METHOD AND ANTIGEN COMPOSITION FOR RAPID DETECTION OF CHAGAS DISEASE, LEISHMANIASIS, AND/OR HEARTWORM IN HUMANS AND ANIMALS

20250020642 ยท 2025-01-16

    Inventors

    Cpc classification

    International classification

    Abstract

    Among several illnesses common to pets such as dogs that can also affect humans, American trypanosomiasis, commonly known as Chagas disease, is a parasitic 20 condition caused by the hemoflagellated protozoa, Trypanosoma cruzi. Active transmission is through triatomine vectors known as kissing bugs, which are prevalent in North and South America. Diagnostic methods, systems, test strips, test kits, and other immunoassay materials are provided for the detection of antibodies to one or more specific parasites of veterinary and human concern in biological samples, including those that are responsible for Chagas disease (Trypanosoma cruzi), Leishmaniasis (Leishmania infantum), and Heartworm (Dirofilaria immitis).

    Claims

    1. A combination of materials comprising: a) a first substrate comprising at least one Trypanosoma cruzi antigen attached to the first substrate; and b) detectably labeled antibodies that are capable of specifically binding to antibodies produced by an animal that has been exposed to Trypanosoma cruzi.

    2. The combination of materials of claim 1, wherein the at least one Trypanosoma cruzi antigen comprises at least one of a Trypanosoma cruzi antigen that is an LA204 protein selected from the proteins in Table A, an IBMP-8 protein selected from the proteins of Table B, 1F8, Tc24, SAPA, B13, PEP2, FRA, TSSA, TcD, TcF, or TcE, or an antigenic fragment of any of said proteins, or a combination of said proteins, or a combination of said antigenic fragments, or a combination of said proteins and antigenic fragments thereof.

    3. The combination of materials of claim 2, wherein the at least one Trypanosoma cruzi antigen comprises a combination of LA204 proteins, or antigenic fragments thereof.

    4. The combination of materials of claim 3, wherein the at least one Trypanosoma cruzi antigen comprises all of the proteins of LA204 as in Table A.

    5. The combination of materials of claim 4, wherein the at least one Trypanosoma cruzi antigen comprises the 1F8 protein, an IBMP-8 protein from Table B, or an antigenic fragment thereof.

    6. The combination of materials of claim 4, wherein the at least one Trypanosoma cruzi comprises the 1F8 or the IBMP-8 protein.

    7. The combination of materials of claim 1, further comprising: i) at least one Leishmania protein or antigenic fragment thereof attached to the first substrate or to a second substrate, and detectably labeled antibodies that are capable of specifically binding to antibodies produced by an animal that has been exposed to the Leishmania, wherein said Leishmania protein is optionally rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18; or ii) at least one Dirofilaria immitis antigen attached to the first substrate, the second substrate, or a third substrate and detectably labeled antibodies that are capable of specifically binding to antibodies produced by an animal that has been exposed to the Dirofilaria immitis; wherein said Dirofilaria immitis antigen is optionally DIT33, ChimDiT33, PDi33, or antigenic fragments thereof; iii) a combination of i) and ii).

    6. The combination of materials of claim 1, wherein the substrate is configured to permit flow of a liquid biological sample through the substrate, and wherein said substrate is optionally nitrocellulose.

    7. The combination of materials of claim 1, wherein the detectably labeled antibodies comprise a detectable label that is visually detectable.

    8. The combination of materials of claim 7, wherein the detectable label comprises gold particles.

    9. The combination of materials of claim 8, wherein the detectably labeled antibodies comprise polyclonal goat anti-feline antibodies.

    10. The combination of materials of claim 9, wherein the polyclonal goat anti-feline antibodies comprise IgG and IgM antibodies.

    11. The combination of materials of claim 10, wherein the polyclonal goat anti-feline IgG and IgM antibodies are capable of specifically binding to anti-feline and anti-canine antibodies.

    12. The combination of materials of claim 11, wherein the at least one Trypanosoma cruzi antigen comprises a combination of 1F8, Tc24, SAPA, B13, PEP2, FRA, TSSA, TcD, TcF, TcE, an LA204 protein selected from the proteins in Table B, and an IBMP-8 protein selected from the proteins of Table B.

    13. The combination of materials of claim 11, wherein the at least one Trypanosoma cruzi antigen comprises all of the proteins as in Table A.

    14. The combination of materials of claim 11, wherein the at least one Trypanosoma cruzi antigen comprises also comprises the 1F8 or the IBMP-8 or an antigenic fragment thereof.

    15. The combination of materials of claim 11, wherein the at least one Trypanosoma cruzi antigen comprises also comprises the 1F8 or the IBMP-8 protein.

    16. The combination of materials of any one of claims 1-15, further comprising a liquid biological sample obtained from a feline or canine.

    17. The combination of materials of any one of claims 1-15, wherein the combination of materials are provided in a kit, the kit further comprising one or more sealed containers that contain the substrate comprising the one or more proteins or antigenic fragments thereof, and one or more containers that contain the detectably labeled antibodies, the kit optionally further comprising printed material that identifies the combination of materials and/or provides instructions to a user for using the combination of materials to determine antibodies from a subject.

    18. A method comprising exposing a biological sample obtained from a mammal to a material of any one of claims 1-15, and determining a signal from the detectably labeled antibodies.

    19. The method of claim 18, wherein the mammal is a canine or feline animal.

    20. The method of claim 18, wherein the mammal is a canine.

    21. The method of claim 18, wherein the mammal is a feline.

    22. The method of claim 18, wherein the signal from the detectably labeled antibodies signifies the mammal has been exposed to Trypanosoma cruzi.

    23. The method of claim 18, wherein the signal from the detectably labeled antibodies aids in a determination that the mammal has Chagas disease.

    24. The method of claim 23, further comprising administering to the mammal at least one therapeutic agent for treatment of the Chagas disease.

    25. A method comprising exposing a biological sample obtained from a mammal to a material of any one of claims 7-15, and determining a signal from the detectably labeled antibodies.

    26. The method of claim 25, wherein the mammal is a canine or feline animal.

    27. The method of claim 25, wherein the mammal is a canine.

    28. The method of claim 25, wherein the mammal is a feline.

    29. The method of claim 25, wherein the signal from the detectably labeled antibodies signifies the mammal has been exposed to Leishmania.

    30. The method of claim 24, wherein the signal from the detectably labeled antibodies aids in a determination that the mammal has Leishmaniasis.

    31. The method of claim 30, further comprising administering to the mammal at least one therapeutic agent for treatment of the Leishmaniosis.

    33. The method of claim 25, wherein the signal from the detectably labeled antibodies signifies the mammal has been exposed to Dirofilaria immitis.

    33. The method of claim 32, wherein the signal from the detectably labeled antibodies aids in a determination that the mammal has heartworm disease.

    34. The method of claim 33, further comprising administering to the mammal at least one therapeutic agent for treatment of the heartworm disease.

    35. A combination of materials comprising: a) a substrate comprising at least one Leishmania antigen attached to the substrate, wherein said antigen is optionally selected from Leishmania protein rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18, and antigenic fragments thereof; and b) detectably labeled antibodies that are capable of specifically binding to antibodies produced by an animal that has been exposed to Leishmania.

    36. A combination of materials comprising: a) a substrate comprising at least one at least Dirofilaria immitis antigen attached to the substrate, wherein said antigen is optionally selected from DIT33, ChimDiT33, PDi33, and antigenic fragments thereof; and b) detectably labeled antibodies that are capable of specifically binding to antibodies produced by an animal that has been exposed to the Dirofilaria immitis antigen attached to the substrate.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0026] FIG. 1. Three representative configurations of a lateral flow assay.

    [0027] FIG. 2. Representative Chagas detection reagents.

    [0028] FIG. 3, panel A. Representative negative Chagas lateral flow result. Panel B, representative positive Chagas lateral flow result Positive result is boxed.

    [0029] FIG. 4. Representative heartworm detection reagents.

    [0030] FIG. 5. Representative Leishmania detection agents.

    DETAILED DESCRIPTION

    [0031] Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains.

    [0032] Unless specified to the contrary, it is intended that every maximum numerical limitation given throughout this description includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification includes every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.

    [0033] The singular forms a, an and the include plural referents unless the context clearly dictates otherwise. The terms a (or an), as well as the terms one or more, and at least one can be used interchangeably herein. Furthermore, and/or where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other.

    [0034] All amino acid sequences of the proteins and peptides described herein include sequences having 90.0-99.9% identity across their entire lengths to the described amino acid sequences. The amino acid sequence associated with each database entry of this disclosure is incorporated herein by reference as presented in the database on the effective filing date of this application or patent. The database entries include but are not necessarily limited to the UniProt and GenBank databases.

    [0035] Aspects of this disclosure include each protein described herein, and all combinations of such proteins. All amino acid sequences in this disclosure include all segments thereof that are at least 5 contiguous amino acids of the described sequences. The disclosure thus includes antigenic fragments of the described protein. An antigenic fragment means a segment of a described protein that stimulates an antibody response in a host that is exposed to a protein that comprises the segment. The proteins and/or antigenic fragments of the proteins are used in assays as further described herein to provide profiles of antibodies that can bind with specificity to the described proteins or antigenic fragments thereof. In certain instances the proteins and antigenic fragments described herein may themselves be referred to as antigens.

    [0036] Determination of the antibodies that bind to the described proteins or antigenic fragments thereof (wherein said binding is not necessarily mutually exclusive) can be performed using any suitable approach, including but not limited to any type of enzyme-linked immunosorbent assay (ELISA) assay, including but not limited to a direct ELISA, a sandwich ELISA, a competitive ELISA, and a reverse ELISA. In embodiments, one or proteins and/or peptides described herein can be incorporated into an immunodiagnostic device, such as a microfluidic device, a lateral flow device, and the like. Non-limiting combinations of materials for use in such assays are described further below.

    [0037] In non-limiting embodiments, the disclosure provides for a device configured to generate a signal that is based on antibodies bound to one or more of the described proteins and/or antigenic fragments thereof. In embodiments, the signal is optically accessible. In embodiments, at least some antibodies, if present in the biological sample, are bound to at least some of the proteins or antigenic fragments thereof in the plurality of proteins. In embodiments, the antibodies are bound to the proteins or antigenic fragments thereof or a combination thereof, and the assay further comprises detectably labeled antibodies bound to the antibodies that are bound to the proteins or antigenic fragments thereof, or a combination thereof. Thus, in one approach, the disclosure includes determining a signal from the detectably labeled antibodies. The detection antibodies or other detection agent can be labeled using any suitably detectable label. In embodiments, the detectable labels produce a signal that comprises UV light (<380 nm), visible light (380-740 nm) or far red light (>740 nm). In embodiments, the detectable signal comprises a fluorescent signal. In embodiments, relative light units (RLUs) are used. In embodiments, a cell-based assay can be used in the methods of the disclosure. In embodiments, a suitable laser may be used. In embodiments, detection, e.g., secondary antibodies, may be conjugated to a gold particle, such as a gold nanoshell. In embodiments, a gold nanoparticle is used, and may be adsorbed to the detection antibodies, and therefore in certain embodiments the gold nanoparticle is not covalently attached to the detection antibodies. Suitable gold nanoparticles for use in the described approaches are commercially available.

