N-acetylated sialic acids and related sialosides
12162901 ยท 2024-12-10
Assignee
Inventors
- Xi Chen (Davis, CA)
- An Xiao (Davis, CA, US)
- Anoopjit Kooner (Davis, CA, US)
- Abhishek Santra (Davis, CA, US)
- Ajit Varki (San Diego, CA, US)
- Hai Yu (Davis, CA, US)
- Lee-Ping Wang (Davis, CA, US)
- Wanqing Li (Davis, CA, US)
Cpc classification
C07H15/04
CHEMISTRY; METALLURGY
C07H15/12
CHEMISTRY; METALLURGY
C12P19/64
CHEMISTRY; METALLURGY
C07H15/14
CHEMISTRY; METALLURGY
C12P19/44
CHEMISTRY; METALLURGY
International classification
C07H15/04
CHEMISTRY; METALLURGY
C07H15/12
CHEMISTRY; METALLURGY
C07H15/14
CHEMISTRY; METALLURGY
C07H15/203
CHEMISTRY; METALLURGY
C12P19/44
CHEMISTRY; METALLURGY
Abstract
The present invention provides N-acetyl derivatives of sialic acids, including N-acetyl derivatives of Neu5Ac and Neu5Gc. Methods for preparing related precursors and a variety of sialosides are also disclosed.
Claims
1. A compound according to Formula IVa: ##STR00092## wherein: R.sup.1 is NHAc; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, NH.sub.2, and OH; wherein at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc or NH.sub.2; R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc; R.sup.5 is selected from the group consisting of Ac, Gc, GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; Ac is C(O)CH.sub.3; Gc is C(O)CH.sub.2OH; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3; and R.sup.6 is selected from the group consisting of a galactoside, an N-acetylgalactosaminide, a glucoside, an N-acetylglucosaminide, and a sialoside.
2. The compound of claim 1, wherein R.sup.6 is present as a member of an oligosaccharide or a polysaccharide.
3. The compound of claim 1, wherein at least one of R.sup.2, R.sup.3, and R.sup.4 is OH.
4. The compound of claim 3, wherein R.sup.5 is NHR.sup.5a.
5. The compound of claim 4, wherein R.sup.5a is Ac or Gc.
6. A method for sialylating a glycoprotein, a glycolipid, or a cell surface, the method comprising combining the glycoprotein, glycolipid or cell with a compound according to claim 5 under conditions sufficient to covalently bond the compound to the glycoprotein, glycolipid, or cell surface, wherein combining the glycoprotein or glycolipid with the compound according to claim 5 comprises forming a mixture comprising the glycoprotein or glycolipid, the compound, and a sialyltransferase, wherein combining the cell with the compound according to claim 5 comprises culturing the cell in the presence of the compound.
7. A compound according to Formula IVa: ##STR00093## wherein: R.sup.1 is NHAc; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, NH.sub.2, and OH; R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc; R.sup.5a is selected from the group consisting of Gc, GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; Ac is C(O)CH.sub.3; Gc is C(O)CH.sub.2OH; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3; and R.sup.6 is selected from the group consisting of a galactoside, an N-acetylgalactosaminide, a glucoside, an N-acetylglucosaminide, and a sialoside.
8. A compound according to Formula IVa: ##STR00094## wherein: R.sup.1 is OH; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, NH.sub.2, and OH; R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc; R.sup.5a is selected from the group consisting of GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3; and R.sup.6 is selected from the group consisting of a galactoside, an N-acetylgalactosaminide, a glucoside, an N-acetylglucosaminide, and a sialoside.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
DETAILED DESCRIPTION OF THE INVENTION
I. General
(18) Described herein are new N-acyl sialic acid compounds and convenient chemoenzymatic methods for synthesizing the N-acyl sialic acid and sialosides containing them. Applications in glycan microarray and cell feeding studies are described, which provide a new approach for elucidating the important roles of O-acetylation of sialic acids.
(19) In certain embodiments, one-pot three-enzyme (OP3E) sialylation systems are used for efficient, high-yield production of a library of Neu5Ac9NAc-containing 2-3- and 2-6-linked sialosides with diverse underlying glycans from chemically synthesized 6-acetamido-6-deoxy-N-acetylmannosamine (ManNAc6NAc). Among these, the use of para-nitrophenylated 2-3- and 2-6-linked sialyl galactosides is demonstrated in microtiter plate-based high-throughput substrate specificity studies of nine different sialidases including those from humans and bacteria.
