSL PDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVD ECRVGEPCRHGGTCLNTPGSFRCQCPAGYTGPLCENPAV PCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDD CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQ LQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCA TAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP CHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGA NPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGP CRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCV NGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNG AKCVDQPDGYECRCAEGFEGTLCDRNVDDCSPDPCHHGRC VDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLD LVDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGIN RYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENGF RCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCV CEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCT CPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCP QGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHG GYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGF AGPRCARDVDECLSNPCGPGTCTDHVASFTCTCPPGYGGF HCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHC QHEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQT LVDWCSRQPCQNGGRCVQTGAYCLCPPGWSGRLCDIRSLP CREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGS HCEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNC EDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEI NEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTG LRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFS GPRCQTVLSPCESQPCQHGGQCRPSPGPGGGLTFTCHCAQ PFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGL SGPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFF RCACAQGWTGPRCEAPAAAPEVSEEPRCPRAACQAKRGDQ RCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNN SRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHF ADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLL PPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR PSPGSEPRARR

(41) The amino acid sequence for mouse N3ECD runs from positions 40 to 1572 of the amino acid sequence that is available from accession number Q61982 (SEQ ID NO: 6), and is as follows:

(42) TABLE-US-00008 (SEQIDNO:6) APPCLDGSPCANGGRCTHQQPSLEAACLCLPGWVGERCQL EDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCS QPDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSD IDECRSGTTCRHGGTCLNTPGSFRCQCPLGYTGLLCENPV VPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVD DCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDEC QLQPNACHNGGTCFNLLGGHSCVCVNGWTGESCSQNIDDC ATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSN PCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIG ANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSG PCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPC VNGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRN GAKCVDQPDGYECRCAEGFEGTLCERNVDDCSPDPCHHGR CVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCL DLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGI NRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDGENG FHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRC VCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRC TCAPGFQGHQCEVLSPCTPSLCEHGGHCESDPDRLTVCSC PPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICH RGYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDG FAGPRCARDVDECLSSPCGPGTCTDHVASFTCACPPGYGG FHCEIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTH CQYEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQ NPVDWCSQAPCQNGGRCVQTGAYCICPPGWSGRLCDIQSL PCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTG SHCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDS CEDNIDECASQPCQNGGSCIDLVARYLCSCPPGTLGVLCE INEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYT GLHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGF TGPRCQIALSPCESQPCQHGGQCRHSLGRGGGLTFTCHCV PPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPG LSGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPF FRCVCAPGWGGPRCETPSAAPEVPEEPRCPRAACQAKRGD QNCDRECNTPGCGWDGGDCSLNVDDPWRQCEALQCWRLFN NSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADH FADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVL LPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYH RPSPGSESRVRR
IGFBP-1

(43) IGFBP-1 is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

(44) An amino acid sequence for human IGFBP-1 is publically available in the UniProt database under accession number P08833 (SEQ ID NO: 7) and is as follows:

(45) TABLE-US-00009 MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSE VTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRG QGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSI LWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISK FYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPN CQIYFNVQN

(46) A nucleotide sequence that encodes human IGFBP-1 is publically available in the GenBank database under accession number NM 000596.2 (SEQ ID NO: 8) and is as follows (the start and stop codons are underlined and bolded):

(47) TABLE-US-00010 GGTGCACTAGCAAAACAAACTTATTTTGAACACTCAGCTCCTAGCGTGCG GCGCTGCCAATCATTAACCTCCTGGTGCAAGTGGCGCGGCCTGTGCCCTT TATAAGGTGCGCGCTGTGTCCAGCGAGCATCGGCCACCGCCATCCCATCC AGCGAGCATCTGCCGCCGCGCCGCCGCCACCCTCCCAGAGAGCACTGGCC ACCGCTCCACCATCACTTGCCCAGAGTTTGGGCCACCGCCCGCCGCCACC AGCCCAGAGAGCATCGGCCCCTGTCTGCTGCTCGCGCCTGGAGATGTCAG AGGTCCCCGTTGCTCGCGTCTGGCTGGTACTGCTCCTGCTGACTGTCCAG GTCGGCGTGACAGCCGGCGCTCCGTGGCAGTGCGCGCCCTGCTCCGCCGA GAAGCTCGCGCTCTGCCCGCCGGTGTCCGCCTCGTGCTCGGAGGTCACCC GGTCCGCCGGCTGCGGCTGTTGCCCGATGTGCGCCCTGCCTCTGGGCGCC GCGTGCGGCGTGGCGACTGCACGCTGCGCCCGGGGACTCAGTTGCCGCGC GCTGCCGGGGGAGCAGCAACCTCTGCACGCCCTCACCCGCGGCCAAGGCG CCTGCGTGCAGGAGTCTGACGCCTCCGCTCCCCATGCTGCAGAGGCAGGG AGCCCTGAAAGCCCAGAGAGCACGGAGATAACTGAGGAGGAGCTCCTGGA TAATTTCCATCTGATGGCCCCTTCTGAAGAGGATCATTCCATCCTTTGGG ACGCCATCAGTACCTATGATGGCTCGAAGGCTCTCCATGTCACCAACATC AAAAAATGGAAGGAGCCCTGCCGAATAGAACTCTACAGAGTCGTAGAGAG TTTAGCCAAGGCACAGGAGACATCAGGAGAAGAAATTTCCAAATTTTACC TGCCAAACTGCAACAAGAATGGATTTTATCACAGCAGACAGTGTGAGACA TCCATGGATGGAGAGGCGGGACTCTGCTGGTGCGTCTACCCTTGGAATGG GAAGAGGATCCCTGGGTCTCCAGAGATCAGGGGAGACCCCAACTGCCAGA TATATTTTAATGTACAAAACTGAAACCAGATGAAATAATGTTCTGTCACG TGAAATATTTAAGTATATAGTATATTTATACTCTAGAACATGCACATTTA TATATATATGTATATGTATATATATATAGTAACTACTTTTTATACTCCAT ACATAACTTGATATAGAAAGCTGTTTATTTATTCACTGTAAGTTTATTTT TTCTACACAGTAAAAACTTGTACTATGTTAATAACTTGTCCTATGTCAAT TTGTATATCATGAAACACTTCTCATCATATTGTATGTAAGTAATTGCATT TCTGCTCTTCCAAAGCTCCTGCGTCTGTTTTTAAAGAGCATGGAAAAATA CTGCCTAGAAAATGCAAAATGAAATAAGAGAGAGTAGTTTTTCAGCTAGT TTGAAGGAGGACGGTTAACTTGTATATTCCACCATTCACATTTGATGTAC ATGTGTAGGGAAAGTTAAAAGTGTTGATTACATAATCAAAGCTACCTGTG GTGATGTTGCCACCTGTTAAAATGTACACTGGATATGTTGTTAAACACGT GTCTATAATGGAAACATTTACAATAAATATTCTGCATGGAAATACTGTTA AAAAAAAAAA
HTRA1

(48) HTRA1 is a serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate matrix metalloproteinase-1 (MMP1) and matrix metalloproteinase-3 (MMP3) production. HTRA1 may also degrade proteoglycans, such as aggrecan, decorin and fibromodulin. Through cleavage of proteoglycans, HTRA1 may release soluble fibroblast growth factor (FGF)-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. HTRA1 is also thought to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. HTRA1 is further believed to inhibit signaling mediated by transforming growth factor beta (TGF-) family members. This activity requires the integrity of the catalytic site, although it is unclear whether TGF- proteins are themselves degraded. By acting on TGF- signaling, HTRA1 may regulate many physiological processes, including retinal angiogenesis and neuronal survival and maturation during development. Intracellularly, HTRA1 degrades Tuberous Sclerosis Complex 2 (TSC2), leading to the activation of TSC2 downstream targets.

(49) An amino acid sequence for human HTRA1 is publically available in the UniProt database under accession number Q92743 (SEQ ID NO: 9) and is as follows:

(50) TABLE-US-00011 MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQP EHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASAT VRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVL QRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVP VASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKAD IALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAG ISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKD RHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSD VIKRESTLNMVVRRGNEDIMITVIPEEIDP

(51) In the sequence shown above, positions 1-22 (SEQ ID NO: 10) correspond to the signal peptide, positions 204-364 (SEQ ID NO: 11) correspond to a serine protease domain.

(52) A nucleotide sequence that encodes human HTRA1 is publically available in the GenBank database under accession number NM 002775.4 (SEQ ID NO: 12) and is as follows (the start and stop codons are underlined and bolded):

(53) TABLE-US-00012 CAATGGGCTGGGCCGCGCGGCCGCGCGCACTCGCACCCGCTGCCCCCGAG GCCCTCCTGCACTCTCCCCGGCGCCGCTCTCCGGCCCTCGCCCTGTCCGC CGCCACCGCCGCCGCCGCCAGAGTCGCCATGCAGATCCCGCGCGCCGCTC TTCTCCCGCTGCTGCTGCTGCTGCTGGCGGCGCCCGCCTCGGCGCAGCTG TCCCGGGCCGGCCGCTCGGCGCCTTTGGCCGCCGGGTGCCCAGACCGCTG CGAGCCGGCGCGCTGCCCGCCGCAGCCGGAGCACTGCGAGGGCGGCCGGG CCCGGGACGCGTGCGGCTGCTGCGAGGTGTGCGGCGCGCCCGAGGGCGCC GCGTGCGGCCTGCAGGAGGGCCCGTGCGGCGAGGGGCTGCAGTGCGTGGT GCCCTTCGGGGTGCCAGCCTCGGCCACGGTGCGGCGGCGCGCGCAGGCCG GCCTCTGTGTGTGCGCCAGCAGCGAGCCGGTGTGCGGCAGCGACGCCAAC ACCTACGCCAACCTGTGCCAGCTGCGCGCCGCCAGCCGCCGCTCCGAGAG GCTGCACCGGCCGCCGGTCATCGTCCTGCAGCGCGGAGCCTGCGGCCAAG GGCAGGAAGATCCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGAC GTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGAATTGTTTCGCAA GCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTA TTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAAC AAGCACCGGGTCAAAGTTGAGCTGAAGAACGGTGCCACTTACGAAGCCAA AATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGACC ACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGG CCGGGAGAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACAC AGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCGGCAAAGAGCTGG GGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAAC TATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGG AATTAACACTTTGAAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTG ATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAGGA AAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCAC GTCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACG TGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGATACCCCAGCAGAA GCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTC CGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCC TGAACATGGTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATT CCCGAAGAAATTGACCCATAGGCAGAGGCATGAGCTGGACTTCATGTTTC CCTCAAAGACTCTCCCGTGGATGACGGATGAGGACTCTGGGCTGCTGGAA TAGGACACTCAAGACTTTTGACTGCCATTTTGTTTGTTCAGTGGAGACTC CCTGGCCAACAGAATCCTTCTTGATAGTTTGCAGGCAAAACAAATGTAAT GTTGCAGATCCGCAGGCAGAAGCTCTGCCCTTCTGTATCCTATGTATGCA GTGTGCTTTTTCTTGCCAGCTTGGGCCATTCTTGCTTAGACAGTCAGCAT TTGTCTCCTCCTTTAACTGAGTCATCATCTTAGTCCAACTAATGCAGTCG ATACAATGCGTAGATAGAAGAAGCCCCACGGGAGCCAGGATGGGACTGGT CGTGTTTGTGCTTTTCTCCAAGTCAGCACCCAAAGGTCAATGCACAGAGA CCCCGGGTGGGTGAGCGCTGGCTTCTCAAACGGCCGAAGTTGCCTCTTTT AGGAATCTCTTTGGAATTGGGAGCACGATGACTCTGAGTTTGAGCTATTA AAGTACTTCTTACACATTGCAAAAAAAAAAAAAAAAAA
Exemplary SVDs and the Treatment Thereof

(54) Aspects of the present subject matter relate to the treatment of SVDs using methods, compositions, systems, and kits described herein. For example, the present disclosure provides methods for monitoring the effectiveness of a treatment over time, as well as processes for determining whether the dose of a therapeutic compound should be increased or decreased.

(55) Cerebral Small Vessel Disease

(56) As used herein, the term cerebral small vessel disease or cerebral SVD refers to a group of pathological processes with various aetiologies that affect the small arteries, arterioles, venules, and capillaries of the brain. See, e.g., Pantoni (2010) Lancet Neurol, 9(7):689-701, the entire contents of which are incorporated herein by reference. Age-related and hypertension-related SVDs and cerebral amyloid angiopathy are the most common forms. The consequences of small vessel disease on the brain parenchyma are mainly lesions located in the subcortical structures such as lacunar infarcts, white matter lesions, large hemorrhages, and microbleeds. Small vessel disease has an important role in cerebrovascular disease and is a leading cause of cognitive decline and functional loss in the elderly.

(57) Cerebral SVD may lead to vascular dementia (also known as vascular cognitive impairment). In vascular dementia, changes in thinking skills sometimes occur suddenly following strokes that block major brain blood vessels. See, e.g., Alzheimer's Association, Alzheimer's & Dementia, available at www.alz.org/dementia/vascular-dementia-symptoms.asp, the entire contents of which are incorporated herein by reference. Thinking problems also may begin as mild changes that worsen gradually as a result of multiple minor strokes or other conditions that affect smaller blood vessels, leading to cumulative damage. Symptoms can vary widely, depending on the severity of the blood vessel damage and the part of the brain affected. Memory loss may or may not be a significant symptom depending on the specific brain areas where blood flow is reduced. Vascular dementia symptoms may be most obvious when they happen soon after a major stroke. Sudden post-stroke changes in thinking and perception may include, e.g., (i) confusion; (ii) disorientation; (iii) trouble speaking or understanding speech; and/or (iv) vision loss. These changes may happen at the same time as stroke symptoms such as a sudden headache, difficulty walking, or numbness or paralysis on one side of the face or the body.

(58) Multiple small strokes or other conditions that affect blood vessels and nerve fibers deep inside the brain may cause more gradual thinking changes as damage accumulates. Common early signs of widespread small vessel disease include impaired planning and judgment; uncontrolled laughing and crying; declining ability to pay attention; impaired function in social situations; and difficulty finding the right words.

(59) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of cerebral SVD.

(60) HTRA1-Associated Small Vessel Disease

(61) As used herein, an HTRA1-associated small vessel disease or HTRA1-associated SVD is a SVD that results from a dominant HTRA1 mutation. In various embodiments, a subject is heterozygous for the mutation. Descriptions of exemplary heterozygous mutations of the HTRA1 gene in patients with familial cerebral small vessel disease are included in Donato et al. 2017 Heterozygous mutations of HTRA1 gene in patients with familial cerebral small vessel disease CNS Neurosci Ther. 23(9):759-765; and Verdura et al. (2015) Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease Brain 138; 2347-2358, the entire contents of each of which are incorporated herein by reference.

(62) Cerebral Autosomal Recessive Arteriopathy with Subcortical Infarcts and Leukoencephalopathy

(63) Cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy, commonly known as CARASIL, is an inherited condition that causes stroke and other impairments. As its name suggests, this condition is inherited in an autosomal recessive pattern. Autosomal recessive inheritance means both copies of the gene in each cell have mutations. The parents of an individual with an autosomal recessive condition each carry one copy of the mutated gene, but they typically do not show signs and symptoms of the condition. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, CARASIL, available at ghr.nlm.nih.gov/condition/cerebral-autosomal-recessive-arteriopathy-with-subcortical-infarcts-and-leukoencephalopathy#inheritance, the entire contents of which are incorporated herein by reference.

(64) Abnormalities affecting the brain and other parts of the nervous system become apparent in an affected person's twenties or thirties. Often, muscle stiffness (spasticity) in the legs and problems with walking are the first signs of the disorder. About half of affected individuals have a stroke or similar episode before age 40. As the disease progresses, most people with CARASIL also develop mood and personality changes, a decline in thinking ability (dementia), memory loss, and worsening problems with movement.

(65) Other characteristic features of CARASIL include premature hair loss (alopecia) and attacks of low back pain. The hair loss often begins during adolescence and is limited to the scalp. Back pain, which develops in early to mid-adulthood, results from the breakdown (degeneration) of the discs that separate the bones of the spine (vertebrae) from one another.

(66) The signs and symptoms of CARASIL worsen slowly with time. Over the course of several years, affected individuals become less able to control their emotions and communicate with others. They increasingly require help with personal care and other activities of daily living; after a few years, they become unable to care for themselves. Most affected individuals die within a decade after signs and symptoms first appear, although few people with the disease have survived for 20 to 30 years.

(67) CARASIL is caused by mutations in the HTRA1 gene. This gene provides instructions for making an enzyme that is found in many of the body's organs and tissues. One of the major functions of the HTRA1 enzyme is to regulate signaling by proteins in the transforming growth factor-beta (TGF-) family. TGF- signaling is essential for many critical cell functions. It also plays an important role in the formation of new blood vessels (angiogenesis).

(68) Without wishing to be bound by any scientific theory, in people with CARASIL, mutations in the HTRA1 gene prevent the effective regulation of TGF- signaling. HTRA1 mutations leading to SVD have been associated with loss of function of the gene. Abnormally regulated TGF- signaling may alter the structure of small blood vessels, particularly in the brain. These blood vessel abnormalities (described as arteriopathy) greatly increase the risk of stroke and lead to the death of nerve cells (neurons) in many areas of the brain. Dysregulation of TGF- signaling may also underlie the hair loss and back pain seen in people with CARASIL, although the relationship between abnormal TGF- signaling and these features is less clear.

