DEPLETING EGFR AND HER2 OVERCOMES RESISTANCE TO EGFR INHIBITORS IN COLORECTAL CANCER
20250009852 ยท 2025-01-09
Inventors
- Yuesheng ZHANG (Henrico, VA, US)
- Lu Yang (Buffalo, NY)
- Arup Bhattacharya (Buffalo, NY)
- Yun Li (Orchard Park, NY)
Cpc classification
A61K31/513
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
C12Y304/13009
CHEMISTRY; METALLURGY
International classification
A61P35/00
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
A61K31/513
HUMAN NECESSITIES
Abstract
Provided are methods for treating cancer. The methods involve administering to an individual who has cancer a combination of peptidase D (PEPD), a sheddase inhibitor, a chemotherapeutic agent and a coagulation inhibitor.
Claims
1. A method for inhibiting growth of cancer in an individual comprising administering to the individual an effective amount of a combination comprising peptidase D (PEPD), a sheddase inhibitor, and optionally a chemotherapeutic agent and a coagulation inhibitor.
2. The method of claim 1, wherein the method also comprises administering the chemotherapeutic agent and the coagulation inhibitor.
3. The method of claim 2, wherein the PEPD comprises a mutation of G at position 278 of SEQ ID NO:1 wherein the mutation is a change of glycine at position 278 to an amino acid other than aspartic acid.
4. The method of claim 3, wherein the sheddase inhibitor comprises aderbasib.
5. The method of claim 4, wherein the chemotherapeutic agent comprises fluorouracil (5-FU).
6. The method of claim 1, wherein the coagulation inhibitor comprises enoxaparin.
7. The method of claim 6, wherein the individual has a cancer that is resistant to an anti-cancer agent.
8. The method of claim 6, wherein the individual has colorectal cancer.
9. The method of claim 8, wherein the colorectal cancer is resistant to a therapeutic antibody that specifically binds to Epidermal growth factor receptor (EGFR).
10. The method of claim 9, comprising administering to the individual a combination comprising the PEPD, the chemotherapeutic agent, the sheddase inhibitor and the coagulation inhibitor.
11. The method of claim 10, wherein the PEPD comprises a mutation of G at position 278 of SEQ ID NO:1 wherein the mutation is a change of glycine at position 278 to an amino acid other than aspartic acid, and wherein the sheddase inhibitor is aderbasib.
12. The method of claim 11, wherein the coagulation inhibitor is enoxaparin.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0006] For a fuller understanding of the nature and objects of the disclosure, reference should be made to the following detailed description taken in conjunction with the accompanying figures.
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0023] Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains.
[0024] Unless specified to the contrary, it is intended that every maximum numerical limitation given throughout this description includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein. All proteins described herein include proteins that have from 90.0-99.9% identity across their entire lengths to such proteins. The amino acid or polynucleotide sequence as the case may be associated with each GenBank or other database accession number of this disclosure is incorporated herein by reference as presented in the database on the effective filing date of this application or patent.
[0025] The steps of the method described in the various embodiments and examples disclosed herein are sufficient to carry out the methods of the present invention. Thus, in an embodiment, the method consists essentially of a combination of the steps of the methods disclosed herein. In another embodiment, the method consists of such steps.
[0026] The present disclosure relates to use of combination therapies that include PEPD. The amino acid sequence of human prolidase (PEPD) in SEQ ID NO:1 is known in the art. SEQ ID NO:1 and the cDNA sequence encoding it is accessible via GenBank accession no. J04605.1; the amino acid sequence is also provided under GenBank accession number AAA60064. In one illustrative but not limiting embodiment, enzymatically active human PEPD has the sequence of SEQ ID NO:1:
TABLE-US-00001 (SEQIDNO:1) MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSI VVLQGGEETQRYCTDTGVLFLQESFFHWAFGVTEPGCYGVIDVDT GKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASV LTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEI VESRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYGLES LFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQN GDMCLFDMGGEYYSVASDITCSFPRNGKFTADQKAVYEAVLLSSR AVMGAMKPGDWWPDIDRLADRIHLEELAHMGILSGSVDAMVQAHL GAVEMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQ PGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGV RIEEDVVVIDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK
[0027] In SEQ ID NO:1, the G at position 278 is bolded and italicized and represents the location of a G278D mutation which renders the PEPD enzymatically inactive. Thus, in embodiments, the PEPD used comprises a change of glycine at position 278 to an amino acid other than aspartic acid. The disclosure includes PEPD which has also been modified by conservative amino acid substitutions that are based generally on relative similarity of R-group substituents. Non-limiting examples of such substitutions include gly or ser for ala; lys for arg; gln or his for asn; glu for asp; ser for cys; asn for gln; asp for glu; ala for gly; asn or gln for his; leu or val for ile; ile or val for leu; arg for lys; leu or tyr for met; thr for ser; tyr for trp; phe for tyr; and ile or leu for val. Thus, a PEPD that comprises any single conservative amino acid substitution, or any combination of conservative amino acid substitution, provided the PEPD retains its described function. PEPD used in embodiments of this disclosure can include modifications that enhance its desirable characteristics, such as the capability to bind to or enter a tumor cell or tumor microenvironment, or to enhance circulation time, bioavailability, stability, or uses related to EGFR-positive cell-targeted killing. In embodiments, the PEPD amino acid sequence is within the context of a larger polypeptide. Thus, fusion proteins comprising PEPD are included in the disclosure. In an embodiment, a PEPD protein can be conjugated to an immunoglobulin (Ig) or a fragment thereof to provide a chimeric PEPD/Ig molecule. In an another embodiment, PEPD can be conjugated to a chemotherapeutic agent.
[0028] Each of the described agents that are used in the described combination therapies can be administered to an individual in need thereof using any suitable route. In embodiments the administration is parenteral, intraperitoneal, intrapulmonary, oral, and intra-tumoral. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, and subcutaneous administration. In embodiments, the PEPD, the sheddase inhibitor, and the chemotherapeutic agent are administered concurrently or sequentially. In an embodiment, the chemotherapeutic agent interferes with nucleotide synthesis or nucleotide incorporation into DNA, or both. In a non-limiting embodiment the chemotherapeutic agent comprises fluorouracil (5-FU). In embodiments, the sheddase inhibitor inhibits the activity of a membrane-bound enzymes that cleaves an extracellular portion of a transmembrane protein and thereby inhibits release of the soluble ectodomain of the protein from the cell surface. In embodiments, the sheddase inhibitor inhibits one or both of ADAM10 and ADAM17. In embodiments, the sheddase inhibitor is Aderbasib, also known as known as INCB007839. In embodiments, Aderbasib is administered to an individual orally. In embodiments, a coagulation inhibitor is also used.