II. Definitions
(20) As used herein, the term monosaccharide refers to a sugar having a six-membered carbon backbone (i.e., a hexose). Examples of monosaccharides include, but are not limited to, glucose (Glc), galactose (Gal), mannose (Man), glucuronic acid (GlcA), and iduronic acid (IdoA). Monosaccharides also include hexoses substituted with hydroxy groups, oxo groups, amino groups, acetamido groups, and other functional groups. Deoxy monosaccharides refer to monosaccharides having carbon atoms one or more carbon atoms in the hexose backbone having only hydrogen substituents. Monosaccharides also include, but are not limited to, glucosamine (2-amino-2-deoxy-glucose; GlcN), N-acetylglucosamine (2-acetamido-2-deoxy-glucose; GlcNAc), galactosamine (2-amino-2-deoxy-galactose; GalN;), N-acetylgalactosamine (2-acetamido-2-deoxy-galactose; GalNAc), mannosamine (2-amino-2-deoxy-mannose; ManN), and N-acetylmannosamine (2-acetamido-2-deoxy-mannose; ManNAc).
(21) As used herein, the term oligosaccharide refers to a compound containing at least two sugars covalently linked together. Oligosaccharides include disaccharides, trisaccharides, tetrasaccharides, pentasaccharides, hexasaccharides, heptasaccharides, octasaccharides, and the like. Covalent linkages for linking sugars generally consist of glycosidic linkages (i.e., COC bonds) formed from the hydroxyl groups of adjacent sugars. Linkages can occur between the 1-carbon (the anomeric carbon) and the 4-carbon of adjacent sugars (i.e., a 1-4 linkage), the 1-carbon (the anomeric carbon) and the 3-carbon of adjacent sugars (i.e., a 1-3 linkage), the 1-carbon (the anomeric carbon) and the 6-carbon of adjacent sugars (i.e., a 1-6 linkage), or the 1-carbon (the anomeric carbon) and the 2-carbon of adjacent sugars (i.e., a 1-2 linkage). A sugar can be linked within an oligosaccharide such that the anomeric carbon is in the - or -configuration. The oligosaccharides prepared according to the methods of the invention can also include linkages between carbon atoms other than the 1-, 2-, 3-, 4-, and 6-carbons.
(22) As used herein, the term isomer refers to a compound having the same bond structure as a reference compound but having a different three-dimensional arrangement of the bonds. An isomer can be, for example, an enantiomer or a diastereomer.
(23) As used herein, the term glycoside refers to a saccharide compound having a moiety OR replacing a hydroxyl group of the parent compound, wherein R is another saccharide (e.g., a monosaccharide, oligosaccharide, or polysaccharide) or a non-saccharide moiety (e.g., a lipid, a protein, a peptide, a linker moiety, a label moiety, etc.). In some embodiments, the moiety OR in the glycoside replaces the hydroxyl group of the anomeric carbon at the reducing end of the parent saccharide.
(24) A galactoside refers to a galactopyranose moiety or a galactofuranose moiety wherein one of the hydroxyl groups of the parent compound is replaced with a moiety OR as described above. Galactosides include, for example, lactosides (i.e., -D-galactopyranosyl-(1.fwdarw.4)-D-glucopyranoses).
(25) An N-acetylgalactosaminide refers to a galactopyranose moiety or a galactofuranose moiety wherein one of the hydroxyl groups of the parent compound is replaced with a moiety OR as described above, and wherein at least one additional hydroxyl group of the parent compound is replaced with NC(O)R, wherein R is C.sub.1-6 alkyl or C.sub.1-6 hydroxyalkyl. N-Acetylgalactosaminides include, for example, N-acetylgalactosamine (GalNAc)-derived 2-acetamido-2-deoxy-D-galactopyranosides.
(26) A glucoside refers to a glucopyranose moiety or a glucofuranose moiety wherein one of the hydroxyl groups of the parent compound is replaced with a moiety OR as described above.