(69) Lacunar Strokes and Hemorrhagic Strokes

(70) As disclosed herein, the consequences of SVD on the brain parenchyma include lesions located in the subcortical structures such as lacunar infarcts (also termed lacunar strokes), white matter lesions, large hemorrhages, and microbleeds. Strokes, such as lacunar strokes and hemorrhagic strokes, are signs of (e.g., may result from) a SVD. A lacunar stroke is the most common type of stroke, and results from the occlusion of one or more small penetrating arteries that provide blood to the brain's deep structures. In some embodiments, a lacunar stroke comprises a small infarct (e.g., 2-20 mm in diameter) in the deep cerebral white matter, basal ganglia, or pons. Such events can result from the occlusion of a single small perforating artery supplying the subcortical areas of the brain. Hemorrhagic strokes (bleeds) can result from a weakened vessel that ruptures and bleeds into the surrounding brain tissue.

(71) In some cases, a subject with a SVD has more difficulty recovering from a lacunar stroke compared to, e.g., a subject without a SVD. A subject with a SVD may also have more difficulty recovering from a hemorrhagic stroke. Treatment, as described herein, improves (e.g., the rate or degree of) recovery, e.g., alleviation of symptoms, of a subject with a SVD who has had a lacunar stroke or a hemorrhagic stroke. Such a treatment also reduces the likelihood that a subject who has a SVD will have a lacunar stroke or a hemorrhagic stroke.

(72) The present subject matter provides methods for the treatment of each subtype, symptom, and/or complication of lacunar strokes and hemorrhagic strokes.

(73) It was reported that heterozygous individuals carrying only one copy of the mutant HTRA1 also develop cerebral small vessel disease indicating that HTRA1 is a haploinsufficient gene and that the disease may also be inherited following an autosomal dominant pattern. Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease. See, e.g., Verdura et al. (2015) Brain 138(Pt 8):2347-58.

(74) Various embodiments of the present subject matter relate to the detection of increased levels of HTRA1 (e.g., a HTRA1 protein having an amino acid sequence encoded by either a mutated or wild-type HTRA1 gene) in a biological sample from a subject. It is surprising that an increase in the level of a HTRA1 protein can indicate an increased risk for CADASIL or a symptom or complication thereof, which as discussed below, is a dominant disease caused by NOTCH3.

(75) Surprisingly, an increase in HTRA1 is indicative of (and identifies a subject as having or being at risk of) CADASIL whereas a decrease in HTRA1 levels or HTRA1 activity is indicative of (and identifies a subject as having or being at risk of) CARASIL.

(76) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of CARASIL.

(77) Cerebral Autosomal-Dominant Arteriopathy with Subcortical Infarcts and Leukoencephalopathy

(78) Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy, usually called CADASIL, is an inherited condition that causes stroke and other impairments. This condition affects blood flow in small blood vessels, particularly cerebral vessels within the brain. The muscle cells surrounding these blood vessels (vascular smooth muscle cells) are abnormal and gradually die. In the brain, the resulting blood vessel damage (arteriopathy) can cause migraines, often with visual sensations or auras, or recurrent seizures (epilepsy). See, e.g., the U.S. National Library of Medicine Genetics Home Reference, CADASIL, available at ghr.nlm.nih.gov/condition/cerebral-autosomal-dominant-arteriopathy-with-subcortical-infarcts-and-leukoencephalopathy#genes, the entire contents of which are incorporated herein by reference.

(79) Damaged blood vessels reduce blood flow and can cause areas of tissue death (infarcts) throughout the body. An infarct in the brain can lead to a stroke. In individuals with CADASIL, a stroke can occur at any time from childhood to late adulthood, but typically happens during mid-adulthood. People with CADASIL often have more than one stroke in their lifetime. Recurrent strokes can damage the brain over time. Strokes that occur in the subcortical region of the brain, which is involved in reasoning and memory, can cause progressive loss of intellectual function (dementia) and changes in mood and personality.

(80) Many people with CADASIL also develop leukoencephalopathy, which is a change in a type of brain tissue called white matter that can be seen with magnetic resonance imaging (MRI).

(81) The age at which the signs and symptoms of CADASIL first begin varies greatly among affected individuals, as does the severity of these features.

(82) CADASIL is not associated with the common risk factors for stroke and heart attack, such as high blood pressure and high cholesterol, although some affected individuals might also have these health problems. However, NOTCH3 variants may influence risk of developing Alzheimer's Disease (Sassi, C. et al. Neurobiology of Aging Mendelian adult-onset leukodystrophy genes in Alzheimer's disease: critical influence of CSF1R and NOTCH3 online Feb. 2, 2018; 1.e1-1.e13, hereby incorporated by reference).

(83) Mutations in the NOTCH3 gene cause CADASIL. One copy of the altered NOTCH3 gene in each cell is sufficient to cause the disorder. The NOTCH3 gene provides instructions for producing the NOTCH3 receptor protein, which is important for the normal function and survival of vascular smooth muscle cells. When certain molecules attach (bind) to NOTCH3 receptors, the receptors send signals to the nucleus of the cell. These signals then turn on (activate) particular genes within vascular smooth muscle cells.

(84) NOTCH3 gene mutations lead to the production of an abnormal NOTCH3 receptor protein that impairs the function and survival of vascular smooth muscle cells. Disruption of NOTCH3 functioning can lead to the self-destruction (apoptosis) of these cells. In the brain, the loss of vascular smooth muscle cells, and/or mural cells (progenitors of vascular smooth muscle cells and pericytes), results in blood vessel damage that can cause the signs and symptoms of CADASIL.

(85) Various embodiments of the present subject matter relate to the detection of decreased levels of the NOTCH3 extracellular domain (e.g., an extracellular domain having an amino acid sequence of a NOTCH3 extracellular domain encoded by either a mutated or wild-type NOTCH3 gene) in a biological sample from a subject. It is surprising that a decrease in the level of a NOTCH3 extracellular domain can indicate an increased risk for CADASIL or a symptom or complication thereof.

(86) FIG. 5C shows that the levels of N3ECD are significantly reduced in mice carrying the C455R CADASIL mutation in NOTCH3 compared to controls. FIG. 5D shows that this was not explained by differences in the levels of mRNA expression. This mutation has been shown to abrogate NOTCH3 signaling in vivo and in vitro in a previous publication (Arboleda-Velasquez et al., PNAS, 2011). The decreased levels of N3ECD may be related to impaired NOTCH3 signaling as it is known that upon proteolytic cleavage of the NOTCH receptors the NOTCH ectodomain is released from the receptor expressing cell and transendocytosed into the ligand-expressing cell (Klueg and Muskavitch, 1999), a process that may be impaired by deficient signaling.

(87) No specific treatment is available for CADASIL. However, anti-platelet agents such as aspirin, dipyridamole, ticlopidine, and clopidogrel are used to slow down the disease and help prevent strokes. Aspects of the present invention relate to administering an anti-platelet agent to a subject who is diagnosed with or determined to be at risk of developing CADASIL. In some embodiments, the subject receives therapy for primary or secondary prevention of stroke and myocardial infarction. Risk-reduction measures in primary stroke prevention may include the use of antihypertensive medications; platelet antiaggregants; 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitors (statins); smoking cessation; dietary intervention; weight loss; and exercise. Additionally, and as noted elsewhere herein, a decrease in the level of NOTCH3 is indicative of CADASIL, and subjects with CADASIL should not be administered thrombolytic agents. In various embodiments, a subject is not administered an anticoagulant therapy or a thrombolytic agent if a decreased level of NOTCH3 is detected in the subject. Secondary prevention may include the use of antiaggregants (aspirin, clopidogrel, extended-release dipyridamole, ticlopidine), cholesterol-reducing medications, and/or blood pressure-lowering medications, as well as the cessation of cigarette smoking, improving the diet (e.g., reducing red meat consumption and/or increasing vegetable consumption), and increased exercise. In certain embodiments relating to women who have been taking an oral contraceptive and is diagnosed as having CADASIL or at risk of developing CADASIL is advised or directed to stop taking the oral contraceptive. In various embodiments, a subject diagnosed with CADASIL or identified as having a risk for developing CADASIL is administered treatment for hypercholesterolemia and/or hypertension. In some embodiments, the subject is administered folic acid and/or L-Arginine. Moreover, the efficacy of a therapeutic agent or regimen may be assessed based on its ability to increase the level of NOTCH3 in a subject with CADASIL (with the increase being indicative of efficacy). Thus, methods, compositions, kits, and devices provided herein are useful for evaluating the efficacy of both known and experimental treatments for the primary, secondary, or tertiary prevention or treatment of the disease.

(88) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of CADASIL.

(89) NOTCH3 Loss of Function-Associated Small Vessel Disease

(90) NOTCH3 loss of function mutations cause an SVD phenotype strikingly similar to CADASIL but with key differences including the lack of accumulation of the NOTCH3 extracellular domain and the lack of GOM deposits. Typical mutations include changes leading to NOTCH3 frame shifts, premature stop codons, or splicing defects. Partial or complete gene deletions or promoter or enhancer mutations leading to lower than normal NOTCH3 expression are also included. It has been reported that in some patients, typical CADASIL mutations also lead to NOTCH3 loss of function and in these, NOTCH3 loss of function contributes to SVD pathology. In most cases, patients with NOTCH3 loss of function are heterozygotes although a homozygote patient has been reported with earlier age at onset of SVD. This indicates that NOTCH3 is haploinsufficient in humans because one wild-type copy of the gene is not sufficient to produce a wild type phenotype. Conditions that may indirectly lead to a decrease in NOTCH3 expression or function in the absence of mutations including cardiovascular or metabolic disease or aging or disease or environmental factor are also included.

(91) Age-Related Macular Degeneration

(92) Age-related macular degeneration (AMD) is an eye disease that is a leading cause of vision loss in older people in developed countries. The vision loss usually becomes noticeable in a person's sixties or seventies and tends to worsen over time. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, Age-Related Macular Degeneration, available at ghr.nlm.nih.gov/condition/age-related-macular-degeneration, the entire contents of which are incorporated herein by reference.

(93) AMD mainly affects central vision, which is needed for detailed tasks such as reading, driving, and recognizing faces. The vision loss in this condition results from a gradual deterioration of light-sensing cells in the tissue at the back of the eye that detects light and color (the retina). Specifically, age-related macular degeneration affects a small area near the center of the retina, called the macula, which is responsible for central vision. Side (peripheral) vision and night vision are generally not affected.

(94) There are two major types of AMD, known as the dry form and the wet form. The dry form is much more common, accounting for 85 to 90 percent of all cases of age-related macular degeneration. It is characterized by a buildup of yellowish deposits called drusen beneath the retina and slowly progressive vision loss. The condition typically affects vision in both eyes, although vision loss often occurs in one eye before the other.

(95) The wet form of AMD is associated with severe vision loss that can worsen rapidly. This form of the condition is characterized by the growth of abnormal, fragile blood vessels underneath the macula. These vessels leak blood and fluid, which damages the macula and makes central vision appear blurry and distorted.

(96) AMD results from a combination of genetic and environmental factors. Many of these factors have been identified, but some remain unknown.

(97) Without wishing to be bound by any scientific theory, changes in many genes may be risk factors for age-related macular degeneration. The best-studied of these genes are involved in a part of the body's immune response known as the complement system. This system is a group of proteins that work together to destroy foreign invaders (such as bacteria and viruses), trigger inflammation, and remove debris from cells and tissues. Genetic changes in and around several complement system genes, including the complement factor H (CFH) gene, contribute to a person's risk of developing age-related macular degeneration. It is unclear how these genetic changes are related to the retinal damage and vision loss characteristic of this condition. Changes on the long (q) arm of chromosome 10 in a region known as 10q26 are also associated with an increased risk of age-related macular degeneration. The 10q26 region contains two genes of interest, age-related maculopathy susceptibility 2 (ARMS2) and HTRA1. Changes in both genes have been studied as possible risk factors for the disease. However, because the two genes are so close together, it is difficult to tell which gene is associated with age-related macular degeneration risk, or whether increased risk results from variations in both genes. An estimated 15 to 20 percent of people with age-related macular degeneration have at least one first-degree relative (such as a sibling) with the condition. Other genes that are associated with age-related macular degeneration include genes involved in transporting and processing high-density lipoprotein (HDL) and genes that have been associated with other forms of macular disease.

(98) Nongenetic factors that contribute to the risk of age-related macular degeneration are also known. Age appears to be the most important risk factor; the chance of developing the condition increases significantly as a person gets older. Smoking is another established risk factor for age-related macular degeneration.

(99) Aspects of the present subject matter relate to administering a treatment for AMD to a subject who is diagnosed with or determined to be at risk of developing AMD. In some embodiments, the subject is administered a statin. In some embodiments relating to neovascular AMD, the subject is administered an antiangiogenic steroid such as anecortave acetate or triamcinolone acetonide. In various embodiments relating to wet AMD, the subject can be treated with laser coagulation or a medication that stops and sometimes reverses the growth of blood vessels. In certain embodiments, the subject is treated with bevacizumab, ranibizumab, pegaptanib, or aflibercept. In some embodiments, photodynamic therapy is administered to the subject. For example, the drug verteporfin is administered intravenously and light of a certain wavelength (e.g., 689 nm) is then applied to the abnormal blood vessels, which activates the verteporfin to destroy the vessels.

(100) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of AMD.

(101) Retinopathy

(102) Retinopathy is persistent or acute damage to the retina of the eye. Ongoing inflammation and vascular remodeling may occur over periods of time where the patient is not fully aware of the extent of the disease. Frequently, retinopathy is an ocular manifestation of systemic disease as seen in diabetes or hypertension. Diabetic retinopathy is the leading cause of blindness in working-aged people.

(103) Causes of retinopathy include but are not limited to: (i) diabetes mellitus, which can cause diabetic retinopathy; (ii) arterial hypertension, which can cause hypertensive retinopathy; (iii) retinopathy of prematurity due to prematurity of a newborn (under the 9 months of human pregnancy); (iv) radiation retinopathy due to exposure to ionizing radiation; (v) solar retinopathy due to direct sunlight exposure; (vi) sickle cell disease; (vii) retinal vascular disease such as retinal vein or artery occlusion; (viii) trauma, especially to the head, and several diseases may cause Purtscher's retinopathy; and (ix) hyperviscosity-related retinopathy as seen in disorders which cause paraproteinemia.

(104) Many types of retinopathy are proliferative, most often resulting from neovascularization or blood vessel overgrowth. Angiogenesis is the hallmark precursor that may result in blindness or severe vision loss, particularly if the macula becomes affected. Retinopathy may also be a symptom or complication of a ciliopathic genetic disorder such as Alstrm syndrome or Bardet-Biedl syndrome.

(105) Aspects of the present subject matter relate to administering a treatment for retinopathy to a subject who is diagnosed with or determined to be at risk of developing retinopathy. Treatment may include laser therapy to the retina and/or the administration of a vascular endothelial growth factor (VEGF) inhibitor.

(106) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of retinopathy.

(107) Microangiopathy

(108) Microangiopathy (or microvascular disease, or small vessel disease) is an angiopathy (i.e. disease of blood vessels) affecting small blood vessels in the body. The condition can occur in any organ of the body. One cause of microangiopathy is long-term diabetes mellitus. In this case, high blood glucose levels cause the endothelial cells lining the blood vessels to take in more glucose than normal (these cells do not depend on insulin). They then form more glycoproteins on their surface than normal, and also cause the basement membrane in the vessel wall to grow abnormally thicker and weaker. Therefore they bleed, leak protein, and slow the flow of blood through the body. As a result, some organs and tissues do not get enough blood (carrying oxygen and nutrients) and are damaged, for example, the retina (diabetic retinopathy) or kidney (diabetic nephropathy). Nerves and neurons, if not sufficiently supplied with blood, are also damaged, which leads to loss of function (diabetic neuropathy, especially peripheral neuropathy). Microangiopathy may also lead to damage or loss of function of vascular smooth muscle cells or and/or mural cells (progenitors of smooth muscle cells and pericytes).

(109) Massive microangiopathy may cause microangiopathic hemolytic anemia (MAHA).

(110) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of microangiopathy.

(111) Nephropathy and Small Vessel Diseases of the Kidney

(112) SVD can occur in the kidneys during or as part of nephropathy. For example, diabetic nephropathy (or diabetic kidney disease) is a progressive kidney disease caused by damage to the capillaries in the kidneys' glomeruli. It is characterized by nephrotic syndrome and diffuse scarring of the glomeruli. It is due to longstanding diabetes mellitus, and is a prime reason for dialysis in many developed countries. It is classified as a small blood vessel complication of diabetes. During its early course, diabetic nephropathy often has no symptoms. Symptoms can take 5 to 10 years to appear after the kidney damage begins. These late symptoms include severe tiredness, headaches, a general feeling of illness, nausea, vomiting, frequent voiding, lack of appetite, itchy skin, and leg swelling.

(113) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of nephropathy.

(114) Proximal 19p13.12 Microdeletion Syndrome

(115) In embodiments, the SVD comprises proximal 19p13.12 microdeletion syndrome. Non-limiting descriptions relating to this syndrome are provided in Huynh et al. (2018) First prenatal case of proximal 19p13.12 microdeletion syndrome: New insights and new delineation of the syndrome Eur J Med Genet. S1769-7212(17)30466-4, the entire content of which is incorporated herein by reference.

(116) In certain embodiments, proximal 19p13.12 microdeletion syndrome comprises intellectual disability, facial dysmorphism, and/or branchial arch defects. In some embodiments, proximal 19p13.12 microdeletion syndrome comprises hypertrichosis-synophrys-protruding front teeth. In various embodiments, a subject with proximal 19p13.12 microdeletion syndrome comprises a heterozygous interstitial deletion at 19p13.12 chromosome region. In certain embodiments, the deletion is a deletion of about 350 kb to about 750 kb. In some embodiments, the deletion is a deletion of about 745 kb. In various embodiments, the deletion includes at least a portion of the NOTCH3 gene. In certain embodiments, the deletion includes the entire NOTCH3 gene. In some embodiments, the deletion comprises (e.g., in addition to a mutation in part of all of the NOTCH3 gene) a portion of, or the entirety of any one of, any combination of the following genes: SYDE1, AKAP8, AKAP8L, WIZ and BRD4.