[0029] In one embodiment, the coagulation inhibitor is an agent that inhibits PEPDs degradation in vivo, so as to reduce PEPD dose required by patients. In one embodiment, the coagulation inhibitor inhibits conversion of prothrombin to thrombin, or inhibits the participation of thrombin in clot formation. In an embodiment, the coagulation inhibitor interferes with the clotting related function of the clot-promoting proteins known as factor X and factor II. In embodiments, the coagulation inhibitor binds to and activates antithrombin III, and as a consequence, coagulation factors Xa and IIa are inhibited. In an embodiment, the coagulation inhibitor is heparin, such as an unfractionated heparin preparation, or a low molecular weight form of heparin. In an embodiment, the inhibitor is a direct Xa inhibitor, either oral or non-oral, including but not limited to the drugs sold under the trade names RIVAROXABAN, APIXABAN or EDOXABAN. In an embodiment, the coagulation inhibitor may be an inhibitor of other blood coagulation factors, including but not limited to Factors XII, XI and VII. In embodiments, the low molecular weight heparin or other coagulation inhibitor is administered using any suitable vehicle and route of administration. In an embodiment, the low molecular weight heparin is enoxaparin or a pharmaceutically acceptable salt thereof, such as enoxaparin sodium. In embodiments, the coagulation inhibitor is administered by subcutaneous injection. In one embodiment, the coagulation inhibitor is administered orally. In embodiments, the coagulation inhibitor can be given prior to, concurrent with, or subsequent to the PEPD composition, and may be administered with the same number and timing of the PEPD administration(s), or may be administered according to a schedule that is different than the PEPD administration.
[0030] The amount of PEPD, aderbasib, the coagulation inhibitor, and a chemotherapeutic agent to be used in the method can be determined by those skilled in the art, given the benefit of the present disclosure. Thus, in one embodiment, an effective amount of a composition of the invention is administered. An effective amount can be an amount of the composition that inhibits growth of cancer cells in the individual, alleviates disease symptoms associated with the cancer, suppresses a malignant phenotype of cancer cells, inhibits growth of cells overexpressing an EFGR receptor, inhibits metastasis of a primary tumor, and combinations thereof. In embodiments, the individual to whom a composition of the invention is administered has, is suspected of having, or is at risk for development and/or recurrence of an a cancer. In embodiments, the cancer is ErbB1- or ErbB2-positive cancer. In embodiments, the cancer is colorectal cancer, breast cancer, bladder cancer, esophageal cancer, ovarian cancer, stomach cancer, anal cancer, pancreatic cancer, or uterine cancer. In embodiments, the individual has a cancer that is resistant to another anti-cancer agent. In embodiments, the individual has a cancer that is resistant to a therapeutic antibody.
[0031] In embodiments, the individual has a cancer that is resistant to another anti-cancer agent. In embodiments, the individual has a cancer that is resistant to a therapeutic antibody. In embodiments, the individual has a cancer that is resistant to a therapeutic antibody or a combination of therapeutic antibodies that specifically bind to EGFR, non-limiting embodiments of which are cetuximab and panitumumab. In embodiments, the individual has a cancer that is resistant to one or more checkpoint inhibitors. In embodiments, the cancer has a mutation that is not present in non-cancer cells. In embodiments, the cancer comprises a mutation of any one or combination of KRAS, PIK3CA, or BRAF. In embodiments, the mutation is an activating mutation. In a non-limiting embodiment, the KRAS mutation comprises KRAS.sup.G12C or KRAS.sup.G12D. In embodiments, the cancer has a mutation in any of Bruton's tyrosine kinase (BTK), EGFR, HER2/NEU, HER3, HER4, MEK, or fibroblast growth factor receptor (FGFR).
[0032] In embodiments, administering an effective amount of a combination of described agents to an individual results in one or a combination of loss expression or loss of phosphorylation of EGFR, HER2, or a combination thereof. In embodiments, administering a combination of described agents to an individual results in one or a combination of loss of expression and phosphorylation of EGFR and HER2, loss of phosphorylation but not expression of HER3, IGF1R, MET, SRC, AKT, MEK and ERK, loss of expression of HRAS and NRAS, and activation of caspase 3.
[0033] In embodiments, administration of a combination of agents as described herein has an improved anti-cancer effect relative to use of the PEPD, the sheddase inhibitor, or the chemotherapeutic agent, as a mono-therapy (with or without the coagulation inhibitor). In embodiments, use of a combination comprising the PEPD, the sheddase inhibitor and the chemotherapeutic agent has an improved anti-cancer effect relative to use of the PEPD and the sheddase inhibitor as dual therapy (with or without the coagulation inhibitor).
[0034] The following examples are presented to illustrate the present disclosure. They are not intended to be limiting in any matter.
Example 1
[0035] This example provides a description of the materials and methods to generate the results described in the examples that follow Example 1.
Antibodies
[0036] The following antibodies were purchased from Cell Signaling: anti-EGFR (Cat #2232), anti-pY1173-EGFR (Cat #4407), anti-HER2 (Cat #2165), anti-pY1221/1222-HER2 (Cat #2243), anti-HER3 (Cat #12708), anti-pY1328-HER3 (Cat #14525), anti-insulin-like growth factor 1 receptor (IGFIR, Cat #9750), anti-pY1131-IGFIR (Cat #3021), anti-MET (Cat #8198), anti-pY1234/1235-MET (Cat #3077), anti-MEK (Cat #4694), anti-pS217/221-MEK (Cat #9154), anti-lysosomal-associated membrane protein 1 (LAMP1, Cat #15665), anti-AKT (Cat #4691), anti-pS473-AKT (Cat #4060), anti-ERK (Cat #9102), anti-pT202/Y204-ERK (Cat #9101), anti-SRC (Cat #2123), anti-pY416-SRC (Cat #6943), anti-cleaved caspase 3 (Cat #9661). Anti-His tag (Cat #MA1-21315), goat-anti-mouse secondary antibody conjugated to Alexa-Fluor 488 (Cat #A-11029), and goat anti-rabbit secondary antibody conjugated to Alexa-Fluor 647 (Cat #A32733) were purchased from Thermo Fisher Scientific. Anti-PEPD (Cat #sc-390042) and anti-NRAS (Cat #sc-31) were purchased from Santa Cruz Biotechnology. Anti-heparin-binding EGF-like growth factor (HB-EGF, Cat #AF-259) and anti-amphiregulin (AREG, Cat #AF-262) were purchased from R&D Systems. Anti-mouse IgG conjugated to horseradish peroxidase (IgG-HRP; Cat #NA931V) and anti-rabbit IgG-HRP (Cat #NA934V) were purchased from GE Healthcare. Anti-PEPD (Cat #ab86507) and anti-KRAS (Cat #WH0003845M1) were purchased from Abcam and Sigma-Aldrich, respectively. Anti-HRAS (Cat #18295-1-AP) and anti-GAPDH (Cat #MAB374) were purchased from Proteintech and Millipore, respectively.