    [0038] In embodiments, and while certain implementations of the described approach may be interpretable by a human user of a described device, such as a lateral flow device, in other embodiments, an imager may be used and located proximal to analyzed sample. In embodiments, free-space optics may be used to detect a signal from the assay using any suitable signal detection device that is placed in proximity to the location where a detectable signal is generated, such as a CCD camera. In embodiments, the disclosure provides a microfluidic device for use in sample analysis. In embodiments, the microfluidic device may comprise, among other features, an optical waveguide to transmit a signal to any suitable measuring device such that optical accessibility to sample is not necessarily required to detect the signal. In embodiments, lens-less optics, and/or a cell phone based imaging approach is used. In embodiments, one or more segments of an assay device on which the described antibody analysis is performed can be connected to or in communication with a digital processor and/or a computer running software to interpret the presence, absence, amount, or a ratio of antibodies that bind to one or more of the described peptides. The processor may run software and/or implement an algorithm to interpret an optically detectable signal, and generate a machine and/or user readable output. In an embodiment, an assay device used to perform the antibody analysis can be integrated or otherwise inserted into an adapter that comprises a detection device, such as a camera, or a microscope, including but not limited to a fluorescent microscope. In embodiments, a computer readable storage medium can be a component of an assay device of this disclosure, and can be used during or subsequent to performing any assay or one or more steps of any assay described herein. In embodiments the computer storage medium is a non-transitory medium, and thus can exclude signals, carrier waves, and other transitory signals.

    [0039] In embodiments, the one or more of the described proteins and/or antigenic fragments thereof are used in a device referred to in the art as a BioCD device, and thus detectable labels may not be required. In embodiments, the BioCD is a differential phase-contrast BioCD biosensor, such as that described in Differential phase-contrast BioCD biosensor, Appl Opt. (2007) 46:8196-6209, from which the entire description is incorporated by reference. In embodiments, the presently described antigens are used in a device and/or method as described in U.S. patent U.S. Pat. Nos. 10,100,092, 7,910,356, 7,787,126, and 7,683,092, from which the disclosures of devices for use in immunoassays, and methods of using the devices, are incorporated herein by reference.

    [0040] In embodiments, an assay of this disclosure may include an antigen component that comprises or consists of antigens that are described herein. Thus, in embodiments, one or a combination of the described antigens may be the only antigens in the assay. In embodiments, the antigens used in a described antibody analysis may comprises or consist of at least two different antigens. In embodiments, the antigens used in a described antibody analysis may comprises or consist of 2-1,000 antigens, inclusive, and including all numbers and ranges of numbers there between.

    [0041] In embodiments, the described proteins and antigenic fragments thereof can be modified using any suitable approach, including but not limited to including one or more purification tags, including but not limited to a His-tag. In an embodiment, a His-tag is a linear sequence of n histidine residues where n is typically 6-10. His-tags achieve purification by binding specifically to nickel or cobalt ions, which may be for example, attached to a substrate, such as any suitable beads. The His-tag, or any other suitable purification tag, may be placed at the N-terminus, or at the C-terminus of the protein or peptide. In embodiments, a FLAG-tag, or FLAG octapeptide, or FLAG epitope, may be included. Suitable FLAG sequences are known in the art. In embodiments, a Small ubiquitin-related modifier (SUMO) tag, such as a His-SUMO tag can be included.

    [0042] In embodiments, one or more of the proteins or antigenic fragments thereof may comprise a linker. The term linker refers to a chemical moiety that connects a segment the peptide to another material. Linkers include amino acids, but other linkers are encompassed as well. Generally speaking, amino acid linkers may be principally composed of relatively small, neutral amino acids, such as Glycine, Serine, and Alanine, and can include multiple copies of a sequence enriched in Glycine and Serine. In embodiments, the linker is provided as a means to connect the protein or peptide to a substrate. As such, the linker may be attached to a binding partner that connects the peptide to a substrate.

    [0043] In embodiments, one or more of the antigenic fragments thereof are modified so that they can be attached to a substrate. The attachment may or may not be via a linker. In various embodiments, the one or more antigenic fragments thereof can be reversibly or irreversibly attached to a substrate, such as by being covalently, ionically, or physically bound to a, for example, a solid-phase substrate using methods such as covalent bonding via an amide or ester linkage, ionic attraction, or by adsorption, non-limiting examples of which comprise biotin and streptavidin tags. The substrate can be any suitable substrate onto which one or more described proteins or antigenic fragments thereof can be attached. Examples include substrates typically used in immunodetection assays, lateral flow devices, bead-based assays, nanoparticles such as gold nanoparticles, microfluidic devices, etc. Thus, a solid substrate can be a porous solid substrate that allows the flow of liquid through the substrate, such as by capillary action. In a non-limiting embodiment, the substrate comprises nitrocellulose. In embodiments, the substrate may be a film. In embodiments, the substrate may comprise one or more channels. The substrate may be in fluid communication with one or more wicking materials, such as a woven mesh or cellulose fiber, such as for use as a sample application pad, and may further be in fluid communication with a suitable filter material to separate non-antibody material from the biological sample.

    [0044] The biological liquid sample can flow through the porous substrate via any suitable means, such as by capillary action, microfluidics, etc. The substrate can also be a non-porous solid substrate, such as beads formed from glass or other non-porous materials, such as plastic. In certain embodiments, the substrate, the proteins or antigenic fragments thereof may be functionalized to facilitate their attachment. The substrate may be blocked prior to attaching the proteins and/or antigenic fragments thereof to reduce artifacts. The describes assays may also be performed in solution.

    [0045] The disclosure includes lateral flow devices that include one or more substrate strips, and thus may be provided in the form of a cassette. A single strip, or separate strips, may be provided and may comprise proteins or antigenic fragments thereof to facilitate detection of antibodies that bind to Chagas antigens, heartworrn antigens, Leishmaniasis antigens, and combinations thereof. The single strip, or a separate strip, may also comprise a control to provide a signal that the particular assay is functional. The described assays may be qualitative or quantitative. Thus, the described assays can provide a determination of the presence of antibodies, the absence of antibodies, or an amount of antibodies that are present in a particular biological sample. In certain embodiments a multiplex assay is provided, wherein antigens from more than one of the described infectious agents can be combined in a single assay, in which case the disclosure provides for use of separately detectable labels.

    [0046] In embodiments, one or more of the antigenic fragments thereof are present in vitro, such as in an in vitro assay. In embodiments, the proteins or antigenic fragments thereof and are in contact with a biological sample obtained from an individual, such as any mammal, representative embodiments of which include but are not limited to human, canines, felines, and equine animals. In embodiments, the biological sample is from an animal who has been exposed or is suspected of having been exposed, or was at risk of exposure, to one or causative agents of Chagas disease, Heartworm, or Leishmaniosis.

    [0047] In certain embodiments a result based on a determination of the presence, absence, amount, type, ratio, or a combination thereof for antibodies analyzed using an approach and/or a device of this disclosure is obtained and is fixed in a tangible medium of expression, such as a digital file, and/or is saved on a portable memory device, or on a hard drive, or is communicated to a web-based or cloud-based storage system. The determination can be communicated to, for example, a veterinary health care provider for the purpose of making a diagnosis, and/or recommending or not recommending any particular medical intervention. In certain non-limiting embodiments, based on a determination of the presence of antibodies, the disclosure further comprises administering to the subject from which the biological sample was obtained a suitable therapeutic agent. For example, for Leishmaniasis, the disclosure includes administering any of Liposomal amphotericin B, pentamidine, Ivermectin, antimony, amphotericin, paromomycin and miltefosine. In embodiments, for Chagas, the disclosure includes administering any of benznidazole, nifurtimox, and itraconazole. In embodiments, for Heartworm, the disclosure includes administering melarsomine.

    [0048] In certain examples the disclosure comprises an article of manufacture, which in embodiments can also be considered kits. The kits can comprise a combination of materials as described herein. The article of manufacture comprises at least one component for use in the antibody analysis described herein, and packaging. The packaging can contain any proteins or antigenic fragments thereof or combinations thereof described herein, and may further provide reagents for use in determining antibodies, and/or for sample collection. The kit can be provided as a component of a cartridge or similar component, or for example a multi-well plate. Such components may be provided pre-loaded with any combination of reagents required to perform the described analysis. Such components may be provided with the substrate and certain reagents as a lyophilized form for reconstitution in, for example, a suitable immunodiagnostic buffer. In various embodiments, the article of manufacture includes printed material. The printed material can be part of the packaging, or it can be provided on a label, or as paper insert or other written material included with the packaging. The printed material provides information on the contents of the package, and instructs a user how to use the package contents for antibody analysis, and may provide information about determination of a property functioning assay and a determination of the presence, absence, and or amount of antibodies present in a sample.

    [0049] In certain embodiments a result obtained from using a method and/or device and/or system and/or a combination of materials of this disclosure can be compared to a suitable reference, examples of which include but are not limited to control sample(s), a standardized curve(s), and/or experimentally designed controls such as a known input value. Any signal used for determining the described antibodies can be normalized to account for, for instance, differing protein lengths which may comprises a different number of epitopes relative to other proteins that may be used in the assay, thereby potentially producing more antibodies bound to a longer protein relative to a shorter protein.

    [0050] In embodiments, a result produced using an approach of this disclosure is improved relative to a result obtained for an immunological assay for the same antibodies, but that is performed using different reagents than those used in the described assays of this disclosure. In an embodiment, an improved result comprises improved specificity, improved sensitivity, or a combination thereof, relative to a comparative assay. In embodiments, a comparative assay comprises an IFA assay. In embodiments, a comparative assay comprises an immunological assay that uses a capture antibody, instead of a configuration wherein an antigen is attached directly to a substrate. In an embodiment, the improved result is obtained using detectably label anti-feline IgG antibodies, detectably label anti-feline IgM antibodies, or a combination thereof, as detection antibodies for analysis of biological samples, including but not necessarily limited to canine samples. In embodiments, the detectably label anti-feline IgG and IgM are antibodies produced by a goat. In non-limiting embodiments, sensitivity is improved relative to a comparative assay by at least 50% to 75%. In an embodiment, improved sensitivity means a described assay produces fewer false negative results than a comparative assay. In an embodiment, improved specificity means a described assay produces fewer false positive results than a comparative assay. In embodiments, a result obtained by performing a method of the disclosure may be obtained faster than a result obtained by using a comparative assay.