(117) The present subject matter provides methods for the treatment of each subtype, symptom, and/or complication of proximal 19p13.12 microdeletion syndrome.

(118) Myocardial Ischemia

(119) NOTCH3 deficiency impairs coronary microvascular maturation and reduces cardiac recovery after myocardial ischemia. See, e.g., Tao et al. (2017) Notch3 deficiency impairs coronary microvascular maturation and reduces cardiac recovery after myocardial ischemia Int J Cardiol. 2017 Jun. 1; 236:413-422, the entire content of which is incorporated herein by reference. In various embodiments, a subject with myocardial ischemia has myocardial infarction.

(120) In certain embodiments, reduced NOTCH3 results in a reduction of pericytes and small arterioles. In some embodiments, the reduction in pericytes and small arterioles increases the severity of myocardial ischemia, and/or reduces cardiac recovery after myocardial ischemia. In various embodiments, a subject with reduced NOTCH3 function (e.g., due to a mutation) is prone to ischemic injury with larger infarcted size and higher rates of mortality. In certain embodiments, the expression of CXCR-4 and VEGF/Ang-1 is decreased in a subject with reduced NOTCH3 function. In some embodiments, a subject with reduced NOTCH3 function has fewer NG2+/Scal+ and NG2+/c-kit+ progenitor cells in an ischemic area and exhibits worse cardiac function recovery at 2 weeks after myocardial ischemia compared to a corresponding subject with a normal level of NOTCH3 function. In certain embodiments, a subject with reduced NOTCH3 function has a significant reduction of pericyte/capillary coverage and arteriolar maturation compared to a corresponding subject with a normal level of NOTCH3 function. In various embodiments, a subject with a reduced level of NOTCH3 function and who has had myocardial ischemia has increased intracellular adhesion molecule-2 (ICAM-2) expression and CD11b+ macrophage infiltration into ischemic areas compared to that of a corresponding subject with a normal level of NOTCH3 function. In embodiments, a subject has a NOTCH3 mutation that impairs recovery of cardiac function post-myocardial ischemia by the mechanisms involving the pre-existing coronary microvascular dysfunction conditions, and impairment of pericyte/progenitor cell recruitment and microvascular maturation.

(121) The present subject matter provides methods for the treatment of each subtype, symptom, and/or complication of myocardial ischemia.

(122) Heart Failure

(123) Heart failure is a chronic, progressive condition in which the heart muscle is unable to pump enough blood through to meet the body's needs for blood and oxygen. Loss of NOTCH3 signaling in vascular smooth muscle cells promotes severe heart failure upon hypertension. See, e.g., Ragot et al., (2016) Hypertension. 68(2):392-400; and the American Heart Association, What is Heart Failure? available at www.heartorg/HEARTORG/Conditions/HeartFailure/AboutHeartFailure/About-Heart-Failure_UCM_002044_Article.jsp#.WM16W_7lva8, the entire contents of each of which are incorporated herein by reference.

(124) The heart tries to make up for this by enlarging, developing more muscle mass, and/or pumping faster. When the heart chamber enlarges, it stretches more and can contract more strongly, so it pumps more blood. With an enlarged heart, the body starts to retain fluid, the lungs get congested with fluid and the heart begins to beat irregularly. An increase in muscle mass occurs because the contracting cells of the heart get bigger. This lets the heart pump more strongly, at least initially. Increased heartrate helps to increase the heart's output.

(125) The body also tries to compensate in other ways: (i) The blood vessels narrow to keep blood pressure up, trying to make up for the heart's loss of power; and (ii) The body diverts blood away from less important tissues and organs (like the kidneys), the heart and brain.

(126) These temporary measures mask the problem of heart failure, but they do not solve it. Heart failure continues and worsens until these substitute processes no longer work. Eventually the subject experiences the fatigue, breathing problems or other symptoms that usually prompt a trip to the doctor.

(127) Heart failure can involve the heart's left side, right side or both sides. However, it usually affects the left side first.

(128) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of heart failure.

(129) Alagille Syndrome and Familial Tetralogy of Fallot

(130) Alagille syndrome is a genetic disorder that can affect the liver, heart, and other parts of the body. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, Alagille syndrome, available at ghr.nlm.nih.gov/condition/alagille-syndrome, the entire contents of which are incorporated herein by reference.

(131) One of the major features of Alagille syndrome is liver damage caused by abnormalities in the bile ducts. These ducts carry bile (which helps to digest fats) from the liver to the gallbladder and small intestine. In Alagille syndrome, the bile ducts may be narrow, malformed, and reduced in number (bile duct paucity). As a result, bile builds up in the liver and causes scarring that prevents the liver from working properly to eliminate wastes from the bloodstream. Signs and symptoms arising from liver damage in Alagille syndrome may include a yellowish tinge in the skin and the whites of the eyes (jaundice), itchy skin, and deposits of cholesterol in the skin (xanthomas).

(132) Alagille syndrome is also associated with several heart problems, including impaired blood flow from the heart into the lungs (pulmonic stenosis). Pulmonic stenosis may occur along with a hole between the two lower chambers of the heart (ventricular septal defect) and other heart abnormalities. This combination of heart defects is called tetralogy of Fallot.

(133) People with Alagille syndrome may have distinctive facial features including a broad, prominent forehead; deep-set eyes; and a small, pointed chin. The disorder may also affect the blood vessels within the brain and spinal cord (central nervous system) and the kidneys. Affected individuals may have an unusual butterfly shape of the bones of the spinal column (vertebrae) that can be seen in an x-ray.

(134) Problems associated with Alagille syndrome generally become evident in infancy or early childhood. The severity of the disorder varies among affected individuals, even within the same family. Symptoms range from so mild as to go unnoticed to severe heart and/or liver disease requiring transplantation.

(135) Some people with Alagille syndrome may have isolated signs of the disorder, such as a heart defect like tetralogy of Fallot, or a characteristic facial appearance. These individuals do not have liver disease or other features typical of the disorder.

(136) In more than 90 percent of cases, mutations in the JAGGED gene cause Alagille syndrome. Another 7 percent of individuals with Alagille syndrome have small deletions of genetic material on chromosome 20 that include the JAG1 gene, which encodes JAGGED. A few people with Alagille syndrome have mutations in a different gene, called NOTCH2. The JAG1 and NOTCH2 genes provide instructions for making proteins that fit together to trigger interactions called NOTCH signaling between neighboring cells during embryonic development. This signaling influences how the cells are used to build body structures in the developing embryo. Changes in either the JAG1 gene or NOTCH2 gene probably disrupt the NOTCH signaling pathway. As a result, errors may occur during development, especially affecting the bile ducts, heart, spinal column, and certain facial features.

(137) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of Alagille syndrome and/or familial tetralogy of Fallot.

(138) Patent Ductus Arteriosus

(139) Patent ductus arteriosus (PDA) is a condition wherein the ductus arteriosus fails to close after birth. Early symptoms are uncommon, but in the first year of life include increased work of breathing and poor weight gain. An uncorrected PDA may lead to congestive heart failure with increasing age.

(140) The ductus arteriosus is a fetal blood vessel that closes soon after birth. In a PDA, the vessel does not close and remains patent (open), resulting in irregular transmission of blood between the aorta and the pulmonary artery. PDA is common in newborns with persistent respiratory problems such as hypoxia, and has a high occurrence in premature newborns. Premature newborns are more likely to be hypoxic and have PDA due to underdevelopment of the heart and lungs.

(141) A PDA allows a portion of the oxygenated blood from the left heart to flow back to the lungs by flowing from the aorta (which has higher pressure) to the pulmonary artery. If this shunt is substantial, the neonate becomes short of breath: the additional fluid returning to the lungs increases lung pressure, which in turn increases the energy required to inflate the lungs. This uses more calories than normal and often interferes with feeding in infancy. This condition, as a constellation of findings, is called congestive heart failure.

(142) In some congenital heart defects (such as in transposition of the great vessels) a PDA may need to remain open, as it is the only way that oxygenated blood can mix with deoxygenated blood. In these cases, prostaglandins are used to keep the DA open until surgical correction of the heart defect is completed.

(143) PDA is associated with NOTCH3 loss of function. See, e.g., Baeten et al., (2015) Genesis 53(12):738-48, the entire content of which is incorporated herein by reference.

(144) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of PDA.

(145) Cerebral Cavernous Malformations

(146) Cerebral cavernous malformations are collections of small blood vessels (capillaries) in the brain that are enlarged and irregular in structure. These capillaries have abnormally thin walls, and they lack other support tissues, such as elastic fibers, which normally make them stretchy. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, Cerebral Cavernous Malformation, available at ghr.nlm.nih.gov/condition/cerebral-cavernous-malformation, the entire contents of which are incorporated herein by reference. As a result, the blood vessels are prone to leakage, which can cause the health problems related to this condition. Cavernous malformations can occur anywhere in the body, but usually produce serious signs and symptoms only when they occur in the brain and spinal cord (which are described as cerebral).

(147) Approximately 25 percent of individuals with cerebral cavernous malformations never experience any related health problems. Other people with this condition may experience serious signs and symptoms such as headaches, seizures, paralysis, hearing or vision loss, and bleeding in the brain (cerebral hemorrhage). Severe brain hemorrhages can result in death. The location and number of cerebral cavernous malformations determine the severity of this disorder. These malformations can change in size and number over time.

(148) There are two forms of the condition: familial and sporadic. The familial form is passed from parent to child, and affected individuals typically have multiple cerebral cavernous malformations. The sporadic form occurs in people with no family history of the disorder. These individuals typically have only one malformation.

(149) Defective NOTCH3 signaling is associated with cerebral cavernous malformations. See, e.g., Schultz et al. (2015) Stroke 46(5):1337-43, the entire content of which is incorporated herein by reference.

(150) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of cerebral cavernous malformation.

(151) Pulmonary Arterial Hypertension

(152) Pulmonary arterial hypertension is a progressive disorder characterized by abnormally high blood pressure (hypertension) in the pulmonary artery, the blood vessel that carries blood from the heart to the lungs. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, Pulmonary Arterial Hypertension, available at ghr.nlm.nih.gov/condition/pulmonary-arterial-hypertension, the entire contents of which are incorporated herein by reference. Pulmonary arterial hypertension is one form of a broader condition known as pulmonary hypertension. Pulmonary hypertension occurs when most of the very small arteries throughout the lungs narrow in diameter, which increases the resistance to blood flow through the lungs. To overcome the increased resistance, blood pressure increases in the pulmonary artery and in the right ventricle of the heart, which is the chamber that pumps blood into the pulmonary artery. Ultimately, the increased blood pressure can damage the right ventricle of the heart.

(153) Signs and symptoms of pulmonary arterial hypertension occur when increased blood pressure cannot fully overcome the elevated resistance. As a result, the flow of oxygenated blood from the lungs to the rest of the body is insufficient. Shortness of breath (dyspnea) during exertion and fainting spells are the most common symptoms of pulmonary arterial hypertension. People with this disorder may experience additional symptoms, particularly as the condition worsens. Other symptoms include dizziness, swelling (edema) of the ankles or legs, chest pain, and a rapid heart rate.

(154) The present subject matter provides diagnostic, prognostic, treatment, and monitoring methods, as well as related compositions, kits, and systems, for each subtype, symptom, and/or complication of pulmonary arterial hypertension.

(155) Subjects at Risk of Developing a Small Vessel Disease or a Symptom or Complication of a Small Vessel Disease

(156) Aspects of the present subject matter relate to inhibiting or preventing a SVD (or a complication or symptom thereof) in a subject who is at risk of developing the SVD (or a symptom or complication thereof). In some embodiments, a subject at risk of developing an SVD or a symptom or complication thereof is administered a therapeutic treatment for the SVD prior to the subject's diagnosis or perception of the SVD or a symptom or complication of the SVD. In certain embodiments, a subject who has not been affirmatively diagnosed with a SVD or a symptom or complication thereof receives, or is advised or directed to receive, additional diagnostic testing or screening for the SVD based on the result of a diagnostic or prognostic method disclosed herein. In various embodiments, a subject is advised or directed to receive treatment for a SVD based on the result of a diagnostic or prognostic method disclosed herein.

(157) Risk factors may vary from SVD to SVD. However, a subject may generally be considered to be at risk of suffering from a SVD or a symptom or complication thereof if the subject has at least 1 or 2 grandparents, parents, or siblings who suffers from the SVD or the symptom or complication thereof. Additional non-limiting examples of risk factors for SVDs are discussed below.

(158) Cerebral SVD has frequently been found on computed tomography (CT) and magnetic resonance imaging (MRI) scans of elderly people. See, e.g., van Norden et al., (2011) BMC Neurology BMC series 11:29, the entire contents of which are incorporated herein by reference. In various embodiments, an elderly subject (e.g., a subject who is at least about 70, 75, 80, 85, 90, or 95 years old) is deemed to be at risk of and treated and/or screened for (e.g., using a diagnostic or prognostic method disclosed herein) cerebral SVD and/or a complication or symptom of cerebral SVD. Symptoms and complications of cerebral SVD are disclosed herein and include, e.g., vascular cognitive impairment, hemorrhages and microbleeds, neuropathy, strokes, dementia, and/or parkinsonism. In various embodiments, a subject at risk of developing cerebral SVD or a complication or symptom thereof is a subject who has suffered from at least one stroke. In certain embodiments, a subject is at risk of developing cerebral SVD or a complication or symptom thereof if the subject has hypertension (e.g., a systolic pressure of at least 140 mmHg or a diastolic pressure of at least 90 mmHg) and/or amyloid deposits in the walls of the blood vessels of the central nervous system. There are also hereditary risk factors for cerebral SVD. See, e.g., Plancher et al. Case Rep Neurol. 2015 May-August; 7(2): 142-147, the entire contents of which are incorporated herein by reference. In some embodiments, the subject has a mutated gene that is associated with cerebral SVD. In certain embodiments, a subject is at risk of developing cerebral SVD if the subject has at least 1 or 2 grandparents, parents, and/or sibling who suffers or has suffered from cerebral SVD or a complication or symptom thereof, and/or who has a gene mutation that is associated with cerebral SVD.

(159) In some embodiments, the subject (or at least 1 or 2 grandparents, parents, and/or siblings thereof) has a mutation in a COL4A1 gene (which encodes the type IV collagen alpha-1 chain). COL4A1-related brain SVD is part of a group of conditions called the COL4A1-related disorders. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, COL4A1-related brain small-vessel disease, available at ghr.nlm.nih.gov/condition/col4a1-related-brain-small-vessel-disease#genes, the entire contents of which are incorporated herein by reference. The conditions in this group have a range of signs and symptoms that involve fragile blood vessels. COL4A1-related brain small-vessel disease is characterized by weakening of the blood vessels in the brain. Stroke is often the first symptom of this condition, typically occurring in mid-adulthood. In affected individuals, stroke is usually caused by bleeding in the brain (hemorrhagic stroke) rather than a lack of blood flow in the brain (ischemic stroke), although either type can occur. Individuals with this condition are at increased risk of having more than one stroke in their lifetime. People with COL4A1-related brain small vessel disease also have leukoencephalopathy, which is a change in a type of brain tissue called white matter that can be seen with MRI. Affected individuals may also experience seizures and migraine headaches accompanied by visual sensations known as auras. In various embodiments, a subject with a COL4A1 mutation is at risk of and treated and/or screened for (e.g., using a diagnostic or prognostic method disclosed herein) for a symptom or complication such as a ischemic stroke, a hemorrhagic stroke, a migraine, a seizure, leukomalacia, nephropathy, hematuria, chronic muscle cramps, and/or a ocular anterior segment disease.

(160) In some embodiments, a subject is at risk of cerebral SVD (e.g., sporadic cerebral SVD). In certain embodiments, the subject (or at least 1 grandparent, parent, aunt, uncle, cousin, and/or sibling thereof) has a mutation in a COL4A2 gene. COL4A2 is associated with lacunar ischemic stroke and deep intracerebral hemorrhage (ICH). See, e.g., Rannikme et al. (2017) COL4A2 is associated with lacunar ischemic stroke and deep ICH: Meta-analyses among 21,500 cases and 40,600 controls Neurology October 24; 89(17):1829-1839.

(161) In embodiments, subjects at risk of ICH (e.g., deep or lobar ICH) and/or ischemic stroke (IS) (e.g., lacunar, cardioembolic, or large vessel disease) include subjects with a mutation in a COL4A1 or COL4A2 gene.

(162) Subjects at risk of developing CARASIL or CADASIL and/or a symptom or complication thereof include subjects with at least 1 or 2 grandparents, parents, or siblings who suffer from CARASIL, or CADASIL, and/or the symptom or complication thereof. Subjects at risk of developing CARASIL also include subjects who carry a mutation in the HTRA1 gene, or who have a grandparent, parent, or sibling who carries such a mutation. Subjects at risk of developing CADASIL also include subjects who carry a mutation in the NOTCH3 gene, or who have a grandparent, parent, or sibling who carries such a mutation.

(163) Subjects at risk of developing AMD (such as wet or dry AMD) and/or a symptom or complication thereof include subjects with high blood pressure, heart disease, a high-fat diet or one that is low in certain nutrients (such as antioxidants and zinc), obesity, repeated and/or prolonged exposure to ultraviolet (UV) rays from sunlight, or who smoke or have smoked for at least about 1, 5, 10, or more years. Subjects at risk of developing AMD and/or a symptom or complication thereof also include subjects with at least 1 or 2 grandparents, parents, or siblings who suffer from AMD, and/or the symptom or complication thereof. In various embodiments, a subject who carries a mutation in a CFH, ARMS2, HTRA1 gene, or a gene involved in transporting or processing HDL.