Chemicals, Biochemicals, and Enzymes
[0037] Recombinant PEPD.sup.G278D was generated in our own lab as previously reported [26]. Briefly, PEPD.sup.G278D was synthesized in E coli using pBAD/TOPO-PEPD.sup.G278D-His, purified by nickel chromatography, and concentrated in phosphate-buffered saline (PBS) using Ultracel YM-30 Centricon which was purchased from Millipore (MRCFOR030). Recombinant human HB-EGF (Cat #: 259-HE) was obtained from R&D Systems. Aderbasib was purchased from Medical Isotopes (Cat #17322). The following chemicals were purchased from Sigma-Aldrich: enoxaparin (EP, Cat #1235820), 5-FU (Cat #F6627), BSA (Cat #9048-46-8), paraformaldehyde (Cat #F1635), dimethyl sulfoxide (DMSO; Cat #M81802), chloroquine (Cat #C6628), phenylmethanesulfonyl fluoride (PMSF; 329-98-6), phosphatase inhibitor cocktail 2 (Cat #P5726), phosphatase inhibitor cocktail 3 (Cat #P0044), and methylthiazolyldiphenyl-tetrazolium bromide (MTT, Cat #M2128). Lipofectamine RNAiMAX (Cat #13778075), lipofectamine 3000 (Cat #L3000-008), and ProLong Gold antifade reagent with DAPI (Cat #P36941) were purchased from Thermo Fisher Scientific. A protease inhibitor cocktail (Cat #11-836-153-001) was purchased from Roche Applied Science. D-luciferin was purchased from Gold Biotechnology (Cat #LUCK-1G). G-sepharose beads (Cat #17-6002-35), and Matrigel (Cat #356237) were purchased from GE Healthcare and Corning, respectively. Sodium dodecyl sulfate (SDS) was purchased from Bio-Rad (Cat #161-0301). Cell lysis buffer (10) was purchased from Cell Signaling (Cat #9803).
Assay Kits
[0038] Human Amphiregulin/AREG ELISA Kit PicoKine (Cat #EK0304) and human HB-EGF ELISA Kit (Cat #EK0770) were purchased from Boster Biological. PI3-Kinase Activity ELISA: Pico Kit was purchased from Echelon Biosciences (Cat #K-1000S). Ras Activation ELISA Kit was purchased from Cell Biolabs (Cat #STA-440). BCA Protein Assay Kit (reagent A: Cat #23228; reagent B: Cat #1859078) was purchased from Pierce. RNeasy Mini Kit (Cat #74104), and MinElute PCR Purification Kit (Cat #28004) were purchased from Qiagen. Luminata Classico (Cat #WBLUC0500), and Luminata Cresendo (Cat #WBLUR0100) were purchased from Millipore.
Plasmids
[0039] pGL4.51[luc2/CMV/Neo] was purchased from Promega (Cat #E132A). pCMV6-A-EGFR-puro, reported previously [20], was used as a template to generate single point mutations of EGFR, including R451C, K467T, and S492R, using the QuikChange Lightning Site-Directed Mutagenesis Kit (Agilent Technologies). The primers were purchased from IDT, including primers for generating EGFR.sup.R451C (forward: 5-tgaacataacatccttgggattatgctccctcaagg-3 (SEQ ID NO:2); reverse: 5-ccttgagggagcataatcccaaggatgttatgttca-3 (SEQ ID NO:3), EGFR.sup.K467T(forward: 5-ggagatgtgataatttcaggaaacacaaatttgtgctatgcaaatacaata-3 (SEQ ID NO:4); reverse: 5-tattgtatttgcatagcacaaatttgtgtttcctgaaattatcacatctcc-3 (SEQ ID NO:5), and EGFR.sup.S492R (forward: 5-ggtcagaaaaccaaaattataaggaacagaggtgaaaacagc-3 (SEQ ID NO:6); reverse: 5-gctgttttcacctctgttccttataattttggttttctgacc-3 (SEQ ID NO:7)). All constructs were confirmed by DNA sequence analysis.
Genotyping of Cell Lines and PDX
[0040] It was previously shown that HCT116 cells carry KRAS (G13D) and PIK3CA (H1047R) mutations and that HT29 cells carry BRAF (V600E) and PIK3CA (P449T) mutations [27]. Colon PDX14650 was found previously to carry KRAS (G12D) mutation. We carried out experiments to confirm the genetic changes, using SW48 cells and SW620 as negative controls. Total RNA was isolated from each cell line and the PDX using a RNeasy Mini Kit, following manufacturer's instruction. RNA (500 ng per sample) was reverse transcribed into complementary DNA using previously described method [21]. The corresponding gene amplicons encompassing KRAS G12 and G13, PIK3CA P449 and H1047, and BRAF V600 were amplified by PCR. The PCR conditions used for all reactions are as follows: 95 C. for 2 min, 35 cycles at 95 C. for 30 sec (denaturation), 64 C. (KRAS G12 and G13, PIK3CA P449) or 54 C. (PIK3CA H1047 and BRAF V600) for 30 sec (annealing), and 72 C. for 30 sec (extension), with the final extension performed at 72 C. for 5 min. The primers were purchased from IDT, including primers for KRAS G12 and G13 (forward: 5-ccatttcggactgggagcgag-3 (SEQ ID NO:8); reverse: 5-gcactgtactcctcttgacctgc-3 (SEQ ID NO:9)), primers for BRAF V600 (forward: 5-gcacctacacctcagcagtt-3 (SEQ ID NO:10); reverse: 5-gacttctggtgccatccaca-3 (SEQ ID NO:11), primers for PIK3CA p449 (forward: 5-cccaggtggaatgaatggct-3 (SEQ ID NO:12); reverse: 5-accacactgctgaaccagtc-3 (SEQ ID NO:13)), and primers for PIK3CA H1047 (forward: 5-acagcatgccaatctcttca-3 (SEQ ID NO:14); reverse: 5-ttgctgtaaattctaatgctgttc-3 (SEQ ID NO:15)). All PCR reaction products were purified using the MinElute PCR purification Kit, following manufacturer's instruction and were subjected to DNA sequencing. Each of the forward primers except for PIK3CA H1047 was used for the sequencing analyses across the specific amino acid sites on each target gene. The following primer was used for sequencing across PIK3CA H1047: 5-aatgatgcttggctctgga-3.
Cell Culture
[0041] HCT116 cells (Cat #CCL-247), HT29 cells (Cat #HTB-38), SW48 cells (Cat #CCL-231), and SW620 cells (Cat #CCL-227) were from American Type Culture Collection. HCT116 cells stably expressing firefly luciferase were generated by transfecting HCT116 cells with pGL4.51[luc2/CMV/Neo] and selection under neomycin. HCT116 cells and luciferase-tagged HCT16 cells were cultured in high-glucose Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% fetal bovine serum (FBS). HT29 cells were cultured in McCoy's 5A Medium supplemented with 10% FBS. SW48 cells were cultured in RPMI-1640 medium supplemented with 1% HEPES, 1% Sodium Pyruvate and 10% FBS. SW620 cells were cultured in L-15 medium supplemented with 10% FBS. All cell lines were mycoplasma-free and were authenticated using short tandem repeat. SW620 cells were cultured in humidified incubators at 37 C. with 100% air. All other cells were cultured in humidified incubators at 37 C. with 5% CO.sub.2.
High glucose DMEM (Cat #10-013-CV), McCoy's 5A medium (Cat #10-050-CV), and RPMI-1640 medium (Cat #10-040-CV) were purchased from Corning Cellgro. L-15 medium was purchased from Thermo Fisher (Cat #11415064). FBS was purchased from Gibco (Cat #10437).