(27) An N-acetylglucosaminide refers to a glucopyranose moiety or a glucofuranose moiety wherein one of the hydroxyl groups of the parent compound is replaced with a moiety OR as described above, and wherein at least one additional hydroxyl group of the parent compound is replaced with NC(O)R, wherein R is C.sub.1-6 alkyl or C.sub.1-6 hydroxyalkyl. N-Acetylglucosaminides include, for example, N-acetylglucosamine (GlcNAc)-derived 2-acetamido-2-deoxy-D-glucopyranosides.
(28) A sialoside refers to a sialic acid moiety wherein one of the hydroxyl groups of the parent compound is replaced with a moiety OR as described above. Sialic acid is a general term for N- and O-substituted derivatives of neuraminic acid, and includes, but is not limited to, N-acetyl (Neu5Ac) or N-glycolyl (Neu5Gc) substitutions, as well as O-substitutions including acetyl, lactyl, methyl, sulfate and phosphate, among others.
(29) As used herein, the term alkyl refers to a straight or branched, saturated, aliphatic radical having the number of carbon atoms indicated. Alkyl can include any number of carbons, such as C.sub.1-2, C.sub.1-3, C.sub.1-4, C.sub.1-5, C.sub.1-6, C.sub.1-7, C.sub.1-8, C.sub.1-9, C.sub.1-10, C.sub.2-3, C.sub.2-4, C.sub.2-5, C.sub.2-6, C.sub.3-4, C.sub.3-5, C.sub.3-6, C.sub.4-5, C.sub.4-6 and C.sub.5-6. For example, C.sub.1-6 alkyl includes, but is not limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, hexyl, etc. Alkyl can also refer to alkyl groups having up to 20 carbons atoms, such as, but not limited to heptyl, octyl, nonyl, decyl, etc. The term alkylene refers to a divalent alkyl radical, wherein the two points of attachment to the diradical are on the same carbon atom or different carbon atoms.
(30) As used herein, the terms halo and halogen refer to a fluorine, chlorine, bromine, or iodine atom.
(31) As used herein, the term sialic acid aldolase refers to an aldolase that catalyzes a reversible reaction that converts a suitable hexosamine, hexose, pentose, or derivative (such as N-acetyl mannosamine) to sialic acid via reaction with pyruvate.
(32) As used herein, the term CMP-sialic acid synthetase refers to a polypeptide that catalyzes the synthesis of cytidine monophosphate sialic acid (CMP-sialic acid) from cytidine triphosphate (CTP) and sialic acid.
(33) As used herein, the term sialyltransferase refers to an enzyme that catalyzes the transfer of a sialic acid to a monosaccharide, an oligosaccharide, or another glycosylated molecule.
(34) As used herein, the term sialidase refers to an enzyme that catalyzes the cleavage of a terminal sialic acid from a sialylated target such as an oligosaccharide, a polysaccharide, or a glycosylated protein.
(35) The term variant, in the context of the enzymes in the present disclosure, means a polypeptide, typically recombinant, that comprises one or more amino acid substitutions relative to a corresponding, naturally-occurring or unmodified sialyltransferase.
(36) The term amino acid refers to any monomeric unit that can be incorporated into a peptide, polypeptide, or protein. Amino acids include naturally-occurring -amino acids and their stereoisomers, as well as unnatural (non-naturally occurring) amino acids and their stereoisomers. Stereoisomers of a given amino acid refer to isomers having the same molecular formula and intramolecular bonds but different three-dimensional arrangements of bonds and atoms (e.g., an L-amino acid and the corresponding D-amino acid).