(164) Subjects at risk of developing retinopathy include subjects with diabetes, arterial hypertension, sickle cell disease, a retinal vascular disease such as retinal vein or artery occlusion, Alstrm syndrome, or Bardet-Biedl syndrome. Subjects at risk of developing retinopathy also include premature human newborns (infants about 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more weeks old who were born after less than about 9, 8, or 7, months of pregnancy), subjects who have been exposed to ionizing radiation, and subjects whose retinas have been exposed to direct sunlight. In some embodiments, the retinopathy is diabetic retinopathy. Subjects at risk of developing diabetic retinopathy include, e.g., subjects with type 1 or type 2 diabetes. In various embodiments, the retinopathy is proliferative (e.g., proliferative diabetic retinopathy).

(165) Subjects at risk of developing heart failure include subjects with high blood pressure, coronary artery disease, diabetes, sleep apnea, a congenital heart defect, valvular heart disease, or irregular heartbeats. Subjects at risk of heart failure also include alcoholics and former alcoholics, subjects who have used tobacco (e.g., who have smoked cigarettes for at least about 5, 10, 15, or 20 years), subjects who are obese, and subjects who have had a heart attack. Subjects who have taken rosiglitazone, pioglitazone, and nonsteroidal anti-inflammatory drugs (NSAIDs) [e.g., regularly (such as 1, 2, 3, 4, 5, 6, or 7 times per week) for at least about 1, 2, 3, 4, or 5 years] are also at risk for heart failure.

(166) Subjects at risk of developing nephropathy (especially diabetic nephropathy) include subjects who have hyperglycemia, hypertension, at least 1 grandparent, parent, aunt, uncle, cousin, or sibling with nephropathy or hypertension. Additional non-limiting examples include subjects who smoke or have smoked for at least about 1, 5, 10, or more years.

(167) Such subjects may be screened and/or treated using the methods, compositions, kits, and systems disclosed herein.

(168) Antibodies for Biomarkers

(169) As used herein, the term antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, F.sub.ab, F.sub.ab and F.sub.(ab)2 fragments, an F.sub.ab expression library, single-chain antibody molecules (e.g., scFv), and multispecific antibodies formed from antibody fragments. By specifically bind or immunoreacts with is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react (i.e., bind) with other polypeptides or binds at much lower affinity (K.sub.d>10.sup.6) with other polypeptides.

(170) An antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.

(171) The terms full length antibody, intact antibody, and whole antibody are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region.

(172) The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one light (about 25 kDa) and one heavy chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a J region of about 12 or more amino acids, with the heavy chain also including a D region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ea., 2nd ed. Raven Press, N.Y. (1989)). The variable regions of each light/heavy chain pair form the antibody binding site.

(173) In general, antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG.sub.1, IgG.sub.2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.

(174) The term antigen-binding site or binding portion refers to the part of the immunoglobulin molecule that participates in antigen binding. The antigen binding site is formed by amino acid residues of the N-terminal variable (V) regions of the heavy (H) and light (L) chains. Three highly divergent stretches within the V regions of the heavy and light chains, referred to as hypervariable regions, are interposed between more conserved flanking stretches known as framework regions, or FRs. Thus, the term FR refers to amino acid sequences which are naturally found between, and adjacent to, hypervariable regions in immunoglobulins. In an antibody molecule, the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as complementarity-determining regions, or CDRs. The assignment of amino acids to each domain is in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk J. Mol. Biol. 196:901-917 (1987), Chothia et al. Nature 342:878-883 (1989).

(175) An Fv fragment is an antibody fragment which contains a complete antigen recognition and binding site. This region consists of a dimer of one heavy and one light chain variable domain in tight association, which can be covalent in nature, for example in scFv. It is in this configuration that the three hypervariable regions (HVRs) of each variable domain interact to define an antigen binding site on the surface of the VH-VL dimer. Collectively, the six HVRs or a subset thereof confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although usually at a lower affinity than the entire binding site.

(176) A Fab fragment contains a variable and constant domain of the light chain and a variable domain and the first constant domain (CHI) of the heavy chain. F(ab) 2 antibody fragments comprise a pair of Fab fragments which are generally covalently linked near their carboxy termini by hinge cysteines between them. Other chemical couplings of antibody fragments are also known in the art,

(177) Single-chain Fv or scFv antibody fragments comprise the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally the Fv polypeptide further comprises a polypeptide linker between the VH and L domains, which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, Vol 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-31S (1994).

(178) The term diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH and VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, BP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).

(179) The expression linear antibodies refers to antibodies as described in Zapata et al., Protein Eng., 8 (10): 1057-1062 (1995). Briefly, these antibodies comprise a pair of tandem segments which, together with complementary light chain polypeptides, form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.

(180) The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.

(181) As used herein, the term epitope includes any protein determinant capable of specific binding to an antibody, an antibody fragment, or a T-cell receptor. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. An antibody is said to specifically bind an antigen when the dissociation constant is 1 M; preferably 100 nM and most preferably 10 nM.

(182) Antibodies can be produced according to various methods known in the art.

(183) Methods of preparing monoclonal antibodies are known in the art. For example, monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256:495. In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. The immunizing agent will typically include a full length protein or a fragment thereof. Generally, either peripheral blood lymphocytes (PBLs) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (see pp. 59-103 in Goding (1986) Monoclonal Antibodies: Principles and Practice Academic Press). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.

(184) In some examples, the antibodies to an epitope for an interested protein as described herein or a fragment thereof are humanized antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, F.sub.ab, F.sub.ab, F.sub.(ab)2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al. 1986. Nature 321:522-525; Riechmann et al. 1988. Nature 332:323-329; Presta. 1992. Curr. Op. Struct. Biol. 2:593-596). Humanization can be essentially performed following methods of Winter and co-workers (see, e.g., Jones et al. 1986. Nature 321:522-525; Riechmann et al. 1988. Nature 332:323-327; and Verhoeyen et al. 1988. Science 239:1534-1536), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (e.g., U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.

(185) In various examples the antibodies to an epitope of an interested protein as described herein or a fragment thereof are human antibodies. Human antibodies can also be produced using various techniques known in the art, including phage display libraries (Hoogenboom and Winter. 1991. J. Mol. Biol. 227:381-388; Marks et al. 1991. J. Mol. Biol. 222:581-597) or the preparation of human monoclonal antibodies (e.g., Cole et al. 1985. Monoclonal Antibodies and Cancer Therapy Liss; Boerner et al. 1991. J. Immunol. 147(1):86-95). Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in most respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, e.g., in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al. 1992. Bio/Technology 10:779-783; Lonberg et al. 1994. Nature 368:856-859; Morrison. 1994. Nature 368:812-13; Fishwild et al. 1996. Nature Biotechnology 14:845-51; Neuberger. 1996. Nature Biotechnology 14:826; Lonberg and Huszar. 1995. Intern. Rev. Immunol. 13:65-93. U.S. Pat. No. 6,719,971 also provides guidance to methods of generating humanized antibodies.

(186) Exemplary antibodies against endostatin include, but are not limited to, antibodies obtained from Abcam (Cambridge, MA, USA) (e.g., Cat. Nos. ab64569, ab3453, ab202973, ab53702, ab175857, ab119279, ab15685, ab84250, ab114141, ab10604, ab11525, ab106491, ab109611, and ab53381), antibodies obtained from antibodies-online.com (Atlanta, GA, USA) (e.g., Cat. Nos. ABIN2871757, ABIN669951, ABIN108513, ABIN2192047, ABIN2878778, ABIN305768, and ABIN809524), and antibodies obtained from ThermoFisher Scientific (Cambridge, MA, USA) (e.g., Cat. Nos. PA1-601, MA1-40230, MA1-72504, PA1-30191, PAS-24199, and PAS-38894).

(187) Exemplary antibodies against NOTCH3 include, but are not limited to, antibodies obtained from Abcam (Cambridge, MA, USA) (e.g., Cat. Nos. ab23426, ab95775, ab213632, ab192006, ab60087, and ab92758), antibodies obtained from antibodies-online.com (Atlanta, GA, USA) (e.g., Cat. Nos. ABIN2804742, ABIN358709, ABIN784287, ABIN562028, ABIN2663860, ABIN2657987, ABIN2658376, ABIN2663861, ABIN2665307, ABIN966685, and ABIN2665306), and antibodies obtained from ThermoFisher Scientific (Cambridge, MA, USA) (e.g., Cat. Nos. A16683, PAS-22797, PAS-19515, PAS-13203, PAS-28082, A18521, and PAS-47120).

(188) Exemplary antibodies against HTRA1 include, but are not limited to, antibodies obtained from Abcam (Cambridge, MA, USA) (e.g., Cat. Nos. ab38611, ab113927, ab199529, and ab38610), antibodies obtained from antibodies-online.com (Atlanta, GA, USA) (e.g., Cat. Nos. ABIN388128, ABIN388127, ABIN356844, ABIN356843, ABIN970921, ABIN1873114, and ABIN1904101), and antibodies obtained from ThermoFisher Scientific (Cambridge, MA, USA) (e.g., Cat. Nos. PAS-23395, PAS-11413, and PA5-11412).

(189) Exemplary antibodies against IGFBP-1 include, but are not limited to, antibodies obtained from ThermoFisher Scientific (Cambridge, MA, USA) (e.g., Cat. Nos. MA1-24775 and MA5-23727), antibodies obtained from Abcam (Cambridge, MA, USA) (e.g., Cat. Nos. ab10732 and ab181141), and antibodies obtained from R&D Systems (Minneapolis, MN, USA) (e.g., Cat. Nos. MAB675 and AF871).

(190) Amplification-Based Detection Methods

(191) RT-PCR is in particularly broad use as a method for amplifying mRNA sequences of interest. Details regarding the use of RT-PCR, PCR, and other amplification methods can be found in any of a variety of standard texts. One of skill will appreciate that essentially any RNA can be converted into DNA suitable for PCR expansion using a reverse transcriptase and a polymerase.

(192) Prior to amplification and/or detection of a nucleic acid (e.g., an mRNA molecule encoding collagen181/endostatin, IGFBP-1, HTRA1, or NOTCH3), the nucleic acid is optionally purified from the a sample. Alternately, a sample can simply be directly subjected to amplification or detection, e.g., following aliquoting and/or dilution.

(193) Suitable primers to be used with the invention can be designed using any suitable method. It is not intended that the invention be limited to any particular primer or primer pair. For example, primers can be designed using any suitable software program, such as

(194) LASERGENE, e.g., taking account of publicly available sequence information. Sequences for mRNA transcripts of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 proteins are publicly available. Thus, suitable amplification primers can be constructed based on well understood base-pairing rules. The presence of any mRNA or amplicon thereof can be detected, e.g., by hybridization (e.g., array or probe hybridization), amplification (e.g., comprising RT-PCR), sequencing, and the like (as well as combinations of these or other approaches).

(195) In various embodiments, a pair of primers that is complementary to a single transcript is used. In certain embodiments, one or more of the primers used comprises a sequence of nucleic acids that is not complementary to the transcript. For example, a primer may comprise a tag sequence that identifies the primer, and/or that may be used to identify the sample or amplicons derived from the sample after future processing (e.g. when multiple samples are analyzed using a single microarray). In some embodiments, the tag sequence is at least about 4, 5, 6, 7, 8, 9, or 10 nucleotides long and/or less than about 20, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, or 4 nucleotides long.

(196) In some embodiments, the primers are radiolabeled, or labelled by any suitable means (e.g., using a non-radioactive fluorescent tag), to allow for rapid visualization of differently sized amplicons following an amplification reaction without any additional labelling step or visualization step. In some embodiments, the primers are not labelled, and the amplicons are visualized following their size resolution, e.g., following agarose or acrylamide gel electrophoresis. In some embodiments, ethidium bromide staining of the PCR amplicons following size resolution allows visualization of the different size amplicons.

(197) It is not intended that the primers be limited to generating an amplicon of any particular size. For example, the primers used to amplify the mRNA herein are not limited to amplifying the entire mRNA, or any subregion thereof. The primers can generate an amplicon of any suitable length for detection. In some embodiments, amplification produces an amplicon at least 20 nucleotides in length, or alternatively, at least 50 nucleotides in length, or alternatively, at least 100 nucleotides in length, or alternatively, at least 200 nucleotides in length. Amplicons of any size can be detected using various technologies described herein and known in the art. Differences in base composition or size can be detected by conventional methods such as electrophoresis.

(198) In some embodiments, PCR detection using dual-labelled fluorogenic oligonucleotide probes, commonly referred to as TaqMan probes is used. These probes are composed of short (e.g., 20-25 base) oligodeoxynucleotides that are labelled with two different fluorescent dyes. On the 5 terminus of each probe is a reporter dye, and on the 3 terminus of each probe a quenching dye is found. The oligonucleotide probe sequence is complementary to an internal target sequence present in a PCR amplicon. When the probe is intact, energy transfer occurs between the two fluorophores and emission from the reporter is quenched by the quencher by FRET. During the extension phase of PCR, the probe is cleaved by 5 nuclease activity of the polymerase used in the reaction, thereby releasing the reporter from the oligonucleotide-quencher and producing an increase in reporter emission intensity. Accordingly, TaqMan probes are oligonucleotides that have a label and a quencher, where the label is released during amplification by the exonuclease action of the polymerase used in amplification. This provides a real time measure of amplification during synthesis. A variety of TaqMan reagents are commercially available, e.g., from Applied Biosystems (Division Headquarters in Foster City, Calif.) as well as from a variety of specialty vendors such as Biosearch Technologies (e.g., black hole quencher probes). Further details regarding dual-label probe strategies can be found, e.g., in PCT International Patent Application Publication No. WO 92/02638.

(199) Other similar methods include e.g. fluorescence resonance energy transfer between two adjacently hybridized probes, e.g., using the LightCycler format described in U.S. Pat. No. 6,174,670, issued Jan. 16, 2001.

(200) Array-Based Detection

(201) Array-based detection can be performed using commercially available arrays, e.g., from Affymetrix (Santa Clara, Calif.) or other manufacturers. Reviews regarding the operation of nucleic acid arrays include Sapolsky et al., 1999 Genet Anal: Biomolec Engin 14: 187-192; Lockhart, 1998 Nature Medicine 4: 1235-1236; Fodor, 1997a FASEB Journal 11:A879; Fodor, 1997b Science 277: 393-395 and Chee et al., 1996 Science 274:610-614. Array based detection is one exemplary method for identification nucleotides (such as mRNA molecules or amplicons thereof) in samples, due to the inherently high-throughput nature of array based detection.

(202) A variety of probe arrays have been described in the literature and can be used to detect mRNA or amplicons thereof (e.g., obtained using RT-PCR). For example, DNA probe array chips or larger DNA probe array wafers (from which individual chips would otherwise be obtained by breaking up the wafer) may be used. DNA probe array wafers may comprise, e.g., glass wafers on which high density arrays of DNA probes (short segments of DNA) have been placed. Each of these wafers can hold, for example, approximately 60 million DNA probes that are used to recognize longer sample DNA sequences (e.g., from individuals or populations). The recognition of a polynucleotide by the set of DNA probes on the glass wafer takes place through DNA hybridization. When a polynucleotide hybridizes with an array of DNA probes, the sample binds to those probes that are complementary to the polynucleotide sequence.

(203) In some implementations, the polynucleotide to be analyzed (e.g., an mRNA encoding collagen181/endostatin, IGFBP-1, HTRA1, or NOTCH3) is isolated, amplified and labelled with biotin and/or a fluorescent reporter group. The labelled nucleic acid may then be incubated with the array using a fluidics station and hybridization oven. The array can be washed and or stained or counter-stained, as appropriate to the detection method. After hybridization, washing and staining, the array is inserted into a scanner, where patterns of hybridization are detected. The hybridization data are collected as light emitted from the fluorescent reporter groups already incorporated into the labelled nucleic acid, which is now bound to the probe array. Probes that most clearly match the labelled nucleic acid produce stronger signals than those that have mismatches. Since the sequence and position of each probe on the array are known, by complementarity, the identity of the nucleic acid sample applied to the probe array can be identified.

(204) In one embodiment, two DNA samples may be differentially labelled and hybridized with a single set of the designed genotyping arrays. In this way two sets of data can be obtained from the same physical arrays. Labels that can be used include, but are not limited to, cychrome, fluorescein, or biotin (later stained with phycoerythrin-streptavidin after hybridization). Two-color labelling is described in U.S. Pat. No. 6,342,355, issued Jan. 29, 2002. Each array may be scanned such that the signal from both labels is detected simultaneously, or may be scanned twice to detect each signal separately.

(205) In various embodiments, intensity data is collected by the scanner for all the markers for each of the individuals that are tested for presence or level of the marker. The measured intensities are a measure indicative of the amount of a particular marker present in the sample for a given individual (i.e., the expression level).

(206) In some embodiments, the level of mRNA is measured by RNA sequencing. In various embodiments, the level of a protein is measured by mass spectrometry (MS). In certain embodiments, the protein is measures by gas chromatography-mass spectrometry (GC-MS), liquid chromatography-mass spectrometry (LC-MS), MALDI-TOF (which combines a matrix-assisted laser desorption/ionization source with a time-of-flight mas analyzer).

(207) General Definitions

(208) Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art (e.g., in cell culture, molecular genetics, and biochemistry).

(209) As used herein, the term about in the context of a numerical value or range means10% of the numerical value or range recited or claimed, unless the context requires a more limited range.

(210) In the descriptions above and in the claims, phrases such as at least one of or one or more of may occur followed by a conjunctive list of elements or features. The term and/or may also occur in a list of two or more elements or features. Unless otherwise implicitly or explicitly contradicted by the context in which it is used, such a phrase is intended to mean any of the listed elements or features individually or any of the recited elements or features in combination with any of the other recited elements or features. For example, the phrases at least one of A and B; one or more of A and B; and A and/or B are each intended to mean A alone, B alone, or A and B together. A similar interpretation is also intended for lists including three or more items. For example, the phrases at least one of A, B, and C; one or more of A, B, and C; and A, B, and/or C are each intended to mean A alone, B alone, C alone, A and B together, A and C together, B and C together, or A and B and C together. In addition, use of the term based on, above and in the claims is intended to mean, based at least in part on, such that an unrecited feature or element is also permissible

(211) It is understood that where a parameter range is provided, all integers within that range, and tenths thereof, are also provided by the invention. For example, 0.2-5 mg is a disclosure of 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg etc. up to and including 5.0 mg.