Gene and siRNA Transfection, and Other Treatments
[0042] Transfection of pCMV6-A-puro-EGFR, pCMV6-A-puro-EGFR.sup.R451C, pCMV6-A-puro-EGFR.sup.K467T or pCMV6-A-puro-EGFR.sup.RS492R was performed using Lipofectamine 3000. SW620 cells were grown in 6-well plates (310.sup.5 cells/well with 2 ml medium) for 24 h and then transfected with a plasmid at 1 g DNA per well for 48 h. For siRNA transfection, cells were grown in 96-well plates (210.sup.3 HCT116 cells/well or 610.sup.3 HT29 cells/well with 100 l medium) or 24-well plates (210.sup.4 HCT116 cells/well or 610.sup.4 HT29 cells/well with 500 l medium) for 24 h and then transfected with nonspecific scramble siRNA, EGFR siRNA or HER2 siRNA (25 nM) using Lipofectamine RNAiMAX for 48 h. All siRNAs were purchased from Origene. The siRNA sequences Origene catalogue numbers are as follows: scramble siRNA, Cat #SR30004; EGFR siRNA, Cat #SR301357A; and HER2 siRNA, Cat #SR301443A.
MTT Cell Proliferation Assay
[0043] Cells were grown in 96-well plates. Each well was seeded with 210.sup.3 HCT116 cells, 610.sup.3 HT29 cells, 510.sup.3 SW48 cells, or 410.sup.3 SW620 cells with 150 l culture medium overnight, treated with solvent, PEPD.sup.G278D (5, 25 or 250 nM), cetuximab (2.75, 27.5 or 275 nM), panitumumab (2.77, 27.7 or 277 nM), or PEPD.sup.G278D plus cetuximab (250 nM each) in 200 l medium per well for 24, 48 or 72 h, and then incubated with medium containing 9.2 mM MTT (200 l/well) at 37 C. for 3 h. The cells were then washed with PBS and mixed with dimethyl sulfoxide (150 l per well), and cell density was determined by measuring the reduction of MTT to formazan spectroscopically at 570 nm using a Synergy 2 Multi-Mode Microplate Reader (BioTek). In experiments involving siRNA transfection, 210.sup.3 HCT116 cells or 610.sup.3 HT29 cells were seeded to each well of 96-well plates overnight and then transfected 25 nM siRNA (scramble siRNA, EGFR siRNA or HER2 siRNA) as described above, followed by MTT assay.
Immunofluorescence Staining and Confocal Microscopy
[0044] SW48 cells were grown in chamber slides (410.sup.4 cells/well) overnight with or without subsequent treatment with PEPD.sup.G278D (25 nM) and/or chloroquine (25 M) for up to 6 h. The cells were then washed with ice-cold PBS, fixed with 4% paraformaldehyde for 20 min at room temperature (RT), washed again with ice-cold PBS and blocked with 1% BSA in PBS for 1 h at RT. The cells were then incubated with an EGFR antibody, a His tag antibody for detection of PEPD.sup.G278D, and/or a LAMP1 antibody overnight at 4 C., washed with PBS, incubated with a secondary antibody conjugated to Alexa-Fluor 488 or Alexa-Fluor 647 antibody for 1 h at RT and washed again with PBS. The cells were then examined with a BZ-X700 fluorescence microscope (Keyence) with a S PL FL ELWD ADM 40xC objective. Merged images from Z-stack were organized using the ImageJ software (NIH Image).
PI3K Activity Assay
[0045] PI3K activity was measured using a PI3-Kinase Activity ELISA Kit from Echelon Biosciences, following manufacturer's instruction. Briefly, PI3K was pulled down from whole cell lysates using an antibody for PI3K/p85. Each sample was prepared from approximately 110.sup.6 cells. The entire immunoprecipitate from each sample was mixed with 30 l of KBZ reaction buffer, which was then mixed with 30 l of 10 M PI(4,5)P2 substrate and incubated for 2 h at 37 C. The kinase reaction was terminated by adding 90 l of kinase stop solution to each reaction solution, and 60 l of each mixture was transferred together with 60 l of PIP3 detector to a well in the incubation plate. After incubation at RT for 1 h, 100 l per sample from the incubation plate was transferred to the detection plate and incubated for 1 h at RT. The detection plate was washed with TBST, incubated with the HRP-conjugated secondary detector for 30 min, washed again with TBST, and the immobilized HRP was measured by a standard colorimetric assay, using 3,3,5,5-tetramethylbenzedine as a substrate and a Synergy 2 Multi-Mode Microplate Reader to record absorbance.
RAS Activity Assay
[0046] Ras activity in cell lysates was measured using a Ras Activation ELISA Kit from Cell Biolabs. Briefly, approximately 510.sup.6 cells were mixed with 0.5 ml lysis buffer. Cell lysates were cleared by centrifugation at 14,000 g for 10 min at 4 C., and 250 l per sample was mixed with 10 l of 0.5 M EDTA with or without 5 l of either 100 GTPS or 100 GDP, which was incubated at 37 C. for 30 min with agitation and then mixed with 33 l of 1 M MgCl.sub.2. The mixture after appropriate dilution was transferred at 100 l per sample to a well in a 96-well plate immobilized with RAF-1 RAS-binding domain and incubated for 1 h at RT. After washing the wells 5 times with wash buffer, 100 l of an anti-pan-RAS antibody was added to each well and incubated for 1 h at RT. After another round of wash, 100 l of a secondary antibody-HRP conjugate was added to each well and incubated for 1 h at RT. After yet another round of wash, 100 l of substrate solution was added to each well and incubated at RT for 20 min, followed by addition of 100 l of stop solution to each well. Absorbance at 450 nm in each well was recorded by a Synergy 2 Multi-Mode Microplate Reader.
Measurement of Plasma PEPD.SUP.G278D .Concentration
[0047] Plasma PEPD.sup.G278D concentration was measured by ELISA as previously reported [26]. Briefly, 96-well ELISA plates were coated with 100 l/well of a PEPD antibody (mouse monoclonal, against amino acids 101-305, sc-390042) overnight at 4 C. The plates were then washed three times with PBST and incubated with 200 l/well of a blocking buffer for at least 2 h at RT. The plates were washed again with PBST and incubated with 100 l/well of a PEPD standard or a sample, which were appropriately diluted, for 2 h at RT. After another round of wash with PBST, each well was incubated with 100 l of a detection antibody (an anti-PEPD rabbit polyclonal, ab-86507) for 2 h at RT. After another round of wash with PBST, 100 l of a secondary antibody-HRP conjugate was added to each well, followed by 1 h incubation at RT. The plates were washed again with PBST three times, and each well was then incubated with 100 l of a HRP substrate solution. After adequate color development, 100 l of stop solution was added to each well, and absorbance at 450 nm was recorded by a Synergy 2 Multi-Mode Microplate Reader. Purified recombinant PEPD.sup.G278D was used as a standard.