    [0051] Representative Chagas antigens that are suitable for use in the described assays include but are not necessarily limited to 1F8, GenBank accession no. CAA26599.1; Tc24 GenBank accession no ABA62611.1, SAPA, UniProt no. 000773, B13, GenBank accession no. AAP88022.1, PEP2, GenBank accession no. AAP88022.1, TcD, GenBank accession no. EAN98335.1, TcF, FRA, TcE, LA204, and IMBP-8 proteins. LA204 is a commercially available mixture of T. cruzi proteins, available for example, from East Coast Bio, under Catalog number LA204. The proteins are a mixture of proteins from T. cruzi proteins strains M/HOM/BR/78/SYLVIO-X10 CL, M/HOM/AR/74/CA-1 and Texas-Tulane. The present disclosure includes a characterization of the proteins in the LA204 product. The proteins are provided in Table A, which provides UniProt database entries for each protein in the LA204 mixture. GenBank accession numbers for IMBP-8 proteins are provided in Table B.

    TABLE-US-00001 TABLE A LA204 UniProt Accession Numbers A0A2V2X5H0 A0A2V2XQW2 A0A2V2VYQ3 A0A2V2WFC2 A0A2V2W077 A0A2V2WVA1 A0A2V2WP51 A0A2V2WI81 A0A2V2UXF5 A0A2V2WXY6 A0A2V2XE27 A0A2V2WDW5 A0A2V2VTM0 A0A2V2V7B1 A0A2V2XQF0 A0A2V2WSY4 A0A2V2VS10 A0A2V2WL30 A0A2V2XMM3 A0A2V2WR94 A0A2V2V8X8 A0A2V2WRW1 A0A2V2XMN2 A0A2V2WD65 A0A2V2VQY5 A0A2V2WVR0 A0A2V2W9C0 A0A2V2WXE3 A0A2V2V595 O61107 A0A2V2W620 A0A2V2X903 A0A2V2V065 A0A2V2V2P8 A0A2V2XHH0 A0A2V2WKA0 A0A2V2V5M4 A0A2V2W0A9 A0A2V2WMN6 A0A2V2WM02 A0A2V2UXG4 O96763 A0A2V2WGK0 A0A2V2VZJ3 A0A2V2V7F4 A0A2V2W573 A0A2V2WKR7 A0A2V2UUI6 A0A2V2V9I0 A0A2V2W206 A0A2V2WJH9 A0A2V2VK35 A0A2V2X840 A0A2V2XGT6 A0A2V2WVA0 A0A2V2W514 A0A2V2X6K9 A0A2V2WWC6 Q598P5 A0A2V2XN58 A0A2V2VSW7 A0A2V2WVA9 A0A2V2VYM4 A0A2V2WU47 A0A2V2XFA6 A0A2V2WV86 A0A2V2VX35 A0A2V2WQC6 A0A2V2WFD8 A0A2V2VVI5 A0A2V2WVE2 A0A2V2XHX1 A0A2V2WFC3 A0A2V2VS74 A0A2V2VAS6 A0A2V2XAM0 A0A2V2WKB2 A0A2V2VTW4 A0A2V2WGT5 A0A2V2XD83 A0A2V2UP60 A0A2V2WXC8 A0A2V2W2R9 A0A2V2XAL8 A0A2V2WGJ8 A0A2V2XBW8 A0A2V2WFU7 A0A2V2XAK1 A0A2V2WHD2 A0A2V2VB61 A0A2V2XEH3 A0A2V2WXM7 A0A2V2X955 A0A2V2W4S9 A0A2V2WBL0 A0A2V2WX48 A0A2V2UK30 A0A2V2WXN9 A0A2V2X3E4 A0A2V2W8P4 Q8STF3 A0A2V2WLD2 A0A2V2VC99 A0A2V2W2W5 Q9U664 A0A2V2WNZ0 O79469 A0A2V2W8C8 A0A2V2WC93 A0A2V2XLG7 A0A2V2WRH3 A0A2V2WW41 A0A2V2XES3 A0A0F6VXC3 A0A2V2X9R4 A0A2V2WY93 A0A2V2XFM8 A0A0F6YE11 A0A2V2X2Y0 A0A2V2XAR8 A0A2V2WXT0 A0A0F6VXL3 A0A2V2WSN9 A0A2V2X9Y6 A0A2V2W5G7 A0A2V2WPQ7 O61101 A0A2V2VM67 A0A2V2X924 A0A2V2XFI7 A0A2V2XBY3 A0A2V2W7E1 A0A2V2WJH7 A0A2V2WVS0 A0A2V2VMU4 A0A2V2WKQ0 A0A2V2XFZ1 A0A2V2UY29 A0A2V2X389 A0A2V2WJU3 A0A2V2X6X5 A0A2V2W7J4 A0A2V2V6P9 A0A2V2XCK3 A0A2V2WP61 A0A2V2WFJ9 A0A2V2X730 A0A2V2XKR0 A0A2V2XC14 A0A2V2X547 A0A2V2X897 A0A2V2UX62 A0A2V2XLY2 A0A2V2WX06 A0A2V2UIF3 A0A2V2X4L6 Q8T9X5 A0A2V2X035 A0A2V2WIX9 A0A2V2WGS3 A0A2V2WNP4 A0A2V2W2P0 A0A2V2X7U8 A0A2V2WZQ3 A0A2V2XDJ5 A0A2V2W3G6 A0A2V2WL05 A0A2V2WGK6 A0A2V2WHR1 A0A2V2VVS5 A0A2V2VMN6 A0A2V2W7L0 A0A2V2W436 A0A2V2VBM7 A0A2V2WDX6 A0A2V2W0T8 A0A2V2W6T3 A0A2V2WNK9 A0A2V2WQI7 A0A2V2WWN1 A0A2V2W9L5 A0A2V2VQ67 A0A2V2WA05 A0A2V2VK45 A0A2V2WAS9 A0A2V2WIH3 A0A2V2WEI3 A0A2V2VMZ2 A0A2V2WCN3 A0A2V2XEW2 A0A2V2WET0 A0A2V2VKE2 A0A2V2W7F9 A0A2V2VKB4 A0A2V2WEQ9 A0A2V2WVL8 A0A2V2V225 A0A2V2VKL3 A0A2V2W927 A0A2V2W0Q8 A0A2V2WEF6 A0A2V2X690 A0A2V2VI28 A0A2V2WRS5 A0A2V2WH08 A0A2V2VMC7 A0A2V2WDM4 A0A2V2XM29 A0A2V2VWT8 A0A2V2X495 A0A2V2XMC1 A0A2V2W5V1 A0A2V2WQE2 A0A2V2W9M2 A0A2V2WQX7 A0A2V2W5U0 A0A2V2W6D7 A0A2V2WR11 A0A1P8CYY9 A0A2V2W875 A0A2V2UU67 A0A2V2WM88 A0A2V2WST8 A0A2V2X126 A0A2V2WJ51 A0A2V2UI35 A0A2V2WRS1 A0A2V2XEE3 A0A2V2XJE7 A0A2V2WCK6 A0A2V2VYI2 A0A2V2WRL2 A0A2V2VXF5 A0A2V2VZ45 A0A2V2WQK9 A0A2V2V2R6 A0A2V2WEQ5 A0A0C5BV55 A0A2V2W9A4 A0A2V2WJU5 A0A2V2WM76 A0A2V2VT40 Q9U4H7 A0A2V2XL43 A0A2V2WYD4 A0A2V2WFL7 A0A2V2W9J5 A0A2V2V8E2 A0A2V2VUY0 A0A2V2WKD4 A0A2V2W3N3 A0A2V2VSW1 A0A2V2WMM5 A0A2V2WHM8 A0A2V2W6N7 A0A2V2VX20 A0A2V2W6U3 A0A2V2XJU3 A0A2V2WHI3 A0A2V2UPG1 A0A2V2W124 A0A2V2XGR5 A0A2V2X9L5 A0A2V2X592 A0A2V2VLR7 A0A2V2WCK3 A0A2V2XL39 A0A2V2W0U8 A0A2V2W9K3 A0A2V2WI80 A0A2V2VDJ1 A0A2V2XAD7 A0A2V2WI78 A0A2V2VFG7 A0A2V2WC16 A0A2V2XNF2 A0A2V2WYE4 A0A2V2WL33 A0A2V2WFX0 A0A2V2XBA1 A0A2V2WZD6 A0A2V2V7C6 A0A2V2WFS6 A0A2V2XC82 A0A2V2W647 A0A2V2V107 A0A2V2X0V0 A0A2V2XMX4 A0A2V2XMX9 A0A2V2W4G1 A0A2V2WY72 A0A2V2WG23 A0A2V2XQF5 A0A2V2XWV4 A0A2V2WRG9 A0A2V2VED7 A0A2V2WLH6 A0A2V2WLA3 A0A2V2X5F4 A0A2V2X4H7 A0A2V2XBN4 A0A2V2X9F6 A0A2V2XB80 A0A2V2XAM3 A0A2V2V2A6 A0A2V2X8V0 A0A2V2X693 A0A2V2X4K8 A0A2V2VXQ0 A0A2V2X6V0 A0A2V2WTB1 A0A2V2WR87 A0A2V2X7D2 A0A2V2X6W9 A0A2V2XAE9 A0A2V2X4C2 A0A2V2W5U5 A0A2V2XCQ1 A0A2V2VL08 A0A2V2WL35 A0A2V2XFF6 A0A2V2W742 A0A2V2WMF3 A0A2V2UIM7 A0A2V2WF83 A0A2V2X287 A0A2V2X931 A0A2V2UZD1 A0A2V2WUX2 A0A2V2X3D7 A0A2V2WEA8 A0A2V2VXH5 A0A2V2WVF8 A0A2V2X2E6 A0A2V2XC91 A0A2V2X2D7 A0A2V2V5E0 A0A2V2WAA9 A0A2V2V649 A0A2V2X001 A0A2V2WSZ7 A0A2V2XFQ7 A0A2V2V3D8 A0A2V2WCT4 A0A2V2WTW6 A0A2V2W6G9 A0A2V2W9F6 A0A2V2USR4 A0A2V2X5L9 A0A2V2XM43 A0A2V2VCM7 A0A2V2XKK4 A0A2V2WTU9 A0A2V2W5I8 A0A2V2VCN8 A0A2V2VJ68 A0A2V2WFS8 A0A2V2WAM0 A0A2V2XK99 A0A2V2WM91 A0A2V2X280 A0A2V2XB96 A0A2V2WV32 A0A2V2VQ92 A0A2V2UWQ7 A0A2V2WC19 A0A2V2W4G5 A0A2V2V886 A0A2V2XDH3 A0A2V2X905 A0A2V2WW92 A0A2V2VDA5 A0A2V2WDM9 A0A2V2V3J8 A0A2V2WUH5 A0A2V2VZX2 A0A2V2WIE0 A0A2V2XHI9 A0A2V2WS51 A0A2V2UXA2 A0A2V2WDF8 A0A2V2XGM1 A0A2V2WY83 A0A2V2VU16 A0A2V2W739 A0A2V2WQS8 A0A2V2WZA8 A0A2V2V047 A0A2V2WT05 A0A2V2XHI4 A0A2V2VYR4 A0A2V2WRG6 A0A2V2WD75 A0A2V2XAT8 A0A2V2XPS2 A0A2V2VJB1 A0A2V2X0K2 A0A2V2X9V2 A0A2V2XIA1 A0A2V2W912 A0A2V2WRR4 A0A2V2WKH0 A0A2V2VMT5 A0A2V2WRB8 A0A2V2WT00 A0A2V2WKL4 A0A2V2X2F9 A0A2V2W3H4 A0A2V2WSM6 A0A2V2V954 A0A2V2VZF9 A0A2V2VWH8 A0A2V2W7Q1 A0A2V2WLG6 A0A2V2VK70 A0A2V2WFG4 A0A2V2WGT9 A0A2V2XAZ8 A0A2V2W5W6 A0A2V2V2J0 A0A2V2WJF8 A0A2V2XLX1 A0A2V2VA43 A0A2V2VWI8 A0A2V2WGT8 A0A2V2VTM7 A0A2V2WX92 A0A2V2X7B6 A0A2V2WGE5 A0A2V2WS20 A0A2V2WXK5 A0A2V2VXX0 A0A2V2WLN5 A0A2V2WBQ8 A0A2V2V7W5 A0A2V2WLG3 A0A2V2WF10 A0A2V2V0Z6 A0A2V2XKU0 A0A2V2WEF8 A0A2V2VB53 A0A2V2W9W8 A0A2V2XKV0 A0A2V2V2N6 A0A2V2XCC4 A0A2V2WKY3 A0A2V2WH20 A0A2V2X3N5 A0A2V2X6H7 A0A2V2V4F9 A0A2V2WRI2 A0A2V2V383 A0A2V2UV35 A0A2V2W0L1 A0A2V2VV01 A0A2V2VQ98 A0A2V2X7F0 A0A2V2W9V5 A0A2V2WFS0 A0A2V2X188 A0A2V2W9E6 A0A2V2VXD6 A0A2V2WEF9 A0A2V2WBP7 A0A2V2X6G0 A0A2V2WJC9 A0A2V2W610 A0A2V2WDB3 A0A2V2W6S6 A0A2V2WQF0 A0A2V2VIP9 A0A2V2XH35 A0A2V2X6H3 A0A2V2X390 A0A2V2W5T3 A0A2V2WCE5 A0A2V2W707 A0A2V2W0R5 A0A2V2WWX1 A0A2V2XHB0 A0A2V2W8Z2 A0A2V2W0N7 A0A2V2V0Y7 A0A2V2X010 A0A2V2W8L1 A0A2V2X3N9 A0A2V2XHL0 A0A2V2WXK6 A0A2V2W9W7 A0A2V2WCJ2 A0A2V2WTG4 A0A2V2WFV0 A0A2V2WLH8 A0A2V2XK70 A0A2V2WIN9 A0A2V2VU90 A0A2V2XL44 A0A2V2VT05 A0A2V2WTS4 A0A2V2WH83 A0A2V2VYP6 A0A2V2WSE3 A0A2V2VLR5 A0A2V2UQP5 A0A2V2WGY6 A0A2V2VJE5 A0A2V2W307 A0A2V2VXG6 A0A2V2VZ90 A0A2V2WAI7 A0A2V2X9R8 A0A2V2X8P9 A0A2V2W9D3 A0A2V2V3Q1 A0A2V2WL51 A0A2V2UGY1 A0A2V2VQE9 A0A2V2W5U4 A0A2V2W4J4 A0A2V2UJI6 A0A2V2WNT7 A0A2V2V115 A0A2V2V9A1 A0A2V2V6K2 A0A2V2UXF1 A0A2V2WLH5 A0A2V2UXF9 A0A2V2VFZ8 A0A2V2XB07 A0A2V2VXW5 A0A2V2UWQ9 A0A2V2VY00 A0A2V2WMH6 A0A2V2W4M3 A0A2V2W959 A0A2V2VTK0 A0A2V2W5J1 A0A2V2VN74 A0A2V2W905 A0A2V2UU13 A0A2V2US66 A0A2V2W363 A0A2V2WZ84 A0A2V2WKK4 A0A2V2VLV1 A0A2V2XGP0 A0A2V2WEC6 A0A2V2V9P3 A0A2V2W7Y4 A0A2V2WZQ4 A0A2V2V792 A0A2V2WXP9 A0A2V2W439 A0A2V2WIA5 A0A2V2VTN9 A0A2V2WKS1 A0A2V2VQ78 A0A2V2VHB5 A0A2V2XK59 A0A2V2WA02 A0A2V2US31 A0A2V2XJZ6 A0A2V2WHM0 A0A2V2VEW9 A0A2V2XI18 A0A2V2W751 A0A2V2VMV2 A0A2V2VW96 A0A2V2W6T1 A0A2V2WH10 A0A2V2UVM3 A0A2V2X3E1 A0A2V2WY15 A0A2V2WHC7 A0A2V2V5F8 A0A2V2X7W1 A0A2V2UNK2 A0A2V2V600 A0A2V2VLU9 A0A2V2WEF5 A0A2V2V6C4 A0A2V2WRA8 A0A2V2V316 A0A2V2X102 A0A2V2WTQ5 A0A2V2XGA3 A0A2V2VN84 A0A2V2XFC3 A0A2V2VN66 A0A2V2XFE2 A0A2V2V953 A0A2V2XR35 A0A2V2WVL7 A0A2V2WX24 A0A2V2V1M4