(212) A small molecule is a compound that is less than 2000 daltons in mass. The molecular mass of the small molecule is preferably less than 1000 daltons, more preferably less than 600 daltons, e.g., the compound is less than 500 daltons, 400 daltons, 300 daltons, 200 daltons, or 100 daltons.

(213) As used herein, an isolated or purified nucleic acid molecule, polynucleotide, polypeptide, or protein, is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized. Purified compounds are at least 60% by weight (dry weight) the compound of interest. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight the compound of interest. For example, a purified compound is one that is at least 90%, 91%, 92%, 93%, 94%, 95%, 98%, 99%, or 100% (w/w) of the desired compound by weight. Purity is measured by any appropriate standard method, for example, by column chromatography, thin layer chromatography, or high-performance liquid chromatography (HPLC) analysis. A purified or isolated polynucleotide (ribonucleic acid (RNA) or deoxyribonucleic acid (DNA)) is free of the genes or sequences that flank it in its naturally-occurring state. Purified also defines a degree of sterility that is safe for administration to a human subject, e.g., lacking infectious or toxic agents.

(214) Similarly, by substantially pure is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it. Typically, the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.

(215) The transitional term comprising, which is synonymous with including, containing, or characterized by, is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase consisting of excludes any element, step, or ingredient not specified in the claim. The transitional phrase consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention.

(216) The terms subject, patient, individual, and the like as used herein are not intended to be limiting and can be generally interchanged. An individual described as a subject, patient, individual, and the like does not necessarily have a given disease, but may be merely seeking medical advice. The terms subject, patient, individual, and the like as used herein include all members of the animal kingdom that may suffer from the indicated disorder. In some aspects, the subject is a mammal, and in some aspects, the subject is a human.

(217) As used herein, the singular forms a, an, and the include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to a disease, a disease state, or a nucleic acid is a reference to one or more such embodiments, and includes equivalents thereof known to those skilled in the art and so forth.

(218) As used herein, treating encompasses, e.g., inhibition, regression, or stasis of the progression of a disorder. For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, alleviation or amelioration of any symptom or symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, preventing spread of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and recovery (whether partial or total), whether detectable or undetectable. As used herein, inhibition of disease progression or a disease complication in a subject means preventing or reducing the disease progression and/or disease complication in the subject.

(219) As used herein, a symptom associated with a disorder includes any clinical or laboratory manifestation associated with the disorder, and is not limited to what the subject can feel or observe.

(220) As used herein, effective when referring to an amount of a therapeutic compound refers to the quantity of the compound that is sufficient to yield a desired therapeutic response without undue adverse side effects (such as toxicity, irritation, or allergic response) commensurate with a reasonable benefit/risk ratio when used in the manner of this disclosure.

(221) As used herein, pharmaceutically acceptable carrier or excipient refers to a carrier or excipient that is suitable for use with humans and/or animals without undue adverse side effects (such as toxicity, irritation, and allergic response) commensurate with a reasonable benefit/risk ratio. It can be, e.g., a pharmaceutically acceptable solvent, suspending agent or vehicle, for delivering the instant compounds to the subject.

(222) A control sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample. For example, a test sample can be taken from a test subject, e.g., a subject in need of diagnosis for a small vessel disease, and compared to samples from known conditions, e.g., a subject (or subjects) that does not have the small vessel disease (a negative or normal control), or a subject (or subjects) who does have the small vessel disease (positive control). A control can also represent an average value gathered from a number of tests or results. One of skill in the art will recognize that controls can be designed for assessment of any number of parameters. One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are variable in controls, variation in test samples will not be considered as significant.

(223) The term diagnosis refers to a relative probability that a disease is present in the subject. Similarly, the term prognosis refers to a relative probability that a certain future outcome may occur in the subject. For example, in the context of the present disclosure, prognosis can refer to the likelihood that an individual will develop a disease, or the likely severity of the disease (e.g., severity of symptoms, rate of functional decline, survival, etc.). The terms are not intended to be absolute, as will be appreciated by any one of skill in the field of medical diagnostics.

(224) The term, normal amount with respect to a compound (e.g., a protein or mRNA) refers to a normal amount of the compound in an individual who does not have a SVD or in a healthy or general population. The amount of a compound can be measured in a test sample and compared to the normal control level, utilizing techniques such as reference limits, discrimination limits, or risk defining thresholds to define cutoff points and abnormal values (e.g., for a particular SVD or a symptom thereof). The normal control level means the level of one or more compounds or combined compounds typically found in a subject known not suffering from an SVD. Such normal control levels and cutoff points may vary based on whether a compounds is used alone or in a formula combining with other compounds into an index. Alternatively, the normal control level can be a database of compounds patterns from previously tested subjects who did not develop a SVD or a particular symptom thereof (e.g., in the event the SVD develops or a subject already having the SVD is tested) over a clinically relevant time horizon.

(225) The level that is determined may be the same as a control level or a cut off level or a threshold level, or may be increased or decreased relative to a control level or a cut off level or a threshold level. In some aspects, the control subject is a matched control of the same species, gender, ethnicity, age group, smoking status, body mass index (BMI), current therapeutic regimen status, medical history, or a combination thereof, but differs from the subject being diagnosed in that the control does not suffer from the disease (or a symptom thereof) in question or is not at risk for the disease.

(226) Relative to a control level, the level that is determined may an increased level. As used herein, the term increased with respect to level (e.g., protein or mRNA level) refers to any % increase above a control level. In various embodiments, the increased level may be at least or about a 5% increase, at least or about a 10% increase, at least or about a 15% increase, at least or about a 20% increase, at least or about a 25% increase, at least or about a 30% increase, at least or about a 35% increase, at least or about a 40% increase, at least or about a 45% increase, at least or about a 50% increase, at least or about a 55% increase, at least or about a 60% increase, at least or about a 65% increase, at least or about a 70% increase, at least or about a 75% increase, at least or about a 80% increase, at least or about a 85% increase, at least or about a 90% increase, at least or about a 95% increase, relative to a control level.

(227) Relative to a control level, the level that is determined may a decreased level. As used herein, the term decreased with respect to level (e.g., protein or mRNA level) refers to any % decrease below a control level. In various embodiments, the decreased level may be at least or about a 5% decrease, at least or about a 10% decrease, at least or about a 15% decrease, at least or about a 20% decrease, at least or about a 25% decrease, at least or about a 30% decrease, at least or about a 35% decrease, at least or about a 40% decrease, at least or about a 45% decrease, at least or about a 50% decrease, at least or about a 55% decrease, at least or about a 60% decrease, at least or about a 65% decrease, at least or about a 70% decrease, at least or about a 75% decrease, at least or about a 80% decrease, at least or about a 85% decrease, at least or about a 90% decrease, at least or about a 95% decrease, relative to a control level.

(228) Risk in the context of the present disclosure, relates to the probability that an event will occur over a specific time period, as in the development of a SVD or a symptom thereof, and can mean a subject's absolute risk or relative risk. In various embodiments, a high risk subject is a subject who is likely to develop a SVD or symptom within, e.g., about 1, 2, 3, 4, or 5 years. Absolute risk can be measured with reference to either actual observation post-measurement for the relevant time cohort, or with reference to index values developed from statistically valid historical cohorts that have been followed for the relevant time period. Relative risk refers to the ratio of absolute risks of a subject compared either to the absolute risks of low risk cohorts or an average population risk, which can vary by how clinical risk factors are assessed. Odds ratios, the proportion of positive events to negative events for a given test result, are also commonly used [odds are according to the formula p/(1p) where p is the probability of event and (1p) is the probability of no event] to no-conversion.

(229) Embodiments and examples are provided below to facilitate a more complete understanding of the invention. The following embodiments and examples illustrate the exemplary modes of making and practicing the invention. However, the scope of the invention is not limited to specific embodiments disclosed in these embodiments and examples, which are for purposes of illustration only, since alternative methods can be utilized to obtain similar results.

EMBODIMENTS

(230) Embodiments include Embodiments P1 to P40 following.

(231) Embodiment P1. A method for diagnosing a small vessel disease (SVD) in a subject in need thereof comprising (a) providing a test sample from said subject; (b) assaying the level of endostatin, High-Temperature Requirement A Serine Peptidase 1 (HTRA1), insulin-like growth factor binding protein 1 (IGFBP-1), and/or Neurogenic Locus Notch Homolog Protein 3 (NOTCH3) in the test sample; and (c) diagnosing the subject with the SVD if (i) the level of endostatin, IGFBP-1, and/or HTRA1 is elevated in the test sample compared to a normal control, and/or (ii) the level of NOTCH3 is reduced in the test sample compared to the normal control.

(232) Embodiment P2. The method of Embodiment P1, wherein said subject is diagnosed with the SVD if (i) the level of endostatin, IGFBP-1, and/or HTRA1 is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control; and/or (ii) the level of NOTCH3 reduced by about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 95%, 99%, 100%, 5-50%, 50-75%, or 75-100% in said test sample compared to a normal control.

(233) Embodiment P3. A method for identifying whether a subject is at risk of developing a SVD comprising (a) providing a test sample from said subject; (b) assaying the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the test sample; and (c) identifying the subject as at risk of developing the SVD if (i) the level of endostatin, IGFBP-1, and/or HTRA1 is elevated in the test sample compared to a normal control, and/or (ii) the level of NOTCH3 is reduced in the test sample compared to the normal control.

(234) Embodiment P4. The method of Embodiment P3, wherein said subject is identified as at risk of developing the SVD if (i) the level of endostatin, IGFBP-1, and/or HTRA1 is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control; and/or (ii) the level of NOTCH3 reduced by about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 95%, 99%, 100%, 5-50%, 50-75%, or 75-100% in said test sample compared to a normal control.

(235) Embodiment P5. The method of Embodiment P3 or P4, further comprising directing the subject to obtain (i) additional screening or an additional diagnostic test for the SVD if the subject is identified as at risk of developing the SVD; or (ii) treatment to reduce, delay, or prevent the onset or progression of the SVD.

(236) Embodiment P6. A method for monitoring whether a SVD is progressing in a subject who has been diagnosed with the SVD, comprising periodically determining the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in said subject, and (1) identifying the SVD as worsening if (i) the level of endostatin, IGFBP-1, and/or HTRA1 increases over time, and/or (ii) the level of NOTCH3 decreases over time; (2) identifying the SVD as improving if (i) the level of endostatin, IGFBP-1, and/or HTRA1 decreases over time, and/or (ii) the level of NOTCH3 increases over time; or (3) identifying the SVD as neither worsening nor improving if the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 remains the same or about the same over time, wherein determining the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 comprises (a) providing a test sample from said subject; and (b) assaying the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the test sample.

(237) Embodiment P7. The method of Embodiment P6, wherein the level of endostatin, IGFBP-1, NOTCH3, and/or HTRA1 is determined at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times and/or at least once every 1, 2, 3, or 4 weeks; at least once every 1, 2, 3, 4, 5, or 6 weeks; or at least once every 1, 2, 3, 4, or 5 years.

(238) Embodiment P8. A method for identifying a prognosis for a subject who has been diagnosed with a SVD comprising (a) providing a test sample from said subject; (b) assaying the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the test sample; and (c) comparing the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 determined in (b) to a value in a database to identify the subject's risk of suffering from a symptom of SVD.

(239) Embodiment P9. The method of Embodiment P8, wherein said database contains (i) endostatin, IGFBP-1, HTRA1, and/or NOTCH3 level values from subjects who have suffered from said symptom of SVD; or (ii) absolute or relative risk values calculated based on endostatin, IGFBP-1, HTRA1, and/or NOTCH3 level values from subjects who have suffered from said symptom of SVD.

(240) Embodiment P10. The method of Embodiment P9, wherein said absolute or relative risk values comprise mean or median level values calculated using endostatin, IGFBP-1, HTRA1, and/or NOTCH3 level values from subjects who have suffered from said symptom of SVD.

(241) Embodiment P11. A method of prophylaxis for a SVD, comprising identifying whether a subject is at risk of suffering from SVD according to the method of Embodiment 3, and administering to the subject a compound that is used to treat the SVD if the subject is identified as at risk of suffering from SVD.

(242) Embodiment P12. The method of Embodiment P11, wherein said compound comprises a an anti-angiogenic compound, an anti-vascular endothelial growth factor (VEGF) compound, an anti-platelet compound, an antihypertensive compound, a platelet antiaggregant, a cholesterol-lowering compound, a 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitor, nimodipine, propentofylline, posatirelin, bevacizumab, ranibizumab, pegaptanib, aflibercept, nicardipine, verteporfin, anecortave acetate, triamcinolone acetonide, aspirin, dipyridamole, ticlopidine, a thrombolytic agent, an anticoagulant, or clopidogrel.

(243) Embodiment P13. A method for adjusting the dose of a compound that is administered to a subject during a treatment regimen for a SVD, comprising periodically determining the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the subject, and (1) increasing the dose of the compound if (i) the level of endostatin, IGFBP-1, and/or HTRA1 increases over time, and/or (ii) the level of NOTCH3 decreases over time; (2) maintaining or decreasing the dose of the compound if (i) the level of endostatin, IGFBP-1, and/or HTRA1 decreases over time, and/or (ii) the level of NOTCH3 increases over time; or (3) maintaining or increasing the dose of the compound if the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 remains the same or about the same over time, wherein determining the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 comprises (a) providing a test sample from said subject; and (b) assaying the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the test sample.

(244) Embodiment P14. A method for identifying whether a therapy has reduced or ameliorated a SVD in a subject comprising (a) providing a pre-therapy test sample from said subject; (b) assaying the pre-therapy level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the pre-therapy test sample; (c) administering the therapy to the subject; (d) providing a post-therapy test sample from said subject; (e) assaying the post-therapy level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in the post-therapy test sample; and (f) identifying the therapy as having reduced or ameliorated said SVD if (i) the level of endostatin, IGFBP-1, and/or HTRA1 in the post-therapy test sample is lower than the level of endostatin, IGFBP-1, and/or HTRA1 in the pre-therapy test sample, and/or (ii) the level of NOTCH3 in the post-therapy test sample is higher than the level of NOTCH3 in the pre-therapy test sample.

(245) Embodiment P15. The method of any one of Embodiments P1-P14, wherein the SVD comprises Age-Related Macular Degeneration (AMD).

(246) Embodiment P16. The method of any one of Embodiments P1-P15, wherein the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 is the level of endostatin and HTRA1.

(247) Embodiment P17. The method of any one of Embodiments P1-P15, which does not comprise assaying and/or detecting the HTRA1.

(248) Embodiment P18. The method of any one of Embodiments P1-P17, wherein NOTCH3 is an extracellular portion of NOTCH3.

(249) Embodiment P19. The method of any one of Embodiments P1-P18, wherein the extracellular portion of NOTCH3 is the NOTCH3 extracellular domain (N3ECD).

(250) Embodiment P20. The method of any one of Embodiments P1-P19, wherein said test sample comprises a bodily fluid from said subject.

(251) Embodiment P21. The method of Embodiment P20, wherein said bodily fluid comprises whole blood, a component of whole blood, plasma, serum, saliva, tears, vitreous, cerebrospinal fluid, sweat, cerebrospinal fluid, or urine.

(252) Embodiment P22. The method of any one of Embodiments P1-P21, wherein said test sample is other than a tissue biopsy.

(253) Embodiment P23. The method of any one of Embodiments P1-P22, wherein the subject does not contain a mutated HTRA1 gene.

(254) Embodiment P24. The method of any one of Embodiments P1-P23, which does not comprise assaying and/or detecting the level of Fas ligand (FasL).

(255) Embodiment P25. The method of any one of Embodiments P1-P14 or P16-P24, wherein said SVD comprises cerebral SVD.

(256) Embodiment P26. The method of any one of Embodiments P1-P14 or P16-P25, wherein said SVD comprises a stroke, vascular cognitive impairment, dementia, nephropathy, retinopathy, or neuropathy.

(257) Embodiment P27. The method of any one of Embodiments P1-P14 or P16-P26, wherein said SVD comprises cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL), age-related macular degeneration (AMD), cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), NOTCH3 loss of function-associated SVD, nephropathy, microangiopathy, heart failure, Alagille syndrome, familial tetralogy of Fallot, patent ductus arteriosus, a cerebral cavernous malformation, pulmonary arterial hypertension, or diabetic retinopathy.

(258) Embodiment P28. The method of any one of Embodiments P1-P25, wherein said SVD comprises AMD and said AMD is dry AMD or wet AMD.

(259) Embodiment P29. The method of any one of Embodiments P1-P28, wherein said subject has diabetes.

(260) Embodiment P30. The method of any one of Embodiments P1-P29, wherein assaying the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 comprises contacting said endostatin, IGFBP-1, HTRA1, and/or NOTCH3 with an endostatin-specific, IGFBP specific HTRA1-specific and/or NOTCH3-specific binding agent.

(261) Embodiment P31. The method of Embodiment P30, wherein said binding agent comprises an antibody or a fragment thereof, a polypeptide or a fragment thereof, or a nucleic acid.

(262) Embodiment P32. The method of Embodiment P31, wherein said binding agent comprises an antibody or a fragment thereof.

(263) Embodiment P33. The method of Embodiment P32, wherein said antibody comprises an anti-endostatin antibody, an anti-IGFBP-1 antibody, an anti-HTRA1 antibody or an anti-NOTCH3 antibody.

(264) Embodiment P34. The method of Embodiment P32 or P33, wherein said antibody or fragment thereof is attached to a solid support.

(265) Embodiment P35. The method of any one of Embodiments P1-P34, wherein said assaying comprises an enzyme immunoassay (EIA).