Measurement of AREG and HB-EGF
[0048] Concentrations of AREG and HB-EGF in tumor tissues were measured using the Human Amphiregulin/AREG ELISA Kit PicoKine and HB-EGF ELISA Kit, following the manufacturer's instruction. Briefly, 100 l of standard or tumor tissue homogenate (cleared by centrifugation) was added to a microtiter well pre-coated with anti-human AREG or anti-human HB-EGF and incubated for 2 h at RT. After washing the plate with washing buffer, 100 l of biotinylated anti-human AREG or biotinylated anti-human HB-EGF were added to each well and incubated for 1.5 h at RT. The microtiter wells were washed 3 times with wash buffer and incubated with 100 l/well of avidin-biotin-peroxidase complex for 40 min at RT. The microtiter wells were washed 5 times with wash buffer and incubated with 90 l/well color developing reagent for 30 min at RT. After adding 100 l of stop solution to each well, absorbance at 450 nm was recorded by a Synergy 2 Multi-Mode Microplate Reader.
Preparation of Cell Lysates and Tumor Tissue Homogenates
[0049] To prepare whole cell lysates, cells were washed with PBS twice, mixed with 1 cell lysis buffer from Cell Signaling Technology supplemented with 2 mM PMSF and a protease inhibitor cocktail from Roche Applied Science, placed on ice for 10 min, sonicated at 0-4 C. to enhance cell lysis using a Branson Model 450 sonifier, and finally centrifuged at 13,000 g for 10 min at 4 C., and the supernatant fraction is collected as whole cell lysate. Tumor and samples were mixed with RIPA buffer (25 mM Tris-HCl, PH7.6, 150 mM NaCl, 1% Nonidet P-40, 1% sodium deoxycholate, and 0.1% SDS), which was supplemented with 2 mM PMSF, the protease inhibitor cocktail mentioned above, phosphatase inhibitor cocktail 2 and phosphatase inhibitor cocktail 3 from Sigma-Aldrich at 14.3 l buffer per mg tissue, and homogenized in a Dounce homogenizer. The homogenates were cleared by centrifugation at 13,000 g for 15 min at 4 C.
Western Blotting and Immunoprecipitation (IP)
[0050] Protein concentrations in all samples were measured using the BCA Assay Kit. For Western blotting, each sample was mixed with 4 loading dye, heated for 5 min at 95 C., and resolved by SDS-PAGE (8-12.5%). Proteins were transferred to polyvinylidene fluoride membrane, probed with specific antibodies, and detected using either Luminata Classico (Millipore) or Luminata Cresendo (Millipore). For IP, cell lysates (0.5 mg protein/sample) were incubated with a desired antibody overnight at 4 C., followed by incubation of 500 l sample with 30 l G-Sepharose beads (2 mg/ml) for 1 h at RT. The beads were washed three times with IP buffer, suspended in 2 SDS loading buffer, boiled for 5 min, and analyzed by Western blotting.
Mouse Study
[0051] SCID mice (C.B.17 SCID) were bred by the Laboratory Animal Shared Resource at Roswell Park Comprehensive Cancer Center. Male mice at 7-8 weeks of age were used. All mouse experiments were approved by the Institutional Animal Care and Use Committee at Roswell Park Comprehensive Cancer Center under protocol 1022M. We established subcutaneous tumors by inoculating 110.sup.6 HCT116 cells, 410.sup.6 HT29 cells, or 210.sup.6 SW48 cells to the flank of each mouse in 100 l of serum free medium. Colon patient-derived xenograft (PDX) 14650 was established from a liver metastatic lesion in a patient treated at Roswell Park Comprehensive Cancer Center. Tumor fragments (20 mm.sup.3) from donor mice were implanted into the flank of each mouse subcutaneously using a trocar. Orthotopic colon tumors in mice were established by inoculating HCT116 cells stably transfected with firefly luciferase (210.sup.6 cells in 50 l of 50% serum-free medium and 50% Matrigel) to the caecum wall of each mouse. Mice in each tumor model were randomized cage-wise into treatment groups using Research Randomizer (www.randomizer.org). Subcutaneous tumor volume was measured using length width.sup.22. Tumor volume was measured three times each week. Orthotopic tumor growth was monitored by bioluminescence weekly. Mice were given D-luciferin (150 mg/kg) by ip and anesthetized with isoflurane, and tumor burden was measured by bioluminescence using the IVIS Spectrum In Vivo Imaging System (PerkinElmer). Drug treatment was started when significant tumor growth was detected. EP (0.5 mg/kg) was administered to mice ip once daily. PEPD.sup.G278D (4 mg/kg) was administered to mice ip thrice weekly (Monday, Wednesday, Friday). Aderbasib (60 mg/kg) was administered to mice by gavage once daily. 5-FU (35 mg/kg) was administered to mice ip twice weekly (Monday and Thursday). EP, PEPD.sup.G278D and 5-FU were administered to mice in PBS. Aderbasib was first dissolved in DMSO and then diluted by PBS (final 5% DMSO by volume). Each agent was administered to mice at 0.1 ml volume per 20 g body weight. When a mouse was given multiple agents on the same day, the agents were dosed at approximately 30 min intervals. The mice were closely monitored for sign of adverse effects and weighed three times each week. Mice were sacrificed 24-48 hours after the last treatment, at which point the tumors were promptly removed, snap frozen and stored at 80 C. for later analysis. Some tumors were fixed in 10% buffered formalin, paraffin embedded, cut at 4 m, and stained with hematoxylin and eosin (H & E) for histological analysis.
Statistical Analysis
[0052] Data were analyzed by two-sided t-test or Mann-Whitney U test for two-group comparison, or one-way analysis of variance (ANOVA) for multi-group comparisons (followed by Tukey multiple comparisons test), using GraphPad Prism 9 software. P value of 0.05 or lower was considered statistically significant. Sample size, mean, SD or SEM, and P value are provided in each figure legend. Each replicate represents an independent sample, not repeated measurement of the same sample.
Example 2
[0053] This Example demonstrates that PEPD.sup.G278D inhibits CRC cells resistant to EGFR MABs.