(37) Naturally-occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, -carboxyglutamate and O-phosphoserine. Naturally-occurring -amino acids include, without limitation, alanine (Ala), cysteine (Cys), aspartic acid (Asp), glutamic acid (Glu), phenylalanine (Phe), glycine (Gly), histidine (His), isoleucine (Ile), arginine (Arg), lysine (Lys), leucine (Leu), methionine (Met), asparagine (Asn), proline (Pro), glutamine (Gln), serine (Ser), threonine (Thr), valine (Val), tryptophan (Trp), tyrosine (Tyr), and combinations thereof. Stereoisomers of a naturally-occurring -amino acids include, without limitation, D-alanine (D-Ala), D-cysteine (D-Cys), D-aspartic acid (D-Asp), D-glutamic acid (D-Glu), D-phenylalanine (D-Phe), D-histidine (D-His), D-isoleucine (D-Ile), D-arginine (D-Arg), D-lysine (D-Lys), D-leucine (D-Leu), D-methionine (D-Met), D-asparagine (D-Asn), D-proline (D-Pro), D-glutamine (D-Gln), D-serine (D-Ser), D-threonine (D-Thr), D-valine (D-Val), D-tryptophan (D-Trp), D-tyrosine (D-Tyr), and combinations thereof.
(38) Unnatural (non-naturally occurring) amino acids include, without limitation, amino acid analogs, amino acid mimetics, synthetic amino acids, N-substituted glycines, and N-methyl amino acids in either the L- or D-configuration that function in a manner similar to the naturally-occurring amino acids. For example, amino acid analogs can be unnatural amino acids that have the same basic chemical structure as naturally-occurring amino acids (i.e., a carbon that is bonded to a hydrogen, a carboxyl group, an amino group) but have modified side-chain groups or modified peptide backbones, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally-occurring amino acid.
(39) Amino acids may be referred to herein by either the commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, as described herein, may also be referred to by their commonly accepted single-letter codes.
(40) With respect to amino acid sequences, one of skill in the art will recognize that individual substitutions, additions, or deletions to a peptide, polypeptide, or protein sequence which alters, adds, or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. The chemically similar amino acid includes, without limitation, a naturally-occurring amino acid such as an L-amino acid, a stereoisomer of a naturally occurring amino acid such as a D-amino acid, and an unnatural amino acid such as an amino acid analog, amino acid mimetic, synthetic amino acid, N-substituted glycine, and N-methyl amino acid.
(41) The terms amino acid modification and amino acid alteration refer to a substitution, a deletion, or an insertion of one or more amino acids. For example, substitutions may be made wherein an aliphatic amino acid (e.g., G, A, I, L, or V) is substituted with another member of the group. Similarly, an aliphatic polar-uncharged group such as C, S, T, M, N, or Q, may be substituted with another member of the group; and basic residues, e.g., K, R, or H, may be substituted for one another. In some embodiments, an amino acid with an acidic side chain, e.g., E or D, may be substituted with its uncharged counterpart, e.g., Q or N, respectively; or vice versa. Each of the following eight groups contains exemplary amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
(42) Identical and identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are substantially identical to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. These definitions also refer to the complement of a nucleic acid test sequence.
(43) For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. For sequence comparison of nucleic acids and proteins, the BLAST and BLAST 2.0 algorithms and the default parameters discussed below are used.
(44) In certain embodiments, an enzyme variant will have at least about 80%, e.g., at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to any one of the amino acid sequences set forth herein.
(45) In some embodiments, the polypeptide further comprises one or more heterologous amino acid sequences located at the N-terminus and/or the C-terminus of the polypeptide. The polypeptide can contain a number of heterologous sequences that are useful for expressing, purifying, and/or using the polypeptide. The polypeptide can contain, for example, a poly-histidine tag (e.g., a His.sub.6 tag (SEQ ID NO: 1)); a calmodulin-binding peptide (CBP) tag; a NorpA peptide tag; a Strep tag (e.g., Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 2)) for recognition by/binding to streptavidin or a variant thereof, a FLAG peptide (i.e., Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys (SEQ ID NO: 3)) for recognition by/binding to anti-FLAG antibodies (e.g., M1, M2, M5); a glutathione S-transferase (GST); or a maltose binding protein (MBP) polypeptide.
(46) As used herein, the term forming a reaction mixture refers to the process of bringing into contact at least two distinct species such that they mix together and can react, either modifying one of the initial reactants or forming a third distinct species, i.e., a product. It should be appreciated, however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture.
III. Sialic Acid Analog Compounds
(47) The sialic acid compounds described herein can be to prepare a variety of useful sugars and glycoconjugates which can, in turn, be used for the study of biological and pathological processes in fields as diverse as immunology, oncology, virology, neuroscience. N-acetyl sialic acids, in particular, can be used as mimics of naturally occurring O-acetyl sialic acids without the instability associated with O-acetylation.