(266) Embodiment P36. The method of any one of Embodiments P1-P35, wherein said assaying comprises an enzyme-linked immunosorbent assay (ELISA), a Western blot, a mass spectrometry assay, a radioimmunoassay, or a fluoroimmunoassay.

(267) Embodiment P37. The method of Embodiment 31, wherein said nucleic acid comprises a probe or a primer that is complementary to mRNA that encodes collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3.

(268) Embodiment P38. The method of any one of Embodiments P1-P31 or 37, wherein said assaying comprises a polymerase chain reaction (PCR).

(269) Embodiment P39. A kit comprising (a) at least two agents selected from the group consisting of (i) an agent for detecting the level of endostatin; (ii) an agent for detecting the level of NOTCH3; (iii) an agent for detecting the level of IGFBP-1; and (iv) an agent for detecting the level of HTRA1, and (b) instructions for using the agent for diagnosing a SVD, for identifying whether a subject is at risk of developing the SVD, for determining the prognosis of the SVD, for determining the progression of SVD, for assessing the efficacy of a treatment for the SVD, and/or for adjusting the dose of a compound during the treatment of SVD.

(270) Embodiment P40. A diagnostic system comprising (a) an assortment, collection, or compilation of test results data representing the level of endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in a plurality of test samples; (b) a means for computing an index value using said level, wherein the index value comprises a diagnostic, prognostic, progression, or treatment score; and (c) a means for reporting the index value.

(271) Additional embodiments include Embodiments 1 to 69 following:

(272) Embodiment 1. A method for diagnosing a small vessel disease (SVD) in a subject comprising (a) assaying the level of (i) Neurogenic Locus Notch Homolog Protein 3 (NOTCH3), collagen181/endostatin, High-Temperature Requirement A Serine Peptidase 1 (HTRA1), and/or insulin-like growth factor binding protein 1 (IGFBP-1), (ii) a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3, in a test sample from said subject; and (b) diagnosing the subject with the SVD if (i) the level of collagen181/endostatin, IGFBP-1, and/or HTRA1 is elevated in the test sample compared to a normal control, and/or (ii) the level of collagen181/endostatin or NOTCH3 is reduced in the test sample compared to the normal control, and/or (iii) the protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 is detected in the test sample.

(273) Embodiment 2. The method of Embodiment 1, wherein NOTCH3 is a NOTCH3 extracellular domain (N3ECD) protein comprising the amino acid sequence of SEQ ID NO: 5, and wherein assaying the level of NOTCH3 comprises contacting the N3ECD protein with an anti-N3ECD antibody.

(274) Embodiment 3. The method of Embodiment 1, wherein (i) assaying the level of NOTCH3 comprises detecting the level of a NOTCH3 protein comprising the amino acid sequence of SEQ ID NO: 3 or 5; (ii) assaying the level of collagen181/endostatin comprises detecting the level of a collagen181/endostatin protein comprising the amino acid sequence of SEQ ID NO: 1; (iii) assaying the level of HTRA1 comprises detecting the level of a HTRA1 protein having the amino acid sequence of SEQ ID NO: 9; and/or (iv) assaying the level of IGFBP-1 comprises detecting the level of an IGFBP-1 protein comprising the amino acid sequence of SEQ ID NO: 7.

(275) Embodiment 4. The method of any one of Embodiments 1-3 wherein (i) assaying the level of collagen181/endostatin comprises contacting the collagen181/endostatin protein with an anti-collagen181/endostatin antibody; (ii) assaying the level of IGFBP-1 comprises contacting the IGFBP-1 potein with an anti-IGFBP-1 antibody; (iii) assaying the level of HTRA1 comprises contacting the HTRA1 protein with an anti-HTRA1 antibody; and/or (iv) assaying the level of NOTCH3 comprises contacting the NOTCH3 protein with an anti-NOTCH3 antibody.

(276) Embodiment 5. The method of Embodiment 1, wherein (i) assaying the level of collagen181/endostatin comprises detecting the level of collagen181/endostatin mRNA; (ii) assaying the level of HTRA1 comprises detecting the level of HTRA1 mRNA; (iii) assaying the level of IGFBP-1 comprises detecting the level of IGFBP-1 mRNA; and/or (iv) assaying the level of NOTCH3 comprises detecting the level of NOTCH3 mRNA.

(277) Embodiment 6. The method of any one of Embodiments 1-5, wherein (i) detecting the level of collagen181/endostatin mRNA comprises contacting the collagen181/endostatin mRNA with a probe or a primer that is complementary to SEQ ID NO: 2; (ii) detecting the level of HTRA1 mRNA comprises contacting the HTRA1 mRNA with a probe or a primer that is complementary to SEQ ID NO: 10; (iii) detecting the level of IGFBP-1 mRNA comprises contacting the IGFBP-1 mRNA with a probe or a primer that is complementary to SEQ ID NO: 8; and/or (iv) detecting the level of NOTCH3 mRNA comprises contacting the NOTCH3 mRNA with a probe or a primer that is complementary to SEQ ID NO: 4.

(278) Embodiment 7. The method of Embodiment 1, wherein said subject is diagnosed with the SVD if (i) the level of collagen181/endostatin, IGFBP-1, and/or HTRA1 is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control; and/or (ii) the level of collagen181/endostatin or NOTCH3 reduced by about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 95%, 99%, 100%, 5-50%, 50-75%, or 75-100% in said test sample compared to a normal control.

(279) Embodiment 8. A method for identifying whether a subject is at risk of developing a SVD comprising (a) assaying the level of (i) collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3, and/or (ii) a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 in a test sample from said subject; and (b) identifying the subject as at risk of developing the SVD if (i) the level of collagen181/endostatin, IGFBP-1, and/or HTRA1 is elevated in the test sample compared to a normal control, and/or (ii) the level of collagen181/endostatin or NOTCH3 is reduced in the test sample compared to the normal control, and/or (iii) the protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 is detected in the test sample.

(280) Embodiment 9. The method of Embodiment 8, wherein said subject is identified as at risk of developing the SVD if (i) the level of collagen181/endostatin, IGFBP-1, and/or HTRA1 is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control; and/or (ii) the level of collagen181/endostatin or NOTCH3 reduced by about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 95%, 99%, 100%, 5-50%, 50-75%, or 75-100%, in said test sample compared to a normal control.

(281) Embodiment 10. The method of Embodiment 8, further comprising directing the subject to obtain (i) additional screening or an additional diagnostic test for the SVD if the subject is identified as at risk of developing the SVD; or (ii) treatment to reduce, delay, or prevent the onset or progression of the SVD.

(282) Embodiment 11. A method for monitoring whether a SVD is progressing in a subject who has been diagnosed with the SVD, comprising periodically determining the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 in said subject, and (1) identifying the SVD as worsening if (i) the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or the complex increases over time, and/or (ii) the level of collagen181/endostatin or NOTCH3 decreases over time; (2) identifying the SVD as improving if (i) the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or the complex decreases over time, and/or (ii) the level of collagen181/endostatin or NOTCH3 increases over time; or (3) identifying the SVD as neither worsening nor improving if the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex remains the same or about the same over time, wherein determining the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 comprises assaying the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex in a test sample from the subject.

(283) Embodiment 12. The method of Embodiment 11, wherein the level of collagen181/endostatin, IGFBP-1, NOTCH3, HTRA1, and/or the complex is determined at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times and/or at least once every 1, 2, 3, or 4 weeks; at least once every 1, 2, 3, 4, 5, or 6 weeks; or at least once every 1, 2, 3, 4, or 5 years.

(284) Embodiment 13. A method for identifying a prognosis for a subject who has been diagnosed with a SVD comprising (a) assaying the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 in a test sample from the subject; and (b) comparing the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex determined in (a) to a value in a database to identify the subject's risk of suffering from a symptom of SVD.

(285) Embodiment 14. The method of Embodiment 13, wherein said database contains (i) collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or complex level values from subjects who have suffered from said symptom of SVD; or (ii) absolute or relative risk values calculated based on collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or complex level values from subjects who have suffered from said symptom of SVD.

(286) Embodiment 15. The method of Embodiment 14, wherein said absolute or relative risk values comprise mean or median level values calculated using collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, complex level values from subjects who have suffered from said symptom of SVD.

(287) Embodiment 16. A method of prophylaxis for a SVD, and administering to a subject a compound that is used to treat the SVD if the subject has been identified as at risk of suffering from SVD according to the method of Embodiment 3.

(288) Embodiment 17. The method of Embodiment 16, wherein said compound comprises a an anti-angiogenic compound, an anti-vascular endothelial growth factor (VEGF) compound, an anti-platelet compound, an antihypertensive compound, a platelet antiaggregant, a cholesterol-lowering compound, a 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitor, nimodipine, propentofylline, posatirelin, bevacizumab, ranibizumab, pegaptanib, aflibercept, nicardipine, verteporfin, anecortave acetate, triamcinolone acetonide, aspirin, dipyridamole, ticlopidine, a thrombolytic agent, an anticoagulant, or clopidogrel.

(289) Embodiment 18. The method of Embodiment 17, wherein the SVD is cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL) and the compound is not a thrombolytic agent.

(290) Embodiment 19. A method for adjusting the dose of a compound that is administered to a subject during a treatment regimen for a SVD, comprising periodically determining the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 in the subject, and (1) increasing the dose of the compound if (i) the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or the complex increases over time, and/or (ii) the level of collagen181/endostatin or NOTCH3 decreases over time; (2) maintaining or decreasing the dose of the compound if (i) the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or the complex decreases over time, and/or (ii) the level of collagen181/endostatin or NOTCH3 increases over time; or (3) maintaining or increasing the dose of the compound if the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex remains the same or about the same over time, wherein determining the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 comprises assaying the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex in a test sample from the subject.

(291) Embodiment 20. A method for identifying whether a therapy has reduced or ameliorated a SVD in a subject comprising (a) assaying the pre-therapy level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 in a pre-therapy test sample from the subject; (b) administering the therapy to the subject; (c) assaying the post-therapy level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex in a post-therapy test sample from the subject; and (d) identifying the therapy as having reduced or ameliorated said SVD if (i) the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or the complex in the post-therapy test sample is lower than the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or the complex in the pre-therapy test sample, and/or (ii) the level of collagen181/endostatin pr NOTCH3 in the post-therapy test sample is higher than the level of collagen181/endostatin or NOTCH3 in the pre-therapy test sample.

(292) Embodiment 21. The method of any one of Embodiments 1-20, wherein the SVD comprises Age-Related Macular Degeneration (AMD).

(293) Embodiment 22. The method of any one of Embodiments 1-21, wherein the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 is the level of collagen181/endostatin and HTRA1.

(294) Embodiment 23. The method of any one of Embodiments 1-22, which does not comprise assaying and/or detecting the HTRA1.

(295) Embodiment 24. The method of any one of Embodiments 1-23, wherein NOTCH3 is an extracellular portion of NOTCH3.

(296) Embodiment 25. The method of any one of Embodiments 1-24, wherein the extracellular portion of NOTCH3 is the NOTCH3 extracellular domain (N3ECD).

(297) Embodiment 26. The method of any one of Embodiments 1-25, wherein said test sample comprises a bodily fluid from said subject.

(298) Embodiment 27. The method of any one of Embodiments 1-26, wherein said bodily fluid comprises whole blood, a component of whole blood, plasma, serum, saliva, tears, vitreous, cerebrospinal fluid, sweat, cerebrospinal fluid, or urine.

(299) Embodiment 28. The method of any one of Embodiments 1-27, wherein said test sample is other than a tissue biopsy.

(300) Embodiment 29. The method of any one of Embodiments 1-28, wherein the subject does not contain a mutated HTRA1 gene.

(301) Embodiment 30. The method of any one of Embodiments 1-29, which does not comprise assaying and/or detecting the level of Fas ligand (FasL).

(302) Embodiment 31. The method of any one of Embodiments 1-30, wherein said SVD comprises cerebral SVD.

(303) Embodiment 32. The method of any one of Embodiments 1-31, wherein said SVD comprises a stroke, vascular cognitive impairment, dementia, nephropathy, retinopathy, or neuropathy.

(304) Embodiment 33. The method of any one of Embodiments 1-32, wherein said SVD comprises cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL), age-related macular degeneration (AMD), CADASIL, NOTCH3 loss of function-associated SVD, nephropathy, microangiopathy, heart failure, Alagille syndrome, familial tetralogy of Fallot, patent ductus arteriosus, a cerebral cavernous malformation, pulmonary arterial hypertension, or diabetic retinopathy.

(305) Embodiment 34. The method of any one of Embodiments 1-33, wherein said SVD comprises AMD and said AMD is dry AMD or wet AMD.

(306) Embodiment 35. The method of any one of Embodiments 1-34, wherein said subject has diabetes.

(307) Embodiment 36. The method of any one of Embodiments 1-35, wherein assaying the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 comprises contacting said collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 with an collagen181/endostatin-specific, IGFBP-1-specific HTRA1-specific and/or NOTCH3-specific binding agent.

(308) Embodiment 37. The method of Embodiment 36, wherein said binding agent comprises an antibody or a fragment thereof, a polypeptide or a fragment thereof, or a nucleic acid.

(309) Embodiment 38. The method of Embodiment 37, wherein said binding agent comprises an antibody or a fragment thereof.

(310) Embodiment 39. The method of Embodiment 38, wherein said antibody comprises an anti-collagen181/endostatin antibody, an anti-IGFBP-1 antibody, an anti-HTRA1 antibody or an anti-NOTCH3 antibody.

(311) Embodiment 40. The method of Embodiment 38, wherein said antibody or fragment thereof is attached to a solid support.

(312) Embodiment 41. The method of any one of Embodiments 1-40 wherein said assaying comprises an enzyme immunoassay (EIA).

(313) Embodiment 42. The method of any one of Embodiments 1-41, wherein said assaying comprises an enzyme-linked immunosorbent assay (ELISA), a Western blot, a mass spectrometry assay, a radioimmunoassay, or a fluoroimmunoassay.

(314) Embodiment 43. The method of any one of Embodiments 1-42, wherein said assaying comprises high-performance liquid chromatography (HPLC), liquid chromatography-mass spectrometry (LC/MS), protein immunoprecipitation, immunoelectrophoresis, or protein immunostaining.

(315) Embodiment 44. The method of any one of Embodiments 1-43, wherein said nucleic acid comprises a probe or a primer that is complementary to mRNA that encodes collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3.

(316) Embodiment 45. The method of any one of Embodiments 1-44, wherein said assaying comprises a polymerase chain reaction (PCR).

(317) Embodiment 46. The method of any one of Embodiments 1-45, wherein said assaying comprises quantitative reverse transcription PCR, microarray analysis, RNA sequencing, Northern analysis, a Nuclease Protection Assay, or in situ hybridization.

(318) Embodiment 47. A kit comprising (a) at least two agents selected from the group consisting of (i) an agent for detecting the level of collagen181/endostatin; (ii) an agent for detecting the level of NOTCH3; (iii) an agent for detecting the level of IGFBP-1; and (iv) an agent for detecting the level of HTRA1, and (b) instructions for using the agent for diagnosing a SVD, for identifying whether a subject is at risk of developing the SVD, for determining the prognosis of the SVD, for determining the progression of SVD, for assessing the efficacy of a treatment for the SVD, and/or for adjusting the dose of a compound during the treatment of SVD.

(319) Embodiment 48. A diagnostic system comprising (a) an assortment, collection, or compilation of test results data representing the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 in a plurality of test samples; (b) a means for computing an index value using said level, wherein the index value comprises a diagnostic, prognostic, progression, or treatment score; and (c) a means for reporting the index value.

(320) Embodiment 49. A method for detecting collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or a protein-protein complex comprising NOTCH3 bound to collagen181/endostatin, HTRA1, IGFBP-1, and/or NOTCH3 in a subject, the method comprising assaying the level of collagen181/endostatin, IGFBP-1, HTRA1, NOTCH3, and/or the complex in a test sample from the subject, wherein the subject has an SVD.

(321) Embodiment 50. The method of Embodiment 49, wherein the level of collagen181/endostatin, IGFBP-1, HTRA1, and/or NOTCH3 is the level of collagen181/endostatin protein, IGFBP-1 protein, HTRA1 protein, and/or NOTCH3 protein.

(322) Embodiment 51. The method of Embodiment 50, wherein detecting the level of a protein comprises immunoprecipitating the protein and then measuring the level of the protein by mass spectrometry.

(323) Embodiment 52. The method of Embodiment 50, wherein assaying the level of collagen181/endostatin protein, IGFBP-1 protein, HTRA1 protein, and/or NOTCH3 protein comprises contacting the sample with an anti-collagen181/endostatin antibody, an anti-IGFBP-1 antibody, an anti-HTRA1 antibody, and/or an anti-NOTCH3 antibody, and detecting binding between collagen181/endostatin and the anti-collagen181/endostatin antibody, IGFBP-1 and the anti-IGFBP-1 antibody, HTRA1 and the anti-HTRA1 antibody, and/or NOTCH3 and the anti-NOTCH3 antibody.

(324) Embodiment 53. The method of Embodiment 49, which does not comprise assaying the level of HTRA1.

(325) Embodiment 54. The method of c Embodiment laim 49, which does not comprise assaying the level of Fas ligand (FasL).

(326) Embodiment 55. The method of Embodiment 49, wherein NOTCH3 is an extracellular portion of NOTCH3.

(327) Embodiment 56. The method of Embodiment 55, wherein the extracellular portion of NOTCH3 is the NOTCH3 extracellular domain (N3ECD).

(328) Embodiment 57. The method of Embodiment 49, wherein said test sample comprises a bodily fluid from said subject.

(329) Embodiment 58. The method of Embodiment 49, wherein said bodily fluid comprises whole blood, a component of whole blood, plasma, serum, saliva, tears, vitreous, cerebrospinal fluid, sweat, cerebrospinal fluid, or urine.