    TABLE-US-00002 TABLE B Chimeric Amino acid Gene bank antigen Sequence name range sequence ID IBMP-8.1 Trans-sialidase 747-774 XP_820062.1 60 S ribosomal protein L19 218-238 XP_820995.1 Trans-sialidase 1435-1449 XP_813586.1 Surface antigen 2 (CA-2) 276-297 XP_813516.1 IBMP-8.2 Antigen, partial 13-73 ACM47959.1 Surface antigen 2 (CA-2) 166-220 XP_818927.1 Calpain cysteine peptidase 31-97 XP_804989.1 IBMP-8.3 Trans-sialidase 710-754 XP_813237.1 Flagellar repetitive antigen 15-56 AAA30177.1 protein 60 S ribosomal protein L19 236-284 XP_808122.1 Surface antigen 2 (CA-2) 279-315 XP_813516.1 IBMP-8.4 Shed-acute-phase-antigen 681-704 CAA40511.1 Kinetoplastid membrane 76-92 XP_810488.1 protein KMP-11 Trans-sialidase 1436-1449 XP_813586.1 Flagellar repetitive antigen 20-47 AAA30177.1 protein Trans-sialidase 740-759 XP_820062.1 Surface antigen 2 (CA-2) 276-298 XP_813516.1 Flagellar repetitive antigen 1-68 AAA30197.1 protein 60 S ribosomal protein L19 218-238 XP_820995.1 Microtubule-associated 421-458 XP_809567.1 protein [0052] Table B includes intact proteins and the specified amino acid segments.

    [0053] Representative and non-limiting Leishmania antigens include rK39 (UniProt number AOABB9PFHO), rK28, rKR05, rK18, K(39, K28, KR95, and K18/

    [0054] Representative and non-limiting Dirofilaria immitis include D1T33 SEQ ID NO:6 I GenBank accession no. Q27384.1), and PDi33, and OV33.

    [0055] With respect to the presently provided tests, and as will be recognized by those skilled in the art, a variety of antigen and antibody configurations are available for lateral flow testing. FIG. 1 provides three examples wherein, in the top drawing, an Antigen-Antigen configuration is shown. In this configuration, the antigen is attached to a substrate on a test line (and a control antigen is present on a control line, as also shown in the middle and bottom drawings). Antibodies, if present in a biological sample applied to the sample pad and follow through the substrate, bind to the antigen. A detectably labeled antigen is then applied, and a signal from the detectably antigen can be visualized if antibodies to the antigen are present in the sample. In the middle drawing, an Antibody-Antigen configuration is shown. In this configuration, an Ig capture antibody is attached to the substrate. Antibodies to an antigen, if present in the sample, bind to the Ig capture antibody. A detectably labeled antigen is then applied, and a signal from the detectably antigen can be visualized if antibodies to the antigen are present in the sample. In the bottom configuration, an Antigen-Antibody configuration is shown. In this configuration, the antigen is attached to the substrate. Antibodies to an antigen, if present in the sample, bind to the antigen. Detectably labeled Ig antibodies are then applied. If antibodies to the antigen are present in the sample, their presence can be visualized by binding of the detectably labeled antibodies.

    [0056] In the present disclosure, it was unexpectedly determined that only the bottom configuration of FIG. 1 provides sufficient sensitivity to determine the presence or absence of the antibodies. In particular, for the Chagas test as described further below under the Chagas Example, representative Trypanosoma cruzi 1F8, a recombinant antigen that comprises the epitope of the flagellar calcium-binding protein of Trypanosoma cruzi, and LA204, as described further herein, were used as the antigens attached to the substrate. Secondary antibodies, also referred to as detection antibodies because they are detectably labeled, were selected and tested for their capability to recognize four antibody types: Canine IgG, Canine IgM, Feline IgG, and Feline IgM, which are typically the predominant antibody isotypes found in animal samples. The secondary antibodies were Goat antibodies, obtained from Bethyl Laboratories. All samples that were Chagas positive and negative were confirmed as such by IFA prior to conducting the test depicted test. Using the described reagents, three orientations were evaluated for anti-Chagas antibody detection, as shown in FIG. 1. Antigen-antigen, where either 1F8 or LA204 was fixed on a nitrocellulose membrane and also conjugated a gold nanoshell; antibody-antigen, where one of the four secondary antibodies was fixed on the nitrocellulose membrane and either 1F8 or LA204 was conjugated to the nanoparticle; and lastly, antigen-antibody, where either 1F8 or LA204 was fixed to the nitrocellulose and one of the four secondary antibodies was conjugated to the gold nanoparticle. These orientations were tested with a negative and positive sample, and it was identified that the only orientation that showed sufficient sensitivity contained LA204 on the nitrocellulose membrane and the secondary antibody on the gold nanoshell, i.e., the antigen-antibody configuration as shown in the bottom drawing of FIG. 1. Further, it was unexpectedly determined that the Goat anti-Cat IgG and Goat anti-Cat IgM antibodies were successful at detecting both canine and feline antibodies present in the sample, removing the need for the Goat anti-Dog secondary antibodies in the assay. Thus, in certain embodiments, an immunoassay of this disclosure may employ only anti-Cat IgG and Goat anti-Cat IgM antibodies as detection antibodies in a Chagas test, and can be used to determine antibodies from both feline and canine samples. Additionally, based at least in part on the described results obtained using LA204, it is expected that combining LA204 with additional antigens described herein, including but not necessarily one or more IBMP-8 proteins and/or 1F8, will improve sensitivity of the described Chagas assay. Also encompassed by the present disclosure are use of all combinations of at least 2 proteins in the LA204 antigen mixture.