(48) Accordingly, one aspect the invention provides compounds according to Formula I:
(49) ##STR00003## or a salt thereof, wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5a is selected from the group consisting of Ac, Gc, GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; Ac is C(O)CH.sub.3; Gc is C(O)CH.sub.2OH; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; and GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3; provided that when R.sup.5 is OH or OAc, at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3; provided that when R.sup.5 is NHR.sup.5a, at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is NHAc or N.sub.3; provided that when R.sup.5 and R.sup.1 are NHAc, at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc; and provided that when R.sup.5 and R.sup.4 are NHAc, at least one of R.sup.1, R.sup.2, and R.sup.3 is NHAc.
(50) In some embodiments, compounds according to Formula I are provided as described above wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, OAc, OH, and hydrogen; and R.sup.5a is selected from the group consisting of Ac and Gc.
(51) In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3, NH.sub.2, and OH. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH, and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH, and R.sup.5 is NHAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH, and R.sup.5 is NHGc.
(52) In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3 and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3 and R.sup.5 is NHAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3 and R.sup.5 is NHGc.
(53) In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH, and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH, and R.sup.5 is NHAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH, and R.sup.5 is NHGc.
(54) In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc and R is NHR.sup.5a. In some embodiments, R, R.sup.2, R.sup.13, and R.sup.4 are NHAc and R is NHAc. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc and R is NHGc.
(55) In some embodiments, R is NHR.sup.5a and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is independently NHAc, NH.sub.2, or N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is independently NHAc or N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and at least two of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and at least three of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(56) In some embodiments, R.sup.5 is NHR.sup.5a and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is N.sub.3 or NH.sub.2. In some embodiments, R.sup.5 is NHR.sup.5a and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and at least two of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and at least three of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R.sup.5 is NHR.sup.5a and R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(57) In some embodiments, R.sup.5 is NHR.sup.5a and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is NHAc. In some embodiments, R.sup.5 is NHR.sup.5a and at least two of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R.sup.5 is NHR.sup.5a and at least three of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R.sup.5 is NHR.sup.5a and R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(58) In some embodiments, R.sup.5 is NHAc and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is N.sub.3 or NH.sub.2. In some embodiments, R.sup.5 is NHAc and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is N.sub.3. In some embodiments, R.sup.5 is NHAc and at least two of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R.sup.5 is NHAc and at least three of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R.sup.5 is NHAc and R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(59) In some embodiments, R.sup.5 is NHGc and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is NHAc. In some embodiments, R.sup.5 is NHGc and at least two of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R.sup.5 is NHGc and at least three of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R.sup.5 is NHGc and R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.1, R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(60) In some embodiments, R is NHR.sup.5a, and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is NHAc, N.sub.3, or NH.sub.2. In some embodiments, R is NHR.sup.5a, and at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is NHAc or N.sub.3.
(61) In some embodiments, R.sup.5 and R.sup.1 are NHAc, and at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc.
(62) In some embodiments, R.sup.5 and R.sup.4 are NHAc, and at least one of R.sup.1, R.sup.2, and R.sup.3 is NHAc.
(63) In some embodiments, compounds according to Formula Ia are provided:
(64) ##STR00004## or a salt thereof, wherein: R.sup.1 is selected from the group consisting of hydrogen, NHAc, and OH; and R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH.
(65) In some embodiments, the compound is selected from Group A consisting of:
(66) ##STR00005##
(67) In some embodiments, R.sup.5 is OH in compounds of Group A. In some embodiments, R.sup.5 is OAc in compounds of Group A. In some embodiments, R.sup.5 is N.sub.3 or NH.sub.2 in compounds of Group A. In some embodiments, R.sup.5 is N.sub.3 in compounds of Group A. In some embodiments, R.sup.5 is NHAc in compounds of Group A. In some embodiments, R.sup.5 is NHGc in compounds of Group A.
(68) In some embodiments, the compound is selected from Group B consisting of.
(69) ##STR00006## ##STR00007##
(70) In some embodiments, R.sup.5a is Ac in compounds of Group B. In some embodiments, R.sup.5a is Gc in compounds of Group B.