(330) Embodiment 59. The method of Embodiment 49, wherein said test sample is other than a tissue biopsy.

(331) Embodiment 60. The method of Embodiment 49, wherein assaying does not comprise a microarray.

(332) Embodiment 61. The method of Embodiment 49, wherein no more than 1000 proteins or mRNA molecules is assayed.

(333) Embodiment 62. The method of Embodiment 49, comprising assaying the level of NOTCH3.

(334) Embodiment 63. The method of Embodiment 62, comprising assaying the level of collagen181/endostatin.

(335) Embodiment 64. The method of Embodiment 62, comprising assaying the level of IGFBP-1.

(336) Embodiment 65. The method of Embodiment 62, comprising assaying the level of HTRA1.

(337) Embodiment 66. The method of Embodiment 49, comprising assaying the level of the complex.

(338) Embodiment 67. The method of Embodiment 49, wherein herein said SVD comprises cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL), age-related macular degeneration (AMD), cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), NOTCH3 loss of function-associated SVD, nephropathy or another SVD of the kidney, proximal 19p13.12 microdeletion syndrome, myocardial ischemia, microangiopathy, heart failure, Alagille syndrome, familial tetralogy of Fallot, patent ductus arteriosus, a cerebral cavernous malformation, a HTRA1-associated small vessel disease, pulmonary arterial hypertension, retinopathy, or diabetic retinopathy.

(339) Embodiment 68. A method of treating or preventing a SVD in a subject who has been diagnosed as having a SVD according to Embodiment 1, comprising administering to a subject a compound that is used to treat the SVD.

(340) Embodiment 69. The method of Embodiment 68, wherein said compound comprises a an anti-angiogenic compound, an anti-vascular endothelial growth factor (VEGF) compound, an anti-platelet compound, an antihypertensive compound, a platelet antiaggregant, a cholesterol-lowering compound, a 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitor, nimodipine, propentofylline, posatirelin, bevacizumab, ranibizumab, pegaptanib, aflibercept, nicardipine, verteporfin, anecortave acetate, triamcinolone acetonide, aspirin, dipyridamole, ticlopidine, a thrombolytic agent, an anticoagulant, or clopidogrel.

Example 1: Blood Biomarkers in a Mouse Model of CADASIL

(341) Mutations in NOTCH3 are the cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), a neurological disorder characterized by stroke, and vascular cognitive impairment and dementia. Loss of vascular smooth muscle cells (VSMC) and accumulation of granular osmiophilic material (GOM) deposits are hallmarks of CADASIL. There are no therapies for CADASIL and experimental endpoints to examine the preclinical efficacy of potential drugs are lacking. In this Example a mouse carrying the C455R mutation in NOTCH3 was used to identify biomarkers associated with CADASIL. Mass spectrometry and antibody arrays were used to explore the aorta and blood proteomes of CADASIL mice, ELISA assays were utilized for biomarker validation, a ligand-dependent assay was applied to examine the relationship between NOTCH signaling and biomarker expression, and retinal histology was performed for quantification of VSMC loss in arteries. Two-hundred day-old mice with the C455R CADASIL mutation in NOTCH3 mice display robust VSMC loss in retinal arteries and had increased plasma levels of collagen181/endostatin (col181) and high-temperature requirement A serine peptidase 1 (HTRA1) and reduced levels of NOTCH3 extracellular domain (N3ECD), compared to control wild type mice. Measurements of plasma endostatin, HTRA1 and N3ECD, along with VSMC quantification in retinal arteries, may serve as surrogate endpoints for assessing efficacy in preclinical therapeutic studies of CADASIL using mice.

(342) Ischemic cerebral small-vessel disease is a prevalent cause of stroke and a strong contributor to vascular cognitive impairment and dementia (Snyder et al., 2015, Alzheimers Dement. 11, 710-7). Multiple clinical studies show strong an association among ischemic cerebral small-vessel disease, aging, and cardiovascular risk factors (Kalaria, 2012, Stroke; a journal of cerebral circulation. 43, 2526-34; Thompson and Hakim, 2009, Stroke: J. Cereb. Circ. 40, e322-e330; Vermeer et al., 2007, The Lancet. Neurology. 6, 611-9). Little is known about the cellular and molecular mechanisms underlying the development of ischemic cerebral small-vessel disease and therapies are lacking. Mendelian conditions resembling key aspects of ischemic cerebral small-vessel disease, in the absence of cardiovascular risk factors, have been described in adult patients (Gould et al., 2006, The New England Journal of Medicine. 354, 1489-96; Hara et al., 2009; Joutel and Faraci, 2014). The study of these inherited ischemic cerebral small-vessel diseases may reveal key pathophysiological mechanisms, uncover biomarkers with diagnostic or prognostic potential, and define molecular targets for rational therapeutics. One such ischemic cerebral small-vessel disease is cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy, (CADASIL), the most common form of inherited SVD (Chabriat et al., 2009, The Lancet. Neurology. 8, 643-53).

(343) Patients with CADASIL often suffer from migraines in childhood, have recurrent ischemic strokes in the third and fourth decade of life, and experience progressive cognitive impairment (Dichgans et al., 1998, Annals of neurology. 44, 731-9). CADASIL is caused by mutations in the NOTCH3 gene, which encodes for one of four NOTCH receptor paralogues in mammals (Joutel et al., 1996, Nature. 383, 707-10). Most CADASIL mutations in NOTCH3 affect cysteine residues located within the epidermal growth factor-like repeats in the extracellular domain (Brass et al., 2009, The New England Journal of Medicine. 360, 1656-65; Dichgans et al., 2000, European journal of human genetics: EJHG. 8, 280-5; Joutel et al., 1997, Lancet. 350, 1511-5; Louvi et al., 2006, Developmental neuroscience. 28, 5-12). Postmortem studies of tissue from CADASIL patients reveal a non-amyloid, non-atherosclerotic, arteriopathy. The characteristics of this arteriopathy include VSMC death and the accumulation of deposits, detected by electron microscopy, known as granular osmiophilic material (GOM) (Baudrimont et al., 1993, Stroke: J. Cereb. Circ. 24, 122-5; Ruchoux et al., 1995, Acta neuropathologica. 89, 500-12; Ruchoux and Maurage, 1997, Journal of Neuropathology and Experimental Neurology. 56, 947-64; Tikka et al., 2009, Brain: J. Neurol. 132, 933-9). GOM deposits are specific to CADASIL and their identification in skin biopsies or brain autopsies is diagnostic (Tikka et al., 2009, Brain: J. Neurol., 132, 933-9). Biochemical studies of vessels of postmortem CADASIL cases and mouse models identified collagen 18 alpha 1(Col181)/endostatin, clusterin (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35), NOTCH3 ectodomain (N3ECD), and tissue inhibitor of metalloproteinases 3 (TIMP3) as GOM components (Ishiko et al., 2006, Acta Neuropathologica. 112, 333-9; Monet-Lepretre et. al., 2013, Brain. 136, 1830-45).

(344) In this Example, published CADASIL mouse models carrying either the C455R or R1031C mutations in NOTCH3 were used. The C455R CADASIL mutation was described in a Colombian family in whom stroke occurs earlier and MRI abnormalities are more extensive than in patients carrying the R1031C, also described in a Colombian pedigree (Arboleda-Velasquez et al., 2002, Neurology. 59, 277-9). Previous work showed that the C455R (located in the ligand-binding domain of the NOTCH3 receptor) and the R1031C (located outside this region) mutations define different hypomorphic activity states of the NOTCH3 receptor and that mice carrying these mutations develop GOM and other age-dependent phenotypes that resemble the human condition (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35).

(345) The availability of multiple CADASIL animal models, including those used in this work, allow for preclinical testing of experimental drugs (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35; Joutel and Faraci, 2014, Stroke: J. Cereb. Circ.). Such studies, as well as clinical diagnostic and treatment processes, would be greatly facilitated by the identification of specific markers of disease progression that are measurable, sensitive, and robust. The data below identifies blood biomarkers associated with CADASIL in a mouse model carrying non-synonymous mutations in NOTCH3. Blood plasma from knock-in mice models carrying NOTCH3 mutations identical to those found in Colombian families (Arboleda-Velasquez et al., 2008, 2011) was used for biomarker discovery and validation.

(346) Screening of CADASIL Biomarkers in Mouse Plasma

(347) Previous analyses of mice and humans carrying CADASIL mutations in NOTCH3 identified col18a1/endostatin, a potent and pleiotropic anti-angiogenic factor, as a protein accumulating in CADASIL vessels and a GOM component (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35; O'Reilly et al., 1997, Cell. 88, 277-85). Surprisingly, increased levels of endostatin were found in the blood of mice carrying CADASIL mutations. An antibody array capable of detecting 53 angiogenesis-related proteins was to determine whether endostatin, and/or other angiogenesis-related proteins, could be detected in plasma samples from our transgenic mice. The plasma of knock-in mice expressing the human WT NOTCH3 protein (N3KO; WT76+/; SM22-Cre) to that of mice expressing the C455R CADASIL mutant receptor (N3KO; C455R+/; SM22-Cre) at 100 and 200 days old, all in a mouse endogenous NOTCH3 knockout background (N3KO) (FIG. 1 and FIG. 7A). Furthermore, to examine whether any angiogenic-related protein candidates were regulated by NOTCH3 function, their expression was also compared in plasma from 200-day old mice lacking NOTCH3, N3KO, and N3KO mice in which NOTCH3 expression was restored in vessels using a conditional transgenic approach, N3KO; WT76+/; SM22-Cre mice (FIG. 2 and FIG. 7A).

(348) Insulin-like growth factor-binding protein-1 (IGFBP-1), stromal cell-derived factor-1 (SDF-1), and col181/endostatin were identified as potential biomarkers based on a variance analysis (see Methods). IGFBP-1 was increased in both 100- and 200-day old N3KO; C455R+/; SM22-Cre mice (FIG. 1 and FIG. 7A), with a fold change of 2.029 and 4.562, respectively). SDF-1 was more abundant in 100-day old N3KO; C455R+/SM22-Cre mice (1.752-fold-change) and less abundant in the 200-day old N3KO; C455R+/; SM22-Cre mice (0.344-fold change, FIG. 1 and FIG. 7A). Col181/endostatin, was significantly less abundant (0.800 fold change) in the 100-day-old N3KO; C455R+/; SM22-Cre mice, but, remained unchanged (1.025-fold change) in the 200-day old mice (FIG. 1 and FIG. 7A). Because protein-protein interactions within complex samples have been reported when using antibody arrays (Kodadek, 2001, Chem Biol. 8, 105-15). ELISA was utilized to validate the results. Analysis in 200-day old N3KO; C455R+/; SM22-Cre mouse plasma using ELISA showed a significant increase in plasma circulating col181/endostatin (FIG. 3A, 1.76-fold change, P<0.01).

(349) IGFBP-1 and SDF-1 levels were not changed in the plasma of mice from functional rescue comparison (N3KO vs. N3KO; WT76+/; SM22-Cre), whereas col181/endostatin was more abundant in the N3KO; WT76+/; SM22-Cre mouse when compared to the N3KO mouse, suggesting that col181/endostatin expression may be regulated by NOTCH3 signaling (FIG. 2 and FIG. 7A). Using a ligand-dependent NOTCH signaling assay (Arboleda-Velasquez et al., 2011) coculture of MEFs was found to express either the WT or C455R mutant NOTCH3 with DLL1-expressing cells led to the expression of col181 mRNA, (FIG. 3B), though induction was significantly less pronounced in the MEFs expressing the C455R mutant NOTCH3 receptor, compared to the WT (FIG. 3B). These data are in line with the hypomorphic nature of the C455R allele (Arboleda-Velasquez et al., 2011) and suggests that col181 expression is dependent on NOTCH3 functionality.

(350) Biomarkers in Degenerating Vessels

(351) Expression of the R1031C CADASIL mutant NOTCH3 receptor has been shown to trigger mural cell degeneration in the aortas of one-year old mice (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35). To search for candidate biomarkers, the proteomes of aortae of R1031C+/; SM22-Cre mice were compared with that of mice expressing the human WT NOTCH3 protein (WT76+/; SM22-Cre). Using quantitative MS (See Methods), 10 proteins that were more abundant were identified and 32 proteins that were less abundant were identified in aortas from R1031C+/; SM22-Cre mice compared to control WT76+/; SM22-Cre mice (FIG. 7B). From this list, focus was directed at high-temperature requirement A serine protease (HTRA1), which was upregulated by about 2-fold in CADASIL aortas, because mutations in HTRA1 have previously been identified as the cause of a similar SVD called cerebral autosomal recessive with subcortical infarcts and leukoencephalopathy (CARASIL) (Hara et al., 2009). To further support the notion that HTRA1 is misregulated in NOTCH3 mutant mice, ELISA was used to measure the plasma levels of HTRA1 in the C455R model (the model used in the antibody arrays above). ELISA analysis of plasma from the CADASIL N3KO; C455R+/; SM22-Cre mice showed a significant increase in HTRA1, compared to N3KO; WT76+/; SM22-Cre controls (FIG. 4, fold-change of 1.83, P<0.05).

(352) NOTCH3 Ectodomain as a CADASIL Biomarker

(353) Experiments were performed to investigate whether N3ECD could be detected in plasma and whether its levels were changed in the presence of NOTCH3 mutations. As a commercial ELISA is not available, a custom assay was designed (see Methods). No signal above background in WT C57BL/6 mice or in the NOTCH3 knockout mice (N3KO; WT76+/) whereas signal was copious in mice expressing the human NOTCH3 protein (N3KO; WT76+/; SM22-Cre), indicating that the N3ECD ELISA was specific for the human N3ECD (Data not shown and FIG. 5). The maximum linear range of the ELISA was 2 g/ml (FIG. 5A). This assay was also capable of detecting N3ECD in both human plasma and serum samples, with higher levels found in the serum (FIG. 5B, 14 ng/ul versus 51 ng/ul, P<0.01). There was a significant decrease in circulating N3ECD in the plasma of CADASIL N3KO; C455R+/; SM22-Cre mice when compared to N3KO; WT76+/; SM22-Cre controls (FIG. 5C, 0.6-fold change, P<0.01). RNA transgene expression was similar for CADASIL and control mice (FIG. 5D).

(354) CADASIL Mice have a Robust Vascular Smooth Muscle Cell Loss Phenotype

(355) These analyses indicate that CADASIL mutations are associated with changes in plasma levels of endostatin, HTRA1 and N3ECD in mice. The level of VSMC degeneration was examined in the retina of CADASIL N3KO; C455R+/; SM22-Cre mice. The retina was focused on because it is part of the central nervous system, has a blood barrier similar to that of the brain, and it has a highly stereotypic vascular bed allowing for systematic quantification of VSMC loss. Using smooth muscle actin (SMA), a marker for VSMC, mice carrying the C455R mutation were observed to have large gaps in VSMC (FIG. 6). This loss appeared to occur uniformly throughout the vasculature with about a 25% percent decrease in total coverage in CADASIL mice 200-days of age compared to mice carrying the WT transgene; this is the same time point at which the biomarker analyses were performed, (FIG. 6E and FIG. 8).

(356) Immunofluorescence localization revealed strong N3ECD staining throughout the retinal vasculature of the CADASIL mice, N3KO; C455R+/; SM22-Cre, most prominently in large caliber arteries, whereas expression in the control N3KO; WT76+/; SM22-Cre mice was less robust (FIG. 9). Col181/endostatin staining was also localized to retinal vessels (FIG. 10), but in contrast to the N3ECD staining was detected predominantly in capillaries at the periphery of the retina in CADASIL N3KO; C455R+/; SM22-Cre mice.

(357) Blood Biomarkers and Diagnostic Methods for SVDs

(358) In the present Example, mouse models of CADASIL, carrying either the C455R or the R1031C mutations in NOTCH3, were used to identify increased plasma levels of col181/endostatin and HTRA1, decreased levels of N3ECD, and loss of VSMC in retinal vessels as candidate biomarkers associated with CADASIL mutations in mice. Mice expressing the C455R mutant NOTCH3 receptor displayed robust VSMC loss in the retinal vasculature by six-months of age. The cerebrovasculature of these mice carrying the C455R mutation in NOTCH3 is being characterized, however, analyses of the retina offer significant advantages including clear visualization of coverage along the length of individual vessels and their branches in a tissue containing a blood barrier similar to that of the brain. Previous analyses of the retinal vasculature in NOTCH3 mutant mouse models have also been helpful in identifying pericytes loss further validating the use of the retinal vasculature as informative for CADASIL phenotypes (Henshall et al., 2015, Arterioscler Thromb Vasc Biol. 35, 409-20; Kofler et al., 2015, Sci Rep. 5, 16449).

(359) Antibody arrays for angiogenesis-related proteins were used to determine whether proteins in this category could be dysregulated in CADASIL mice. Antibody arrays are not without limitations because the results could be affected by protein-protein interactions within the sample mixture (Kodadek, 2001, Chem Biol. 8, 105-15), which may explain the discrepancy in the results for endostatin between antibody arrays and ELISA. Notwithstanding these limitations, the endostatin finding may be functionally relevant to the pathobiology of CADASIL as identified possible differences in the vascular distribution of col181/endostatin in the retina were identified and differences in circulating levels of endostatin have been shown to be prognostic for ischemic stroke (Navarro-Sobrino et al., 2011, Atherosclerosis. 216, 205-11). Furthermore, the analyses in this Example indicated that the increased plasma levels of col181/endostatin in mice carrying the C455R mutation was not directly related to the effects of the CADASIL mutation on NOTCH3 signaling; col181/endostatin mRNA expression levels were increased in cells expressing WT human NOTCH3 and reduced in cells expressing the C455R mutant.