[0054] We compared the response of four human CRC cell lines to cetuximab, panitumumab, and PEPD.sup.G278D, including HCT116, HT29, SW48, and SW620 cells. Both EGFR and HER2 were expressed in HCT116, HT29, and SW48 cells, but their expression levels varied greatly among the cell lines, whereas neither EGFR nor HER2 could be detected in SW620 cells (
[0055] Both cetuximab and panitumumab inhibited the growth of SW48 cells in a time- and concentration-dependent manner, but neither agent is active in HCT116 cells and HT29 cells (
Example 3
[0056] PEPD.sup.G278D abolishes RAS-ERK and PI3K-AKT signaling despite activating mutations in KRAS, BRAF, and PIK3CA
[0057] Although HCT116 cells carry activating mutations of KRAS and PIK3CA, and HT29 cells carry activating mutations of BRAF and PIK3CA, and both cell lines are resistant to cetuximab and panitumumab, as described above, the inhibitory activities of PEPD.sup.G278D in HCT116 cells and HT29 cells were similar to that in SW48 cells whose KRAS, BRAF and PIK3CA are not mutated. ERK and AKT are downstream of KRAS and PIK3CA, respectively. PEPD.sup.G278D caused marked loss of phosphorylation of ERK and AKT in both HCT116 and HT29 cells (
[0058] It was previously shown that oncogenic RAS mutants regulate basal effector pathway signaling, while WT RAS in the same cells mediates signaling downstream of activated RTKs [30]. It was also shown that the gain of function of PIK3CA mutants is enabled by activated RAS or PI3K/p85-mediated binding to activated RTKs [31, 32]. Notably, only one allele of each of the KRAS and PIK3CA genes in HCT116 cells is mutated, and only one allele of each of the BRAF and PIK3CA genes in HT29 cells is mutated (
Example 4
PEPD.sup.G278D Also Targets EGFR Mutants that Occur in CRC Patients
[0059] While EGFR is not mutated in SW48, HCT116 and HT29 cells [27], several acquired mutations in the extracellular domain of EGFR have been reported in CRC patients following cetuximab treatment, including R451C, K467T, and S492R, each of which prevents cetuximab binding and confers resistance to cetuximab [33, 34]. EGFR.sup.R451C and EGFR.sup.K467T also bind poorly to panitumumab [33]. However, these mutations locate far from the site (amino acids #166-310) to which PEPD.sup.G278D binds [20]. Because SW620 cells do not express EGFR, we transfected each EGFR mutant as well as WT EGFR into these cells and then treated the cells with solvent or PEPD.sup.G278D (25 nM for 48 h). Each EGFR mutant was strongly downregulated by PEPD.sup.G278D, showing loss of both expression and phosphorylation, and the extent of downregulation of each mutant by PEPD.sup.G278D is very similar to that of WT EGFR (
Example 5
EGFR Ligands Slow PEPD.SUP.G278D .Induction of EGFR Internalization and Lysosomal Degradation
[0060] PEPD.sup.G278D causes depletion of both EGFR and HER2, but HER2 depletion was much faster than that of EGFR in cells cultured in medium with 10% serum. In HCT116, HT29, and SW48 cells, HER2 level decreased markedly after 3 h of PEPD.sup.G278D treatment, whereas EGFR level showed no decrease even after 6 h of PEPD.sup.G278D treatment, although it showed profound decrease at 24 h (
[0061] We previously showed that PEPD.sup.G278D induces HER2 internalization and lysosomal degradation [21]. Here, we show that PEPD.sup.G278D also induces EGFR internalization and lysosomal degradation. We focused on SW48 cells, taking advantage of their high EGFR level. SW48 cells were cultured in serum-free medium. PEPD.sup.G278D binding to EGFR and subsequent EGFR trafficking were analyzed by immunofluorescence staining and confocal microscopy. PEPD.sup.G278D bound abundantly to cell membrane and colocalized with EGFR after 15 min of treatment, but at 6 h, neither PEPD.sup.G278D nor EGFR remained on cell membrane, with residual amount of PEPD.sup.G278D but no EGFR detected intracellularly (
Example 6
PEPD.sup.G278D Fails to Inhibit Tumors that Overexpress a High-Affinity EGFR Ligand
[0062] We next compared the antitumor activities of PEPD.sup.G278D and cetuximab in vivo. PEPD.sup.G278D is degraded in vivo by coagulation proteases, but EP, a clinically used anticoagulant, inhibits PEPD.sup.G278D degradation [38]. EP itself has no antitumor activity but combining EP with PEPD.sup.G278D allows therapeutically relevant plasma concentrations of PEPD.sup.G278D to be achieved for inhibition of tumors overexpressing EGFR and/or HER2 [20, 22]. We inoculated human CRC cells to immunocompromised mice subcutaneously, and the tumor-bearing mice were randomized for treatment with EP, EP plus PEPD.sup.G278D, or cetuximab. Based on previous studies, EP was administered to the mice at 0.5 mg/kg daily by intraperitoneal injection (ip); PEPD.sup.G278D was administered at 4 mg/kg ip three times weekly; and cetuximab was administered at 15 mg/kg ip twice weekly. Both PEPD.sup.G278D and cetuximab strongly inhibited the growth of SW48 tumors and at the end of treatment inhibiting tumor growth by 91.5% and 85.8%, reactively, but neither agent inhibited the growth of HCT116 tumors and HT29 tumors (
[0063] Lack of inhibitory activity of PEPD.sup.G278D in HCT116 tumors and HT29 tumors was not due to lack of PEPD.sup.G278D delivery, as plasma concentrations of PEPD.sup.G278D were high and similar in mice bearing SW48 tumors and HCT116 tumors (
Example 7
Aderbasib Restores the Antitumor Activity of PEPD.SUP.G278D .in Tumors Overexpressing HB-EGF
[0064] Aderbasib inhibits the shedding of all EGFR ligands by inhibiting ADAM10 and ADAM17 as mentioned before. We evaluated the antitumor activity of aderbasib as a single agent or in combination with EP plus PEPD.sup.G278D in HCT116 and HT29 tumors. Tumor-bearing mice were treated with EP, aderbasib, or the combination of aderbasib with EP and PEPD.sup.G278D. As in previous experiments, EP was administered at 0.5 mg/kg ip daily, and PEPD.sup.G278D was administered at 4 mg/kg ip three times weekly. Aderbasib was administered at 60 mg/kg by gavage daily. In HCT116 and HT29 tumors, aderbasib alone was ineffective, but combining aderbasib with EP plus PEPD.sup.G278D inhibited tumor growth by 63.3% and 54.4% respectively at the end of treatment (
[0065] Aderbasib caused marked decrease in soluble HB-EGF level in the tumor tissues (
[0066] Notably, in tumors treated by the triple combination (EP, aderbasib and PEPD.sup.G278D), low levels of p-AKT, p-ERK and p-MEK remained despite profound loss of both expression and phosphorylation of EGFR and HER2 induced by PEPD.sup.G27D, suggesting that mutated PIK3CA, KRAS and BRAF may sustain a low level of signaling despite depletion of EGFR and HER2. Likewise, in cultured HCT116 and HT29 cells, despite profound loss of both EGFR and HER2 and marked inhibition of both RAS and PI3K activities by PEPD.sup.G278D, residual RAS and PI3K activities remain as mentioned before.
Example 8
Adding 5-FU to the PEPD.SUP.G278D.-Based Combination Treatment Enhances Therapeutic Outcome
[0067] Because 5-FU, an antimetabolite, is commonly used in CRC treatment, we asked whether combining 5-FU with the PEPD.sup.G278D-based combination regime described above enhances treatment outcome. Thus, tumor-bearing mice were treated with EP, or the combination of EP, 5-FU, aderbasib and PEPD.sup.G278D. As in other experiments, EP was administered at 0.5 mg/kg ip daily, PEPD.sup.G278D was administered at 4 mg/kg ip three times weekly, and aderbasib was administered by gavage at 60 mg/kg daily. 5-FU was administered to mice at 35 mg/kg ip once every 3-4 days, which was not toxic in a dose-finding experiment. We first evaluated the combination regimen in mice bearing subcutaneous HCT 116 and HT29 tumors. The combination treatment was highly effective against both types of tumors, inhibiting tumor growth by 72.4% (HCT 116 tumors) and 69.4% (HT29 tumors) at the end of treatment (
[0068] We also evaluated the combination regimen in mice bearing orthotopic HCT116 tumors. HCT116 cells stably expressing firefly luciferase were inoculated to the cecum of mice. Tumor growth was monitored by bioluminescence imaging (
[0069] Although the present disclosure has been described with respect to one or more particular embodiments and/or examples, it will be understood that other embodiments and/or examples of the present disclosure may be made without departing from the scope of the present disclosure.