    [0057] It will be recognized from the foregoing that, in certain embodiments, a rapid detection immunoassay system and method is provided for qualitatively detecting the presence or absence of antibodies against a target parasite selected from the group consisting of Trypanosoma cruzi, a Leishmania species, and Dirofilaria immitis. Each of these parasites causes a disease condition in a human or animal, with Trypanosoma cruzi being the parasite causing Chagas disease, a Leishmania parasite being the parasite that cause Leishmaniasis, and Dirofilaria immitis being the parasite that causes Heartworm. In an exemplary embodiment of the invention, a test strip is provided which has a plurality of parallel lanes upon which one or more antigens from a specific parasite can be housed. The antigens may be coated onto the test strip in a number of ways that would be well known to those skilled in the art. These antigens are placed on the strip in a manner that so that the different lanes will contain antigens from one parasite, and each lane with antigens will be different from other lanes containing antigens. In one embodiment, the antigens are prepared in the form of an antigenic composition having subset of antigens with antigens specific to one of the parasites referred to above.

    [0058] In an exemplary method in accordance with the invention, a sample of bodily fluid or other biological matrix from a human or animal patient may be obtained in order to be tested. Such bodily fluid or other biological matrix may be any suitable sample that is readily obtained from a subject, such as during a visit to a doctor or other clinician. Such samples may include blood, serum, saliva, mucus, urine, and other bodily fluids or biological matrices. By biological matrix is meant any substance in the human or animal body that fills a space, e.g., bodily fluids, and such matrices can also include other biological matrices such as an extracellular matrix, a bone matrix, a cartilage matrix, a mitochondrial matrix, a nuclear matrix, and a Golgi matrix. The bodily fluid or other biological matrix sample is then applied to the lanes of the test strip so that the any antibodies in the sample can interact with the antigens on the test strip. By contacting the multiple lanes of the test strip, tests can be carried out to determine the presence or absence of antibodies to multiple parasites at one time. After the sample has had sufficient contact with the test strip so that any antibodies from the sample can interact with antigens on the test strip, the presence or absence of antibodies to one or more target parasites are detected by detecting immunobinding between the antigens on the test strip and the antibodies in the sample. The system detecting the presence of immunobinding can be accomplished in a number of suitable ways that would be recognized by one skilled in the art, including use of markers, signals, or other reagents such as colloidal gold, fluorescent markers, radioactive and non-radioactive isotopes and markers, immunoprecipitation reagents, and other suitable detection materials for qualitatively determining the presence or absence of the target material such as an antibody. This multi-target approach capitalizes in the use of several different antigens for each parasite in order to build-in redundancy and ensure higher sensitivity and specificity of the test.

    [0059] By virtue of the invention, a system and method is thus provided for qualitatively determining the presence or absence of a plurality of diseases caused by one or more of the target parasites identified above.

    [0060] In one embodiment, a method is provided wherein a test strip is provided having parallel lanes coated with an antigenic composition comprising antigens from said target parasite, wherein said antigenic composition is provided in separate antigenic composition subsets wherein each subset contains only antigens from a specific target parasite, wherein each subset contains antigens from a different target parasite, and wherein each subset is coated onto one of said parallel lane on said test strip so that a plurality of tests can be carried out at one time. The method can be carried out by obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject, applying said sample to said lanes of said test strip; and determining the presence or absence of antibodies against the target parasite by detecting immunobinding of antigens within each subset to antibodies against said target parasites.

    [0061] In exemplary embodiments, the antigenic compositions of the invention are based on specific antigens from the target parasites designed to provide highly accurate and sensitive tests that can identify antibodies to the target parasites in a rapid manner, such as during a veterinary or doctor visit, and do so in a manner that reduces false positive and false negative results. The selection of these particular antigens allows for greater precision in the qualitative testing than previously possible, and the present method and also allows for tests of multiple infections at one time.

    [0062] In this regard, antigen compositions and subsets are provided. As also discussed herein, for Trypanosoma cruzi, these antigens may be selected from the group consisting of 1F8, rTc24 (PGR24-His), TcF, SAPA, TSSA, SAPAITSSA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), PEP2, TcD, and TcE, LA204, and an IBMP-8 protein. For a Leishmania parasite, these antigens may be selected from the group consisting of rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18; and for Dirofilaria immitis, these may be selected from the group consisting of ChimDiT33, DIT33, DIT331PDi33, and OV33.

    [0063] In an exemplary embodiment, the antigens from Trypanosoma cruzi can comprise 1F8: epitope of the flagellar calcium-binding protein (natural or recombinant), Tc24 (PGR24-His): fusion protein found across different evolutionary stages of T. cruzi (natural or recombinant), and the TcF antigen containing tandem sequences of different T. cruzi-specific peptides (natural or recombinant), and LA204. For Leishmania species parasites, the antigen may be rK39:-kinesin-like protein highly conserved among viscerotropic Leishmania species (recombinant), or non-recombinant K39. The protein K39 is a repetitive immunodominant epitope in a kinesin-related protein that is highly conserved among viscerotropic Leishmania species and thus can be sensitive and specific for the diagnosis of Leishmaniasis in humans and animals, such as dogs. In Dirofilaria immitis, the antigen may be DIT33:-pepsin inhibitor (recombinant or non-recombinant). Alternatively other antigens can be added.

    [0064] In some embodiments, a combination of antigens is provided including antigens from one or more of the above target parasites, and these combinations maximize testing sensitivity and accuracy. The following combinations may be used in the above system and method, wherein each of the recited combinations may also comprise one or more LA204 and/or one or more IBMP-8 proteins: [0065] a. rK39, SAPAITSSA, and ChimDiT33; [0066] b. Tc24 (PGR24-His), SAPA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), LA204, IBMP-8, and DIT33; and [0067] c. 1F8, LA204, IBMP-8, Tc24, TcF, SAPA, SAPATSSA, RK39, RK28, RKR95, RK18 and DIT33.

    [0068] In other embodiments of the invention, a range of antigens that are used in the antigenic composition may be any suitable number that will provide a qualitative determination of the presence of antibodies against said antigen. Such totals, for example, may be between 1 and 100 antigens for each target parasite, 5 to 50 antigens, or 10 to 20 antigens used in each lane of the test strip. The antigens used in accordance with the invention described herein may be in solutions designed to promote binding of the antigens to antibodies from the sample of bodily fluid or other biological matrix. Such solutions and reagents are well known in immunoassay testing, and the antigens in the testing may be employed in appropriate concentrations and volumes, e.g., 25 to 50 L, with additional examples being provided below.

    [0069] In an exemplary embodiment, a rapid detection immunoassay method is provided for qualitatively detecting the presence or absence of antibodies against a target parasite selected from the group consisting of Trypanosoma cruzi, a Leishmania parasite, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, said method comprising (a) providing an antigenic composition comprising antigens from a plurality of said target parasites; (b) separating said antigenic composition to form a plurality of antigenic composition subsets, wherein each subset contains only antigens from a single target parasite, and wherein each subset contains antigens from a different target parasite; (c) transferring each of said subsets onto test strips, said test strips having a plurality of parallel lanes, said transferring conducted so as to generate a test strip having separate lanes for each antigenic composition subset so that said test strip is capable of performing an immunoassay of a plurality of a target parasites at the same time; (d) obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject; (e) applying said sample to said lanes of said test strip; and determining the presence or absence of antibodies against the target parasite by detecting immunobinding of antigens within each subset to antibodies against said target parasites.

    [0070] In accordance with the disclosure, the antigens used in the herein system and method can be any antigenic components that are recognized by antibodies to the target parasites as set forth above. These antigens may be selected from the group consisting of proteins, protein fragments and epitopes, glycans, and peptides. The antigen may also be a blood stage (soluble) or viscerotropic/cardiotropic (tissue-bound) antigen.

    [0071] In an exemplary embodiment of the invention, the test strips can comprise a nitrocellulose membrane and can be prepared and aligned by establishing a reference line for orientation on a blotter before said antigens are applied to said nitrocellulose membranes. In the above method, separation of the antigenic compositions into the plurality of antigenic composition subsets may be carried out by electrophoresis under denaturing conditions.

    [0072] With regard to the antigens of the invention as described above, these will include antigens that have had their amino acid chain sequenced. Examples of these antigen sequences include sequences for rK39 (SEQ ID NO:1), SARA (SEQ ID NO:2), TSSA (SEQ ID NO:3), FRA (SEQ ID NO:4), B13 (SEQ ID NO:5), and DIT33 (SEQ ID NO:6).

    [0073] In another embodiment of the invention, a rapid detection immunoassay method of qualitatively detecting the presence or absence antibodies against a target parasite selected from the group consisting of T. cruzi, Leishmania species, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject is provided which comprises (a) providing an antigenic composition comprising antigens from said target parasite; (b) separating said antigenic composition to form separate antigenic composition subsets by electrophoresis, wherein each subset contains only antigens from a specific target parasite, and wherein each subset contains antigens from a different target parasite; (c) transferring said antigenic composition onto nitrocellulose membrane strips in parallel lanes to generate membranes pre-coated with said antigenic composition so that each lane contains an antigenic composition subset; (d) obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject; (e) applying said sample to said lanes of said nitrocellulose membrane strip; and (f) determining the presence of antibodies against the target parasite by detecting immunobinding of antigens within each subset to antibodies against said target parasites. The antigenic composition may include antigens from Trypanosoma cruzi selected from the group consisting of 1F8, rTc24 (PGR24-His), TcF, SAPA, TSSA, SAPA/TSSA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), PEP2, TcD, TcE, LA204, and IBMP-8 proteins; antigens from a Leishmania parasite selected from the group consisting of rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18; and antigens from Dirofilaria immitis selected from the group consisting of ChimDiT33, DIT33, DIT33/PDi33, and OV33.