(360) Using aortas from mice carrying the R1031C mutation, MS analysis identified HTRA1 as a misregulated protein. In humans, CADASIL affects primarily small caliber vessels in the brain (Louvi et al., 2006, Developmental Neuroscience. 28, 5-12), although possible effects in large vessels have not been systematically analyzed. In CADASIL mice, however, the phenotype reported was overt, with aortas losing about half their width by one year of age (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35), providing a rationale for using this tissue in this Example. The finding of HTRA1 changes in affected vessels from a CADASIL mouse model is of particular interest because mutations in this protein are associated with a similar SVD known as CARASIL (Hara et al., 2009, The New England journal of medicine. 360, 1729-39). The similarities between CADASIL and CARASIL have been reviewed in detail (Tikka et al., 2014, Brain: J. Neurol. 132, 933-939), however, notable similarities include cerebral small vessel disease associated with a loss of VSMC coverage, stroke and cognitive impairment. It is unclear how the NOTCH3 CADASIL mutations lead to HTRA1 accumulation in vessels and in plasma and whether HTRA1 may contribute to CADASIL pathobiology. Mutations in CARASIL have been proposed to cause a loss of function in HTRA1 activity and, by effect, a gain of function in TGF- signaling as the mutant HTRA1 fails to repress TGF- signaling (Hara et al., 2009, The New England journal of medicine. 360, 1729-39). However, another hypothesis postulates that CARASIL pathobiology is associated with diminished TGF- signaling caused by defective HTRA1-mediated cleavage of latent TGF- binding protein 1 (LTBP-1), a known TGF- facilitator protein (Beaufort et al., 2014, Proc Natl Acad Sci USA. 111, 16496-501).

(361) The C455R CADASIL mouse model had less detectable N3ECD in plasma when compared to controls and this difference was not explained by differences in levels of mRNA expression. The decreased levels of N3ECD may be related to impaired NOTCH3 signaling as it is known that upon proteolytic cleavage of the NOTCH receptors the NOTCH ectodomain is released from the receptor expressing cell and transendocytosed into the ligand-expressing cell (Klueg and Muskavitch, 1999, J Cell Sci. 112 (Pt 19), 3289-97), a process that may be impaired by deficient signaling. Alternatively, it is possible that mutant N3ECD accumulates in vessels as GOMs, as it has been suggested occurs in humans and mouse models (Monet-Lepretre et al., 2013, Brain. 136, 1830-45; Joutel et al., 2010, J Clin Invest. 120, 433-45), resulting in less detectable N3ECD in plasma of the CADASIL mice (FIG. 5C). In support of this concept, N3ECD staining was found to be more prominent in vessels from CADASIL (C455R) mice compared to controls. The notion that the extracellular domain of the NOTCH3 receptor circulates in blood and that its levels may change in CADASIL is novel and it remains to be established if they are functional in this compartment. The use of N3ECD as a plasma biomarker may have some practical advantages over the recently reported Notch3 score, which represents a measure for the NOTCH3 accumulation based upon immunohistochemistry analysis of postmortem brain tissue from mice (Rutten et al., 2015), as plasma N3ECD could be measured over time from live animals allowing prospective analyses.

(362) Monitoring the level of these biomarkers at the beginning and end of a trial may offer a means to quantify the efficacy of a treatment that is both inexpensive and technically feasible. Possible therapies include modulation of NOTCH3 signaling to test the NOTCH3 signaling defect hypothesis in CADASIL (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA. 108, E128-35). Other approaches include therapeutic NOTCH3 cysteine correction in CADASIL using exon skipping or allele specific regulation of NOTCH3 expression, which will constitute a direct test of the NOTCH3 (ECD) toxic accumulation cascade hypothesis (Rutten et al., 2016, Brain 139 (Pt 4):1123-35).

(363) The present subject matter provides three circulating protein biomarkers SVD: endostatin, HTRA1, and NOTCH3. Those these biomarkers were identified in in a C445R mouse model of CADASIL, they are useful for diagnostic, prognostic, and therapeutic methods disclosed herein. Changes in these proteins occurred in mice by 200-days of age, coincident with a significant loss of VSMC in the retina. Quantification of these three proteins, along with analyses of VSMC coverage in the retina, may be used as a surrogate endpoints in future preclinical trials of CADASIL and other SVDs, as well as in clinical settings, such as during the treatment and/or diagnostic and/or prognostic evaluation of subjects.

(364) Experimental Procedures

(365) Animal Models

(366) All mouse models used in this study were previously described (Arboleda-Velasquez et al., 2008, Proc Natl Acad Sci USA 105, 4856-61; Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA, 108, E128-35). Briefly, mice express either a wild type human NOTCH3 transgene (WT76) or a mutated human NOTCH3 transgene (C455R or R1031C), or a NOTCH ligand (DLL1); transgenes are inserted into the ROSA26 locus (Soriano, 1999, Nat Genet. 21, 70-1) and expression occurs through Cre-mediated recombination.

(367) Both male and female animals were included in the study.

(368) Plasma Collection

(369) Plasma was collected from mice with the following genotypes: a mouse endogenous NOTCH3 knockout (N3KO), and a N3KO mouse heterozygous for the WT (WT76) human or mutant (C455R) human NOTCH3 transgene, both driven by SM22-Cre (N3KO; WT76+/; SM22-Cre and N3KO; C455R+/; SM22-Cre, respectively). Mice were anesthetized using a mixture of ketamine (120 mg/kg) and xylazine (20 mg/kg) using a 0.5, 27 G needle via intraperitoneal injection. Under anesthesia, the anterior chest wall was removed and the left ventricle was pierced with a 0.5, 20 G needle. Blood was aspirated and dispensed, into a BD Vacutainer K2 EDTA, lavender top, blood collection tube (BD 367841). This tube was inverted several times to ensure the blood made contact with the entire surface of the EDTA-coated tube. The tube was then placed on ice and immediately processed for plasma following the manufacture's protocol. Plasma was aliquoted into 100 l volumes in Eppendorf LoBind Protein Microcentrifuge Tubes (Eppendorf, 022431102) then stored at 80 C. until use.

(370) Human Plasma Collection

(371) Plasma was prepared from blood obtained through venipuncture using BD Vacutainer K2 EDTA tubes then stored at 80 C. until use.

(372) Candidate Biomarker Screening Using an Angiogenesis Antibody Array Plasma (200 l) from control mice (N3KO; WT76+/; SM22-Cre), CADASIL mutant mice (N3KO; C455R+/; SM22-Cre), and endogenous NOTCH3 knockout mice (N3KO) was processed on the Proteome Profiler Angiogenesis Array Kit (R&D Systems, ARY015), according to the manufacture's protocol. For all antibody arrays, two control and two experimental mice were used. Dot blot analysis was performed via Image J by measuring integrated density. Background was accounted for by subtracting the integrated density of the dot's surrounding area. A variance analysis was conducted on each array (FIGS. 1 and 2) to identify potential candidate proteins, as previously described (Arboleda-Velasquez et al., 2011). Proteins of interest were considered to be differentially abundant in plasma if the absolute value of the difference between the two control (N3KO; WT76+/; SM22-Cre) and two experimental (N3KO; C455R+/; SM22-Cre) mice exceeded 1.5 times the variation (equation below).

(373) Var = ( Control 1 - Control 2 ) 2 + ( Experimental 1 - Experimental 2 ) 2 2

(374) Candidate proteins that were differentially abundant in at least two of the three arrays were selected for validation via ELISA.

(375) Candidate Biomarker Identification Utilizing a MS Proteomic Screen

(376) The material used for MS was obtained from a cohort of previously published mice and analyzed for different parameters (Arboleda-Velasquez et al., 2011, Proc Natl Acad Sci USA, 108, E128-35). The genotypes of the mice, all wild type for the endogenous mouse NOTCH3, were heterozygous for the WT (WT76) human or mutant (R1031C) human NOTCH3 transgene, driven by SM22-Cre (WT76+/; SM22-Cre and R1031C+/; SM22-Cre), respectively.

(377) Aortas were isolated from one-year old mice and homogenized in 8 M urea and 50 mmol/L Tris-HCl (pH 8). Protein from each sample was reduced, alkylated and digested using 1 g of Lys-C at 37 C. overnight. Peptides from proteolytic digestion were desalted and labeled using reductive dimethylation (Boersema et al., 2008, Proteomics. 8, 4624-32; Hsu et al., 2003, Anal Chem. 75, 6843-52). Samples were labeled with light (CH2ONaBH3CN) and heavy (CD2O-NaBD3CN) reagents, respectively. The samples were washed with 0.1% formic acid and eluted from the column using 80% ACN and 0.5% acetic acid. Samples were then dried down using a vacuum centrifuge. Peptides from light or heavy aorta samples were separated by strong cation-exchange chromatography into 20 fractions. Each fraction was dried down by vacuum centrifugation and desalted using self-packed C18 STAGE-tips (Rappsilber et al., 2003, Anal Chem. 75, 663-70). All liquid chromatography-tandem mass spectrometry (LC-MS/MS) data were obtained using an LTQ-Orbitrap Discovery hybrid mass spectrometer (Thermo Fisher, San Jose, CA). Each sample was loaded onto a reverse phase column and separated using 95 min LC gradient of 5-27% buffer B at a flow of 0.5-1 l/min. MS analysis was performed using a top 10 method where the MS1 scan was acquired in the Orbitrap, followed by 10 data depended MS/MS scans on the 10 most intense ions in the LTQ with CID for fragmentation. MS/MS spectra assignments were made with the Sequest algorithm (Eng et al., 1994, J Am Soc Mass Spectrom. 5, 976-89) using the entire mouse IPI database (version 3.6).

(378) Sequest searches were performed using a target-decoy strategy (Elias and Gygi, 2010, Methods Mol Biol. 604, 55-71) with the mouse IPI database in correct orientation (forward database) and the same database but with all sequences in reverse orientation (reverse database). Sequest searching was performed with a precursor ion tolerance of 50 ppm with LysC specificity. For dimethyl labels, a static modification of 28.0313 Da was used on the N-terminus and lysine residues. In addition, a differential modification of 8.044336 Da was used for heavy proteins, respectively, on the N-terminus and lysine residues. A protein level false discovery rate of 1% was used as a threshold for protein identifications using the target decoy strategy. Quantification of each protein was determined using the peak heights for light and heavy forms for that protein. The criterion for protein quantification was a signal-to-noise ratio of 5 for at least one of the protein species (light or heavy). Quantification of protein level was performed by calculating the median value of the ratios of light to heavy. Using this method of quantification, the contribution of single peptide protein species in the data set was low (5%), presumably reflecting the high accuracy and sensitivity of the MS methods and the high signal-to-noise cutoff used. Z scores were given to the proteins of the R1031C mice based on the standard deviation of the control mice. A median score of plus or minus two was used as a cut off to generate a list of candidate proteins (FIG. 7B). Proteins identified as candidates passed this cut off criteria in two independent MS experiments, each utilizing one aorta per genotype.

(379) Candidate Validation Using ELISA

(380) Endostatin and HTRA1 were measured using commercially available ELISA kits (MyBiosource, MBS266186 and MBS90656, respectively), according to the provider's protocol. The genotype of the samples tested was masked to the investigator conducting the assays and samples were randomized in the plates to prevent position effects. No samples were excluded from the analyses on the basis of being outliers.

(381) NOTCH3 Extracellular Domain ELISA

(382) The N3ECD sandwich enzyme-linked immunosorbent assay was designed using commercially available antibodies. A monoclonal capture antibody (R&D systems MAB 1559) was coated on a high affinity binding ELISA plate (Fisher Scientific 3590) at 625 ng/ml in 100 l of PBS, overnight, on a rotator, at 4 C. The plate was then blocked using 300 l of a 10% BSA solution in PBS at room temperature on a rotator for 2-3 h and washed three times with wash buffer diluted in distilled water from a 25 stock (R&D systems WA126). Recombinant human NOTCH3 extracellular domain region (N3ECD), which was originally used to raise the antibodies (R&D systems 1559-NT-050), was used as a positive control and standard. Recombinant N3ECD serially diluted from 2 ng/ml to 0.125 ng/ml, along with experimental serum or plasma samples diluted 1:10 in PBS, were applied to the plate and left to incubate on a shaker overnight at 4 C.

(383) Biotinylated polyclonal antibody raised against the N3ECD (R&D Systems BAF1559) was used for detection. This antibody was diluted in solution of PBS containing 2.5% BSA (Sigma) to a final concentration of 0.001 mg/ml. One hundred l was applied to each well and left at room temperature on a rotator for 2 h. The plate was washed three times and a Horse Radish Peroxidase-streptavidin (HRP-Strep) complex was added (R&D Systems DY998). The HRP-Strep complex was diluted using Reagent Calibrator Diluent 2 (R&D Systems DY008) at a 1 concentration. For each well 5 l of HRP-Strep was added to 95 l of the 1 calibrator diluent. One hundred l of the diluted HRP-Strep complex was applied to the plate and left on a rotator at room temperature for 40 min. The plate was then washed five times to ensure complete removal of the HRP-Strep. After this, 100 l of tetramethylbenzedine (TMB) (R&D Systems DY008) was added to the plate, initiating the detection phase of the reaction. Termination of this reaction took place after 20 min using 50 l of warm (37 C.) sulfuric acid. The plate was then read using a SPECTRAmax plus 384 from Molecular Devices using a 450 nm wavelength.

(384) To test the ability of the ELISA to detect circulating N3ECD in human samples, serially diluted plasma and serum samples, from patients with no CADASIL mutations, were used.

(385) Ligand-Dependent NOTCH Signaling Assay

(386) Ligand-dependent NOTCH signaling assay was performed as described previously (Arboleda-Velasquez et al., 2011). Briefly, mouse embryonic fibroblasts (MEFs) were isolated from N3KO; WT76+/+ or N3KO; C455R+/+ embryos for signal-receiving cells, and from ROSA26.sup.DLL1+/+ embryos for signal-sending cells. Induction of the different transgenes at the ROSA26 locus was achieved by in vitro infection with an adenovirus encoding the Cre recombinase (adeno-Cre, 12.5 d.p.c.). This inducible transgene system was chosen to avoid creating an early selection pressure in the generation of the MEFs used in these experiments. MEFs were first generated in non-induced cells and then induction was performed prior to coculture.

(387) Signal-sending and signal-receiving cells were plated together at a ratio of 2:1 respectively to ensure every signal-receiving cell was exposed to the DLL1 ligand, cultured together for 48 h, before signal-receiving cells were sorted by FACS based upon their eGFP expression (the transgene is bicistronic including the NOTCH3-IRES-eGFP) and directly lysed into RLT lysis buffer for RNA extraction with the RNeasy kit (Qiagen). Following retro-transcription of 600 ng total RNA (High Capacity Archive RNA-to-cDNA Kit, Applied Biosystems), col181/endostatin cDNA levels were assessed by TaqMan qPCR (Gene Expression Assay Mm00487131_m1) following manufacturer's guidelines (Applied Biosystems). Differential expression was calculated using the 2.sup.Ct method with mouse Tbp (Mm00446973_m1) used to normalize cDNA input. Relative expression was calculated by normalizing on control samples where signal-receiving cells were cocultured with ROSA26.sup.DLL1+/+ cells that were not induced with Cre and therefore did not over-express the DLL1 ligand.

(388) Quantification of Smooth Muscle Cell Loss in the Vasculature

(389) VSMC loss in the retinal vasculature was quantified in 10 animals: five control N3KO; WT76+/; SM22-Cre mice and five CADASIL N3KO; C455R+/; SM22-Cre mice. Animals were sacrificed and whole eyes were removed and immediately fixed overnight in 4% paraformaldehyde at 4 C. Following dissection and removal of the fixed retina from the eyecup, retina was washed three times in 2 ml of phosphate buffered saline (PBS) at room temperature for three minutes. Blocking buffer was then applied for a minimum of 5 h at room temperature. Blocking buffer consists of 1 mol/L CaCl.sub.2, 1 mol/L MgCl.sub.2, 1 mol/L MnCl.sub.2, 3.9 mmol/L sodium citrate, 1% Triton, and 0.3% goat serum, all diluted in PBS.

(390) The retinas were then incubated with 5 mg/ml of Alexa 488-conjugated isolectin B4 glycoprotein (IB4) [1 in 200] (Invitrogen 121411) and 10 mg/ml of Cy3-conjugated smooth muscle actin antibody (SMA) [1 in 100] (Sigma C6198), in a final volume of 300 l of blocking buffer overnight at 4 C. on a rotator before the retina was then washed with PBS and then mounted for imaging. Whole retina images were taken under 5 (1.25) using the Zeiss Axioskope 2 mot plus microscope, using the red and green channels. The SMA coverage was quantified using ImageJ macros as follows. The program utilizes the signal of the IB4 positive staining to outline the area of the vessels to obtain a measurement of the total vascular area. Then the red channel is assessed for positive signal and the area for the regions of positive signal are recorded. The macro then produces an analyzed image, outlining the vascularized area in blue and the SMA positive area in red, and a table of results of vascular area and SMA positive area to be utilized for calculating percent coverage from the ratio of SMA positive area to total vascularized area.

(391) NOTCH3 and Endostatin Retina Staining

(392) Staining was performed in retinas of 6-month old N3KO; C455R+/; SM22-Cre, and N3KO; WT76+/; SM22-Cre mice with antibodies against either NOTCH3 extracellular domain (1 in 200) (EMD Millipore MABC594) or endostatin (1 in 120) (R&D Systems BAF570) with Col IV, a vessel marker, [1:200] (Abcam ab6586) in a total volume of 300 l per retina. Retinas were prepared as described above and then placed in 300 l of blocking solution with one of the two pairs of antibodies and imaged as described above.

(393) Statistical Analysis

(394) An unpaired students t-test function assuming a two tailed distribution and equal variance as statistical comparison of the ELISA results and VSMC loss quantification. P values<0.05 were considered significant and are indicated with an asterisk (*).

Other Embodiments

(395) While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

(396) The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.

(397) While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.