[0070] The following reference listing is not an indication that any particular reference is material to patentability: [0071] 1. Spano J P, Lagorce C, Atlan D, Milano G, Domont J, Benamouzig R, et al. Impact of EGFR expression on colorectal cancer patient prognosis and survival. Ann Oncol. 2005; 16:102-108. [0072] 2. Shia J, Klimstra D S, Li A R, Qin J, Saltz L, Teruya-Feldstein J, et al. Epidermal growth factor receptor expression and gene amplification in colorectal carcinoma: an immunohistochemical and chromogenic in situ hybridization study. Mod Pathol. 2005; 18:1350-1356. [0073] 3. Chan DLH, Segelov E, Wong R S, Smith A, Herbertson R A, Li B T, et al. Epidermal growth factor receptor (EGFR) inhibitors for metastatic colorectal cancer. Cochrane Database Syst Rev. 2017; 6:CD007047. [0074] 4. Cunningham D, Humblet Y, Siena S, Khayat D, Bleiberg H, Santoro A, et al. Cetuximab monotherapy and cetuximab plus irinotecan in irinotecan-refractory metastatic colorectal cancer. N Engl J Med. 2004; 351:337-345. [0075] 5. Van Cutsem E, Peeters M, Siena S, Humblet Y, Hendlisz A, Neyns B, et al. Open-label phase III trial of panitumumab plus best supportive care compared with best supportive care alone in patients with chemotherapy-refractory metastatic colorectal cancer. J Clin Oncol. 2007; 25:1658-1664. [0076] 6. Price T J, Peeters M, Kim T W, Li J, Cascinu S, Ruff P, et al. Panitumumab versus cetuximab in patients with chemotherapy-refractory wild-type KRAS exon 2 metastatic colorectal cancer (ASPECCT): a randomised, multicentre, open-label, non-inferiority phase 3 study. Lancet Oncol. 2014; 15:569-579. [0077] 7. Bardelli A, Siena S. Molecular mechanisms of resistance to cetuximab and panitumumab in colorectal cancer. J Clin Oncol. 2010; 28:1254-1261. [0078] 8. Van Emburgh B O, Sartore-Bianchi A, Di Nicolantonio F, Siena S, Bardelli A. Acquired resistance to EGFR-targeted therapies in colorectal cancer. Mol Oncol. 2014; 8:1084-1094. [0079] 9. Bylsma L C, Gillezeau C, Garawin T A, Kelsh M A, Fryzek J P, Sangare L, et al. Prevalence of RAS and BRAF mutations in metastatic colorectal cancer patients by tumor sidedness: A systematic review and meta-analysis. Cancer Med. 2020; 9:1044-1057. [0080] 10. Misale S, Di Nicolantonio F, Sartore-Bianchi A, Siena S, Bardelli A. Resistance to anti-EGFR therapy in colorectal cancer: from heterogeneity to convergent evolution. Cancer Discov. 2014; 4:1269-1280. [0081] 11. Karapetis C S, Khambata-Ford S, Jonker D J, O'Callaghan C J, Tu D, Tebbutt N C, et al. Kras mutations and benefit from cetuximab in advanced colorectal cancer. N Engl J Med. 2008; 359:1757-1765. [0082] 12. Amado R G, Wolf M, Peeters M, Van Cutsem E, Siena S, Freeman D J, et al. Wild-type KRAS is required for panitumumab efficacy in patients with metastatic colorectal cancer. J Clin Oncol. 2008; 26:1626-1634. [0083] 13. Hong D S, Fakih M G, Strickler J H, Desai J, Durm G A, Shapiro G I, et al. KRAS(G12C) Inhibition with sotorasib in advanced solid tumors. N Engl J Med. 2020; 383:1207-1217. [0084] 14. Kopetz S, Desai J, Chan E, Hecht J R, O'Dwyer P J, Lee R J, et al. PLX4032 in metastatic colon cancer patients with mutant BRAF tumors. J Clin Oncol. 2010; 28(15_suppl):3534. [0085] 15. Juric D, Rodon J, Tabernero J, Janku F, Burris H A, Schellens JHM, et al. Phosphatidylinositol 3-kinase alpha-selective inhibition with alpelisib (BYL719) in PIK3CA-altered solid tumors: results from the first-in-human study. J Clin Oncol. 2018; 36:1291-1299. [0086] 16. Ramanathan R K, Hwang J J, Zamboni W C, Sinicrope F A, Safran H, Wong M K, et al. Low overexpression of HER-2/neu in advanced colorectal cancer limits the usefulness of trastuzumab (Herceptin) and irinotecan as therapy. A phase II trial. Cancer Invest. 2004; 22:858-865. [0087] 17. Delord J P, Argiles G, Fayette J, Wirth L, Kasper S, Siena S, et al. A phase lb study of the MET inhibitor capmatinib combined with cetuximab in patients with MET-positive colorectal cancer who had progressed following anti-EGFR monoclonal antibody treatment. Invest New Drugs. 2020; 38:1774-1783. [0088] 18. Rimassa L, Bozzarelli S, Pietrantonio F, Cordio S, Lonardi S, Toppo L, et al. Phase II study of tivantinib and cetuximab in patients with KRAS wild-type metastatic colorectal cancer with acquired resistance to EGFR inhibitors and emergence of MET overexpression: lesson learned for future trials with EGFR/MET dual inhibition. Clin Colorectal Cancer. 2019; 18:125-132. [0089] 19. Yang L, Li Y, Zhang Y. Identification of prolidase as a high affinity ligand of the ErbB2 receptor and its regulation of ErbB2 signaling and cell growth. Cell Death Dis. 2014; 5:e1211. [0090] 20. Yang L, Li Y, Bhattacharya A, Zhang Y. Dual inhibition of ErbB1 and ErbB2 in cancer by recombinant human prolidase mutant hPEPD-G278D. Oncotarget. 2016; 7:42340-42352. [0091] 21. Yang L, Li Y, Bhattacharya A, Zhang Y. A recombinant human protein targeting HER2 overcomes drug resistance in HER2-positive breast cancer. Sci Transl Med. 2019; 11:eaav1620. [0092] 22. Yang L, Li Y, Bhattacharya A, Zhang Y. Inhibition of ERBB2-overexpressing tumors by recombinant human prolidase and its enzymatically inactive mutant. EBioMedicine. 