    [0074] In yet another embodiment of the present method, a rapid qualitative detection immunoassay method is provided for detecting the presence or absence of antibodies against a target parasite selected from the group consisting of T. cruzi, Leishmania parasites, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, said method comprising: (a) providing a test strip having parallel lanes coated with an antigenic composition comprising antigens from said target parasite, wherein said antigenic composition is provided in separate antigenic composition subsets wherein each subset contains only antigens from a specific target parasite, wherein each subset contains antigens from a different target parasite, and wherein each subset is coated onto one of said parallel lane on said test strip so that a plurality of tests can be carried out at one time; (b) obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject; (c) applying said sample to said lanes of said test strip; and (d) determining the presence or absence of antibodies against the target parasite by detecting immunobinding of antigens within each subset to antibodies against said target parasites.

    [0075] In another exemplary embodiment., a system is provided for a rapid detection immunoassay that qualitatively detects the presence or absence of antibodies against a target parasite selected from the group consisting of Trypanosoma cruzi, a Leishmania parasite and Dirofilaria immitis, as determined from a bodily fluid or other biological matrix from a human or animal subject, said system comprising (a) a test strip having parallel lanes coated with an antigenic composition comprising antigens from said target parasite, wherein said antigenic composition is provided in separate antigenic composition subsets wherein each subset contains only antigens from a specific target parasite, wherein each subset contains antigens from a different target parasite, and wherein each subset is coated onto one of said parallel lane on said test strip so that a plurality of tests can be carried out at one time; (b) a sample of a bodily fluid or other biological matrix from a human or animal subject that can be applied to said test strip; (c) immunobinding detection reagents in each lane of said test strip which provide a signal that indicates immunobinding of the antigens when the sample contains antibodies against the target parasite; and (d) a detection zone on said test strip wherein the signal indicative of immunobinding between the antigens on the test strip and antibodies against said target parasites can be observed. The antigens from Trypanosoma cruzi used in this system may be selected from the group consisting of 1F8, rTc24 (PGR24-His), TcF, SAPA, TSSA, SAPA/TSSA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), PEP2, TcD, TcE, LA204 and an IBMP-8 protein; the antigens from a Leishmania parasite may be selected from the group consisting of rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18; and the antigens from Dirofilaria immitis are selected from the group consisting of ChimDiT33, DIT33, DIT33/PDi33, and OV33. Particular combinations of antigens may be used in this system whereby each combination includes at least one antigen from each parasite being tested. Examples of such combinations of antigens may include (a) rK39, SAPA/TSSA, and ChimDiT33; (b) Tc24 (PGR24-His), SAPA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA) and DIT33; or (cc) 1F8, Tc24, TcF, SAPA, SAPA/TSSA, RK39, RK28, RKR95, RK18 and DIT33. These antigens may be recombinant or non-recombinant, and can be any antigen or antigen fragment capable of binding to an antibody from one of the target parasites, such as proteins, protein fragments or epitopes, glycans, and peptides.

    [0076] A variety of test strip systems well known in the immunoassay art may be used in the method and system described herein, such as membrane test strips made out of nitrocellulose. The test strips may also be any of a wide range of commercially available test strips that are set up to include a wide variety of test strip reagents and modes of detection. In one system, the immunoassay may comprise a nitrocellulose membrane tests strip that includes a reference line for orientation on a blotter. The test strip will generally contain a number of antigens specific to each of said target parasites, and the antigens will be in suitable numbers so that they will be recognized and will exhibit immunobinding with the respective target parasite antibodies in the bodily fluid or other biological matrix being tested. Such a system is suitable for a wide variety of immunoassay methods and devices including lateral flow immunoassays, multiple antigen blot immunoassays, cross-blot immunoassays, direct or indirect Enzyme-linked immunosorbent assays (ELISA), enzymatic immunoassays, sandwich immunoassays, electrochemilumescence immunoassays, dipstick immunoassays, and radioisotope immunoassays . . . .

    [0077] As indicated above, the test strip of the invention may comprise any suitable test strip commonly used in immunoassay procedures and apparatuses that would be well known to one skilled in the art. The test strip is used for qualitatively determining the present or absence of antibodies against a target parasite selected from the group consisting of Trypanosoma cruzi, a Leishmania parasite and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, and the test strip will generally include parallel lanes coated with an antigen from each of said target parasites, with the antigens configured so that there is a different antigen specific to a particular target parasite in each lane. The antigens may be provided in the form of an antigenic composition which is separated to form antigenic composition subsets, each of which contains antigens from only one of said target parasites. These antigen subsets may be configured on the test strip so that a particular lane will include antigens from only one of said target parasites, and each lane will contain antigens that are different from each other. In one embodiment, the test strip will have a plurality of lanes wherein one lane will contain antigens only from Trypanosoma cruzi, one lane will include only antigens from a Leishmania parasite, and one lane will contain antigens only to Dirofilaria immitis. Other configurations are possible wherein the test strip will include antigens from fewer than all three of the target parasites, including combinations of any two of the parasites, or a single parasite individually.

    [0078] In another exemplary embodiment, the test strip contains on or more antigenic subsets rom a specific target parasite, and in the case where multiple target parasites are included, each subset will contains antigens from a different target parasite, and each subset will be coated onto one of said lanes on said test strip so that a plurality of tests can be carried out at one time. As indicated herein, the test strips of the invention may contain antigens from Trypanosoma cruzi selected from the group consisting of 1F8, rTc24 (PGR24-His), TcF, SAPA, TSSA, SAPA/TSSA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), PEP2, TcD, TcE, LA204, and an IBMP-8 protein; antigens from a Leishmania parasite selected from the group consisting of rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18; and/or antigens from Dirofilaria immitis selected from the group consisting of ChimDiT33, DIT33, DIT33/PDi33, and OV33. In specific combinations of antigens from the various target parasites, such combination of antigens may include (a) rK39, SAPA/TSSA, and ChimDiT33; (b) Tc24 (PGR24-His), SAPA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA) and DIT33; and (c) 1F8, LA204, Tc24, an IBMP-8 protein, TcF, SAPA, SAPA/TSSA, RK39, RK28, RKR95, RK18 and DIT33. Such antigens may also be one or more of the specific sequences SEQ ID NOs:1-6 as included herein.

    [0079] In another embodiment, a rapid detection immunoassay test kit for qualitatively detecting the presence or absence of antibodies against a target parasite selected from the group consisting of T. cruzi, Leishmania species and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, wherein the test kit comprises (a) a test strip having parallel lanes coated with an antigenic composition comprising antigens from said target parasite, wherein said antigenic composition is provided in separate antigenic composition subsets wherein each subset contains only antigens from a specific target parasite, wherein each subset contains antigens from a different target parasite, and wherein each subset is coated onto one of said parallel lane on said test strip so that a plurality of tests can be carried out at one time; (b) immunobinding detection reagents in each lane of said test strip which provide a signal that indicates immunobinding of the antigens when the sample contains antibodies against the target parasite; and (c) a detection zone on said test strip wherein the signal indicative of immunobinding between the antigens on the test strip and antibodies against said target parasites can be observed.

    [0080] In another embodiment, a method is provided for diagnosing an infection caused by a parasite selected from the group consisting of T. cruzi, Leishmania parasites, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, said method comprising: (a) providing a test strip having parallel lanes coated with an antigenic composition comprising antigens from said target parasite, wherein said antigenic composition is provided in separate antigenic composition subsets wherein each subset contains only antigens from a specific target parasite, wherein each subset contains antigens from a different target parasite, and wherein each subset is coated onto one of said parallel lane on said test strip so that a plurality of tests can be carried out at one time; (b) obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject; (c) applying said sample to said lanes of said test strip; and (d) diagnosing the infection by determining the presence or absence of antibodies against the target parasite by detecting immunobinding of antigens within each subset to antibodies against said target parasites.

    [0081] Still a further embodiment of the invention is a method of determining whether a human or animal subject has a disease condition selected from the group of Chagas disease, Leishmaniasis, and Heartworm, said method comprising: (a) providing a test strip having parallel lanes coated with an antigenic composition comprising antigens from parasites that cause said disease conditions, wherein said antigenic composition is provided in separate antigenic composition subsets wherein each subset contains only antigens from a specific parasite causing one of said disease condition, wherein each subset contains antigens from only said specific parasite, and wherein each subset is coated onto one of said parallel lane on said test strip so that a plurality of tests can be carried out at one time; (b) obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject; (c) applying said sample to said lanes of said test strip; and (d) determining whether the human or animal subject has a disease condition selected from the group of Chagas disease, Leishmaniasis, and Heartworm by detecting the presence or absence of antibodies against said specific parasites causing said disease conditions, said presence or absence determined by detecting immunobinding of antigens within each subset to antibodies against said specific parasites.

    [0082] In another embodiment, a rapid detection immunoassay method is provided for qualitatively detecting the presence or absence of antibodies against a target parasite selected from the group consisting of T. cruzi, a Leishmania parasite, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, said method comprising: (a) providing a test strip comprising a plurality of lanes, wherein each lane in said plurality of lanes contains an antigen from a specific target parasite, and each of said lanes contains an antigen from a different target parasite; (b) obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject; (c) applying said sample to the plurality of lanes of said test strip; and (d) determining the presence of antibodies against the target parasite by detecting immunobinding of antigens within each subset to antibodies against said target parasites; Also provided is a rapid detection immunoassay for qualitatively detecting the presence or absence of antibodies against a target parasite selected from the group consisting of Trypanosoma cruzi, a Leishmania parasite, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, said immunoassay comprising: (a) a test strip comprising a plurality of lanes, wherein each lane in said plurality of lanes contains an antigen from a specific target parasite, and each of said lanes contains an antigen from a different target parasite; and (b) a sample of a bodily fluid or other biological matrix from a human or animal subject that can be applied to said test strip so that the presence of antibodies against the target parasite can be determined by virtue of immunobinding between said antigens and said antibodies; wherein the antigen from Trypanosoma cruzi is selected from the group consisting of 1F8, rTc24 (PGR24-His), TcF, SAPA, TSSA, SAPA/TSSA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), PEP2, TcD, TcE, LA204 and an IMBP-protein, wherein the antigen from a Leishmania species is selected from the group consisting of rK39, rK28, rKR95, rK18, K39, K28, KR95, and K18; and wherein the antigen from Dirofilaria immitis is selected from the group consisting of ChimDiT33, DIT33, DIT33/PDi33, and OV33.

    [0083] In certain embodiments of the present detection method is carried out using a Lateral flow assay (LFA) which provides multiple diagnostic assays for various parasites of veterinary/human concern. The method of detection using the antigenic composition of the present invention is normally carried out by conducting in vitro assay using the antigens of the invention for the detection of one or more of the target parasitic pathogens as described herein, and the assays can also be repurposed for other immunoassay methods as needed. Given the multifaceted life cycles of the parasites Trypanosoma cruzi, Leishmania species pathogens, and Dirofilaria immitis and the occurrence of multiple developmental stages with different and complex antigenic makeups for each stage, the present invention involves selecting a specific antigen array comprising a mixture of at least one recombinant antigen known to be present through all stages of infection for each parasite in order to increase yield of detection, particularly in pre-patent and latent stages of infection.

    [0084] As a result, in accordance with the invention, an immunoreactive antigenic composition suitable for detecting the different life stages of Trypanosoma cruzi, Leishmania species such as Leishmania infantum, and Dirofilaria immitis, is provided which includes the combination of the antigen Tc24 from Trypanosoma cruzi, of the antigen K39 from a Leishmania parasite, and DIT33 from Dirofilaria immitis. These antigens are thus useful in identifying and diagnosing the diseases caused by these parasites. For example, Chagas disease, otherwise known as American trypanosomiasis, may be diagnosed using one or more antigens to Trypanosoma cruzi such as Tc24 which can be utilized as a pan-stage marker in the present antigen repertoire. Tc24 is a 24-kDA protein of the T. cruzi parasite that is found across all developmental stages of the parasite, specifically in the flagella of trypomastigotes (infectious stage) and epimastigotes (vectorbound stage). With regard to the disease visceral leishmaniasis, one of the antigens used in accordance with the invention is K39, a large kinesin-related protein expressed predominantly by amastigotes (intracellular form of the parasite in the mammalian host). With regard to Heartworm infection, the invention may include the antigen DIT33/PDi33 from Dirofilaria immitis, a homologue of the aspartyl protease inhibitor (0v33) of the related parasite Onchocerca volvulus. DIT33 is also a pan-stage marker present across all stages of the parasite in the mammalian host (microfilariae, L3, L4, adult males, and females). As a result of the fact that certain antigens are found across all life stages of these parasites makes the antigens as described herein particularly useful in identifying antibodies to the parasites at multiple life stages of the parasite life cycle.

    [0085] The antigens used in the present invention can be obtained from a variety of sources, including well known commercially available sources where these antigens may be purchased. Alternatively, it is also possible to generate the antigens used in the invention by culturing transformed cells with an expression vector (e.g., recombinant DNA or other nucleic acid) encoding for each and every one of the antigens provided herein. These generation methods allow for the expression and purification of individual antigens so as to then generate the antigen composition that will be used in the immunoassay methods, systems, and devices of the present invention as described herein.

    [0086] For example, there are several commercially available sources of the antigens of the present invention such as reflected below: [0087] K39: https://www.rekombiotech.com/en/antigens/humans/k39 [0088] r1F8: https://www.creative-diagnostics.com/Recombinant-Trypanosoma-Cruzi-1F8-25-8-kDa-His-tagged-4315-407.htm [0089] TcF: https://www.creative-diagnostics.com/Active-T-cruzi-Chagas-TcF-protein-176190-407.htm [0090] DIT33: https://www.creative-biolabs.com/vaccine/recombinant-canine-heartworm-Dirofilaria-immitis-dit33-protein-aa-18-234-28438.htm [0091] OV33: https://www.bio-connectnVproteins-signaling-moleculelimmunodominant-antigen-ov33-3-recombinant-protein-onchocerca-volvulus/opca51067/sfid/10496061 [0092] https://www.hoelze biotech.com/en/cusabio-proteins-other-csb-ep324156oeg-recombinant-immunodominant-antigen-ov33-3.html

    [0093] The present disclosure includes the design of a qualitative, membrane based immunoassay for detecting Trypanosoma cruzi, Leishmania species such as Leishmania infantum and Dirofilaria immitis in canine serum and whole-blood matrices by applying various antigens for each parasite in order to increase sensitivity and specificity. As indicated herein, there are many forms of immunoassay that may be utilized in accordance with the invention, and exemplary modalities for carrying out the present diagnostic method would include (1) Lateral flow immunoassay; (2) Multiple antigen blot assay; and (3) Enzyme-linked immunosorbent assay (ELISA).

    [0094] In one exemplary example, the present immunoassay system and method as described herein may include a first testing modality comprising the use of a membrane, such as a nitrocellulose membrane, that is pre-coated with the antigens (recombinant or non-recombinant) as described herein. These antigens may be arrayed and lined up in different test line regions with separate controls to ensure assay flow and performance. This method also may include an immunoreactive composition of said antigens and a suitable stabilizing and conjugate solution. In an exemplary method, both the bodily fluid or other biological matrix being tested, such as blood serum, and the immunobinding conjugate are placed in a sample pad creating an admixture that migrates by capillary action through the membrane to react with the antigens on the membrane. If antibodies from the target parasites are present as would be detected by immunereactivity to any of the target antigens, the test line will display a signal, such as immunofluorescence of a colorimetric reaction, and this signals the presence of antibodies against the target antigen in the bodily fluid or other biological matrix sample.

    [0095] A second testing modality may comprise the simultaneous screening of said antigens using a dot immunobinding assay which comprises lining up the antigen repertoire on a nitrocellulose membrane reformatted into a dipstick immunoassay format. It is also possible to include a third modality which would be in proper format for an Enzyme-linked immunosorbent assay (ELISA).

    [0096] In one exemplary embodiment, a method is provided for qualitative, membrane-based immunobinding assay testing for the detection of antibodies against Trypanosoma cruzi, Leishmania species, and Dirofilaria immitis both in serum and whole blood matrices. In such a method, recombinant antigens and/or peptides obtained from known sequences of Trypanosoma cruzi, Leishmania sp., and Dirofilaria immitis synthetized by various methods are separated by electrophoresis under denaturing conditions and electro transferred or transferred by diffusion onto nitrocellulose membrane strips (using the cross-blot method) in parallel lanes to generate membranes pre-coated with recombinant antigens/peptides. In one such method, nitrocellulose membranes are prepared and aligned by establishing a reference line for orientation on the blotter before being sensitized with the said antigens. In the general case, a range of antigens, such as 1-to-600, 5-to-50, or 10-to-20 antigens can be tested simultaneously on each membrane. Using the composition of specific antigens in accordance with the invention overcomes the disadvantages of previous approaches using single target antigens by providing testing redundancy. In addition, this novel composition (based on an admixture of antigens) targeting multiple parasites of interests is comparable or superior in terms of specificity, sensitivity and reproducibility for detection of Trypanosoma cruzi, Leishmania sp and Dirofilaria immitis, and thus the diseases associated with these parasites, respectively Chagas disease, Leishmaniasis, and Heartworm.

    [0097] As provided below, the sensitivity and specificity of some of the antigens used in the invention are shown in the charts below:

    Leishmania sp:

    TABLE-US-00003 Antigen Sensitivity Specificity rK39 97.3% 100% rK28 95.9% 100% rKR95 95.9% 100% rK18 89.10% 98.60%
    Trypanosoma cruzi:

    TABLE-US-00004 Antigen Sensitivity Specificity SAPA 86.80% 100% SAPA/TSSA 94.70% 100% FRA, B13, MACH (PEP2, 99.60% 97.50% TcD, TcE, SAPA)

    [0098] In one embodiment of the above antigens, the antigen combination SAPA/TSSA VI has been shown to have a significant reactivity (95%) in dog sera.

    Dirofilaria immitis:

    TABLE-US-00005 Antigen Sensitivity Specificity ChimDiT33 Not determined Not determined

    REFERENCES

    [0099] Additionally, specific embodiments of the present invention may include compositions that comprise the following combination/admixture of antigens: rK39, SAPA/TSSA, ChimDT33 embracing a single antigen for each parasite.

    [0100] A further embodiment is a composition comprising: Tc24 (PGR24-His), SAPA, SAPA/TSSA, FRA, B13, MACH (PEP2, TcD, TcE, SAPA), LA204, and a IBMP-8 protein, and DIT33 restricted to the cardiotropic parasites Trypanosoma cruzi and Dirofilaria immitis.

    [0101] In yet another embodiment the composition consists of the following broad panel of antigens: 1F8, Tc24, TcF, SAPA, SAPA/TSSA, RK39, RK28, RKR95, RK18, DIT33, LA204, and an IBMP-8 protein.

    [0102] In another exemplary embodiment, the immunoassay may be a cross-blot system (apparatus) that is built for commercial scale and which is used for delivery of an antigen preparation (membrane sensitizationincubation). A series of effective antigenic concentrations may be prepared to ensure the antigens will bind with antibodies from said target parasites, with such concentrations ranging from 10 to 100 uL, or amounts within this range such as 20 to 80 UI or 25 to 50 uL, of each antigenic preparation can be transferred (blotted) onto the membrane and incubated for a suitable period, e.g., 30-90 minutes or 45-60 minutes followed by washing by a suitable wash solution, such as PBS-0.05%, Tween 200, and blocking with a suitable blocking solution (such as 5% non-fat milk in PBS-0.05% Tween 20) for a suitable period of time, e.g., 1-3 hours, or approximately 2 hours. The membranes may subsequently be washed by a suitable immunoassay wash solution (e.g., PBS-0.05% Tween-20) for a suitable time (e.g., 3 for 10 minutes) and incubated for suitable conjugation period, e.g., 30 to 90 minutes, or about 60 minutes, using standard conjugation methods and revealed to assess reactivity of the assayed sera.

    [0103] For use in lateral flow, dipstick-based diagnostic format a blend of stable liquid conjugate along with the tested sera will react with the said composition of antigens which will appear as positive test lines for the specific parasite(s) present, shortening the time to 15 to 25 minutes total test time.

    [0104] Another aspect of this disclosure is that this composition of antigens can be used to improve any format of detection immunoassays for the detection of anti-T. cruzi, anti-Leishmania sp and anti-Dirofilaria independently of the method of detection (enzyme immunoassay, electrochemilumescence assay or radioisotope) as well as the format for testing (ELISA direct/indirect, sandwich, or test strip).