2015; 2:396-405. [0093] 23. Witters L, Scherle P, Friedman S, Fridman J, Caulder E, Newton R, et al. Synergistic inhibition with a dual epidermal growth factor receptor/HER-2/neu tyrosine kinase inhibitor and a disintegrin and metalloprotease inhibitor. Cancer Res. 2008; 68:7083-7089. [0094] 24. Sahin U, Weskamp G, Kelly K, Zhou H M, Higashiyama S, Peschon J, et al. Distinct roles for ADAM10 and ADAM17 in ectodomain shedding of six EGFR ligands. J Cell Biol. 2004; 164:769-779. [0095] 25. Sahin U, Blobel C P. Ectodomain shedding of the EGF-receptor ligand epigen is mediated by ADAM17. FEBS Lett. 2007; 581:41-44. [0096] 26. Yang L, Li Y, Ding Y, Choi K S, Kazim A L, Zhang Y. Prolidase directly binds and activates epidermal growth factor receptor and stimulates downstream signaling. J Biol Chem. 2013; 288:2365-2375. [0097] 27. Troiani T, Napolitano S, Vitagliano D, Morgillo F, Capasso A, Sforza V, et al. Primary and acquired resistance of colorectal cancer cells to anti-EGFR antibodies converge on MEK/ERK pathway activation and can be overcome by combined MEK/EGFR inhibition. Clin Cancer Res. 2014; 20:3775-3786. [0098] 28. Kennedy S P, Hastings J F, Han J Z, Croucher D R. The under-appreciated promiscuity of the epidermal growth factor receptor family. Front Cell Dev Biol. 2016; 4:88. [0099] 29. Kennedy S P, Han JZR, Portman N, Nobis M, Hastings J F, Murphy K J, et al. Targeting promiscuous heterodimerization overcomes innate resistance to ERBB2 dimerization inhibitors in breast cancer. Breast Cancer Res. 2019; 21:43. [0100] 30. Young A, Lou D, McCormick F. Oncogenic and wild-type Ras play divergent roles in the regulation of mitogen-activated protein kinase signaling. Cancer Discov. 2013; 3:112-123. [0101] 31. Zhao L, Vogt P K. Helical domain and kinase domain mutations in p110 alpha of phosphatidylinositol 3-kinase induce gain of function by different mechanisms. Proc Natl Acad Sci USA. 2008; 105:2652-2657. [0102] 32. Hon W C, Berndt A, Williams R L. Regulation of lipid binding underlies the activation mechanism of class IA PI3-kinases. Oncogene. 2012; 31:3655-3666. [0103] 33. Arena S, Bellosillo B, Siravegna G, Martinez A, Canadas I, Lazzari L, et al. Emergence of multiple EGFR extracellular mutations during cetuximab treatment in colorectal cancer. Clin Cancer Res. 2015; 21:2157-2166. [0104] 34. Price T, Ang A, Boedigheimer M, Kim T W, Li J, Cascinu S, et al. Frequency of S492R mutations in the epidermal growth factor receptor: analysis of plasma DNA from patients with metastatic colorectal cancer treated with panitumumab or cetuximab monotherapy. Cancer Biol Ther. 2020; 21:891-898. [0105] 35. Ogiso H, Ishitani R, Nureki O, Fukai S, Yamanaka M, Kim J H, et al. Crystal structure of the complex of human epidermal growth factor and receptor extracellular domains. Cell. 2002; 110:775-787. [0106] 36. Garrett T P, McKern N M, Lou M, Elleman T C, Adams T E, Lovrecz G O, et al. Crystal structure of a truncated epidermal growth factor receptor extracellular domain bound to transforming growth factor alpha. Cell. 2002; 110:763-773. [0107] 37. Li S, Schmitz K R, Jeffrey P D, Wiltzius J J, Kussie P, Ferguson K M. Structural basis for inhibition of the epidermal growth factor receptor by cetuximab. Cancer Cell. 2005; 7:301-311. [0108] 38. Yang L, Li Y, Bhattacharya A, Zhang Y. A plasma proteolysis pathway comprising blood coagulation proteases. Oncotarget. 2016; 7:40919-40938. [0109] 39. Sanders J M, Wampole M E, Thakur M L, Wickstrom E. Molecular determinants of epidermal growth factor binding: a molecular dynamics study. PLoS One 2013; 8:e54136. [0110] 40. Normanno N, Tejpar S, Morgillo F, De Luca A, Van Cutsem E, Ciardiello F. Implications for KRAS status and EGFR-targeted therapies in metastatic CRC. Nat Rev Clin Oncol. 2009; 6:519-527. [0111] 41. De Roock W, Claes B, Bernasconi D, De Schutter J, Biesmans B, Fountzilas G, et al. Effects of KRAS, BRAF, NRAS, and PIK3CA mutations on the efficacy of cetuximab plus chemotherapy in chemotherapy-refractory metastatic colorectal cancer: a retrospective consortium analysis. Lancet Oncol. 2010; 11:753-762. [0112] 42. Okada Y, Kimura T, Nakagawa T, Okamoto K, Fukuya A, Goji T, et al. EGFR downregulation after anti-EGFR therapy predicts the antitumor effect in colorectal cancer. Mol Cancer Res. 2017; 15:1445-1454. [0113] 43. Hecht J R, Mitchell E, Neubauer M A, Burris H A, 3rd, Swanson P, Lopez T, et al. Lack of correlation between epidermal growth factor receptor status and response to Panitumumab monotherapy in metastatic colorectal cancer. Clin Cancer Res. 2010; 16:2205-2213. [0114] 44. Wheeler D L, Huang S, Kruser T J, Nechrebecki M M, Armstrong E A, Benavente S, et al. Mechanisms of acquired resistance to cetuximab: role of HER (ErbB) family members. Oncogene. 2008; 27:3944-3956. [0115] 45. Liao H W, Hsu J M, Xia W, Wang H L, Wang Y N, Chang W C, et al. PRMT1-mediated methylation of the EGF receptor regulates signaling and cetuximab response. J Clin Invest. 2015; 125:4529-4543. [0116] 46. Friedman S, Levy R, Garrett W, Doval D, Bondarde S, Sahoo T, et al. Clinical benefit of INCB7839, a potent and selective inhibitor of ADAM10 and ADAM17, in combination with trastuzumab in metastatic HER2 positive breast cancer patients. Cancer Res. 2009; 69(24 suppl), abstract nr 5056. [0117] 47. Jin J, Shi Y, Zhang S, Yang S. PIK3CA mutation and clinicopathological features of colorectal cancer: a systematic review and Meta-Analysis. Acta Oncol. 2020; 59:66-74. [0118] 48. Prahallad A, Sun C, Huang S, Di Nicolantonio F, Salazar R, Zecchin D, et al. Unresponsiveness of colon cancer to BRAF(V600E) inhibition through feedback activation of EGFR. Nature. 2012; 483:100-103. [0119] 49. Jones J C, Renfro L A, Al-Shamsi H O, Schrock A B, Rankin A, Zhang B Y, et al. .sup.Non-V600 BRAF mutations define a clinically distinct molecular subtype of metastatic colorectal cancer. J Clin Oncol. 2017; 35:2624-2630. [0120] 50. Wang Q, Shi Y L, Zhou K, Wang L L, Yan Z X, Liu Y L, et al. PIK3CA mutations confer resistance to first-line chemotherapy in colorectal cancer. Cell Death Dis. 2018; 9:739.