    [0105] In another aspect of the disclosure, a device is provided for conducting an immunoassay of antibodies against a target parasite selected from the group consisting of T. cruzi, a Leishmania parasite, and Dirofilaria immitis in a bodily fluid or other biological matrix from a human or animal subject, said device comprising a nitrocellulose membrane having strips in parallel lanes that are pre-coated with an antigenic composition comprising two or more antigens as described herein; wherein each of said lanes contains an antigenic composition exclusively obtained from one of said target parasites, and provides a surface for receiving a sample of bodily fluid or other biological matrix from a human or animal subject; and wherein said nitrocellulose membrane further comprises detection reagents that detect binding between an antibody to a target parasite located in said bodily fluid or other biological matrix sample so as to qualitatively detect antibodies to the target parasite in said sample when said binding is detected. The device may include detection reagents or other detection materials that generate a signal when binding of the antigen to an antibody is detected. The signal is selected from the group consisting of a colorimetric signal, a fluorescent signal, a chemiluminescent signal, a radioactive signal, and a visual signal.

    [0106] In yet another exemplary method, an antigenic composition is provided comprising recombinant antigens, peptides, or mixtures thereof obtained from known sequences of T. cruzi, Leishmania sp and Dirofilaria immitis. This antigenic composition may be separated by electrophoresis under denaturing conditions and electrotransferred or transferred through other suitable means, wherein said antigenic composition is transferred onto nitrocellulose membrane strips in parallel lanes to generate membranes pre-coated with said antigenic composition so that each lane contains an antigenic composition exclusively comprised of recombinant antigens, peptides, or mixtures thereof from a single target parasite. The testing may be conducted by obtaining a sample of a bodily fluid or other biological matrix from a human or animal subject, such as a dog or other pet susceptible to one or more of the target parasites, and applying the sample to the lanes of said nitrocellulose membrane strip, and the presence or absence of antibodies to the target parasite in the bodily fluid or other biological matrix sample is determined by detecting the immunoassay binding of the antigens in the antigenic composition with immunobinding antibodies from said target parasite which reflect exposure to the human or animal subject to one of the target parasites and the diseases associated with the respective parasites.

    EXAMPLES

    [0107] The following Examples are intended to illustrate but not limit the disclosure. In assays described in these examples, detectably labeled goat serum may be 5%-10% of the volume of a mixture that is applied to a test strip. In embodiments, the sample is allowed to contact the test line antigen prior to application of the labeled detection antibodies. In embodiments, a NaCl concentration in which goat serum is used is more than 1.2M. In embodiments, the NaCl concentration in goat serum is 2.4M, or at least 2.4M. Other components used in the assays can comprise MgCl2, dextran, and sodium citrate.

    Chagas Example

    [0108] For Chagas, the antigen attached to the substrate was LA204 at 1.0 mg/mL. The substrate was a MD1150 nitrocellulose membrane. The running buffer was 150 mM Tris, 0.8PBS, 0.4% PVP40, 15 mM EDTA, 0.2% Casein, 0.5% BSA, 1% Tergitol, 0.02% Sodium Azidein a 80 L volume. The sample loading was 10 L sample chased with 15 L RB. The reading window is about 37-53 mm within a 25 mm segment of the strip. The nitrocellulose membrane is flanked by a buffer pad, a sample pad, and a filter pad on the sample loading side, and a wick pad at the end of the flow direction. The entire length of the strip is 80 mm. A mixture of Goat anti-Cat IgG/Goat anti-Cat IgM serum was used. The conjugate nanoparticle on the detection antibodies is 150 nm GNS COOH. The control is Streptavidin 40s conjugated goat serum and Blue Dye; biotinylated BSA is attached to the substrate. The sample contained canine or feline serum. The sample comprised 10 uL Sample, 85 uL Buffer. The general sample conditions are shown in FIG. 2. All negative samples and positive samples were confirmed to be Chagas negative or positive, respectively, by IFA prior to the lateral flow strip tests. A representative result for a Chagas negative sample is shown in FIG. 3, panel A. A representative result for a Chagas positive sample is shown in FIG. 3, panel B.

    [0109] Positive and negative results consistent with the IFA-predetermined status for Chagas were obtained for both canine and feline samples using the Goat anti-Cat IgG/Goat anti-Cat IgM. Thus, this Example demonstrates that use of Goat anti-Cat IgG/Goat anti-Cat IgM is sufficient for determining positive and negative results for both canine and feline subjects. Sensitivity of 50% was achieved using 18 positive and 12 negative samples. The disclosure includes increasing sensitivity of this assay by combining the LA204 antigens with at least one additional antigen, such as an IBMP-8 antigen, or a 1F8 antigen. The disclosure also includes increasing sensitivity by combining least one of an IBMP-8 protein with at least one of 1F8, Tc24, SAPA, B13, PEP2, FRA, TSSA, TcD, TcF, or TcE.

    Heartworm Example

    [0110] For heartworm, conditions were similar to the Chagas assay. 0.5 mg/mL Dit33 was applied to the strip at 0.08 uL/mm. The running buffer was 150 mM Tris, 0.8PBS, 0.4% PVP40, 15 mM EDTA, 1% Tergitol, 0.02% Sodium Azide, pH 8.1-8.2. The sample buffer was 150 mM Tris, 0.8PBS, 0.4% PVP40, 15 mM EDTA, 1% Tergitol, 1.2M NaCl, 0.02% Sodium Azide, pH 8.1-8.2. 10 uL Sample in 85 uL Buffer was used. A representative table of assay components is shown in FIG. 4. Positive and negative results were obtained from feline and canine samples.

    Leishmania Example

    [0111] For Leishmania, general conditions were similar to heartworm. The antigen was rK39 at 0.25 mg/mL. The running buffer comprised 150 mM Tris, 0.8PBS, 0.4% PVP40, 15 mM EDTA, 0.2% Casein, 0.5% BSA, 1% Tergitol, 0.02% Sodium Azide, pH 8.1-8.2. Positive and negative results were obtained from feline and canine samples. A representative table showing Leishmania assay conditions is provided in FIG. 5, wherein the sample buffer comprises 2.4M NaCl. Positive and negative results were obtained from feline and canine samples.

    TABLE-US-00006 SEQUENCES: rK39 >tr|A0A6B9PFH0|A0A6B9PFH0_LEIINKinesin-likeprotein(Fragment)OS=Leishmania infantumOX=5671PE=4SV=1 [SEQIDNO:1] ELATEWEDALRERALAERDEAAAAELDAAASTSQNARESACERLTSLEQQLRDSEER AAELASQLESTTAAKMSAEQDRESTRATLEQQLRESEERAAELASQLESTTAAKMSAE QDRESTRATLEQQLRDSEERAAELASQLESTTAAKMSAEQDRESTRATLEQQLRESE ARAAELAS SARA >tr|Q00773|Q00773_TRYCRShed-acute-phase-antigenOS=Trypanosomacruzi OX=5693GN=SAPAPE=4SV=1 [SEQIDNO:2] MGRTVVGASRMFWLTHFVPLLLALCPSEPAHALAPGSSRVELFKRQNSTVPFEENGE VRQRVVHSFRLPALVNVDGVMVAIADARYDTSNDNSLIDTVVKYSVDDGETWETQIAIK NSRASSVSRVVDPTVIVKGNKIYVLVGSYNSSTSYWTSHGDARDWDILLAVGEVTKSIV DGKTTANITWGSPVSLKEFFPAYMEGMHTNQFLGGAGVAIVASNGNLVYPVQVTNKR KQVFSKIFYSEDDGKTWKFGKGRSDFGCSEPVALEWEGKLIINTRVDYRRRLVYESSD TEKPWVEAVGTLSRCWGPSPKSDQPGSQSSFTAVTIEGMRVMLFTHPLNFKGWWLR DRLNLWLTDNQRIYNVGQLSIGDENSAYSSVLYKDDKLYCLHEINSNEVYSLVFARLVG ELRIIKSVLQSWKKWDSHLSSICTPADPAASSSERVCGPAVTTVGLAGFLSHSANKTK WKDAYRCVDASTANAERVSNGLKFAGVGGGALWPVSQQGQNQRYRFANHAFTLVA SVTIHEAPSVASPLLGASLDSSGGKKLLGLSYDEKHQWQPIYGSTPVTPTGSWETGKR YHVVLTMANRNGSVYVDGELLKGSGQTWVPDRTPDISHFYVGGYGRSDMPTISHVTV NNVLLYNRQLNAEEIKTLFLSQDLIGTEAHMDSSSDSSAHGTPSTPVDSTAHGTPSTPA DSSAHSTPSTPADSSAHSTPSTPVDSSAHSTPSTPADSSAHSTPSTPADSSAHSTPST PVDSTAHGTPSTPADSSAHSTPSTPVDSSAHSTPSTPADSSAHSTPSTPVDSSAHSTP STPADSSAHGTPSTPVDSSAHSTPSTPADSSANGTVLILPDGAALSTFSGGGLLLCAC ALLLHVFFTAVFF TSSA >tr|D0VAW4|D0VAW4_TRYCRTrypomastigotesmallsurfaceantigen(Fragment) OS=TrypanosomacruziOX=5693GN=TSSAPE=4SV=1 [SEQIDNO:3] MTTCRLLCALLALALCCCLXACTTANGGSTXSTPPSGTENKPAXGEAPSQPGASSGEA EASS FRA >tr|Q26921|Q26921_TRYCRFlagellarrepetitiveantigen(FRA)protein(Fragment) OS=TrypanosomacruziOX=5693PE=4SV=1 [SEQIDNO:4] MEQERRQLLEKDPRRNAKEIAALEESMNARAQELAREKKLADRAFLDQKPERVPLAD VPLDDDSDFVA B13 >tr|Q7YZF5|Q7YZF5_TRYCRB13antigen(Fragment)OS=Trypanosomacruzi OX=5693PE=4SV=1 [SEQIDNO:5] PPPFGQAAAGDKPSPFGQAAAGDKPPPFGQAAAGDKPSPFGQAAAGDKPPPFGQAA AGDKPSPFGQAAAGGKPPPFGQAAAGDKPSPFGQAAAGDKPPPFGQAAAGDKPSPF GQAAAGDKPPPFGQAAAGDKPPPFGQAAEGDKPPPFGQAAAGDKPAPFGQAAEGD KPPPFGQAAAADKPSLFGQAAAGDKLSLFGQAAAGDKPPPFGQAAEGDKPPPFGQA AAGD DIT33 >sp|Q27384|API_DIRIMPepsininhibitorDit33OS=Dirofilariaimmitis OX=6287GN=DIT33PE=2SV=1 [SEQIDNO:6] MKILFCFVLLAIAALRASVINRHNKRFAGFSVAGIGGTAGCVVVDNKLFANSFYLRDLTT EEQRELAQYVEDSNQYKEEVKTSLEERRKGWQLARHGEKDAKVLSSLAEKKFPKPPK KPSFCSAGDTTQYYFDGCMVQNNKIYVGRMYVRDLTSDEINQLKTFDAKMTAYQKYL SSSIQQQVDSLFGDKSNLFNLFTDTRHETSSQPSDATTISTTTQAPVEPPETPHFCIAIY