(71) In some embodiments, R.sup.1 is H, and R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3, NH.sub.2, and OH. In some embodiments, R.sup.1 is H, and R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH; and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH; and R.sup.5 is NHAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH; and R.sup.5 is NHGc.
(72) In some embodiments, R.sup.1 is H, and R.sup.2, R.sup.3, and R.sup.4 are N.sub.3 or NH.sub.2. In some embodiments, R.sup.1 is H, and R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are N.sub.3; and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are N.sub.3; and R.sup.5 is NHAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are N.sub.3; and R.sup.5 is NHGc.
(73) In some embodiments, R.sup.1 is H, and R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH; and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH; and R.sup.5 is NHAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH; and R.sup.5 is NHGc.
(74) In some embodiments, R.sup.1 is H, and R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some such embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are NHAc; and R.sup.5 is NHR.sup.5a. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are NHAc; and R.sup.5 is NHAc. In some embodiments, R.sup.1 is H; R.sup.2, R.sup.3, and R.sup.4 are NHAc; and R.sup.5 is NHGc.
(75) In some embodiments, R.sup.1 is H; R.sup.5 is OH or OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc, N.sub.3, or NH.sub.2. In some embodiments, R.sup.1 is H; R.sup.5 is OH or OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc or N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is OH or OAc; and at least two of R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.1 is H; R is OH or OAc; and R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(76) In some embodiments, R.sup.1 is H; R.sup.5 is OH; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc, N.sub.3, or NH.sub.2. In some embodiments, R.sup.1 is H; R.sup.5 is OH; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc or N.sub.3. In some embodiments, R is H; R.sup.5 is OH; and at least two of R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is OH; and R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(77) In some embodiments, R.sup.1 is H; R.sup.5 is OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc, N.sub.3, or NH.sub.2. In some embodiments, R.sup.1 is H; R.sup.5 is OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc or N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is OAc; and at least two of R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is OAc; and R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(78) In some embodiments, R is H; R.sup.5 is OH; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3 or NH.sub.2. In some embodiments, R.sup.1 is H; R.sup.5 is OH; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is OH; and at least two of R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is OH; and R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(79) In some embodiments, R.sup.1 is H; R.sup.5 is OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3 or NH.sub.2. In some embodiments, R.sup.1 is H; R.sup.5 is OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3. In some embodiments, R is H; R.sup.5 is OAc; and at least two of R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R is H; R.sup.5 is OAc; and R.sup.2, R.sup.3, and R.sup.4 N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(80) In some embodiments, R is H; R.sup.5 is OH; and at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc. In some embodiments, R is H; R.sup.5 is OH; and at least two of R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R is H; R.sup.5 is OH; and R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(81) In some embodiments, R.sup.1 is H; R is OAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc. In some embodiments, R is H; R.sup.5 is OAc; and at least two of R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R is H; R.sup.5 is OAc; and R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(82) In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc, N.sub.3, or NH.sub.2. In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and at least one of R.sup.2, R.sup.3, and R.sup.4 is independently NHAc or N.sub.3. In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and at least two of R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is NHR.sup.5a; and R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(83) In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3 or NH.sub.2. In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3. In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and at least two of R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R is H; R.sup.5 is NHR.sup.5a; and R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(84) In some embodiments, R.sup.1 is H; R.sup.5 is NHR.sup.5a; and at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc. In some embodiments, R.sup.1 is H; R.sup.5 is NHR.sup.5a; and at least two of R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R.sup.1 is H; R.sup.5 is NHR.sup.5a; and R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(85) In some embodiments, R.sup.1 is H; R.sup.5 is NHAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3 or NH.sub.2. In some embodiments, R.sup.1 is H; R.sup.5 is NHAc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is N.sub.3. In some embodiments, R.sup.1 is H; R.sup.5 is NHAc; and at least two of R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, R.sup.1 is H; R is NHAc; and R.sup.2, R.sup.3, and R.sup.4 are N.sub.3. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(86) In some embodiments, R.sup.1 is H; R.sup.5 is NHGc; and at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc. In some embodiments, R.sup.1 is H; R.sup.5 is NHGc; and at least two of R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, R.sup.1 is H; R.sup.5 is NHGc; and R.sup.2, R.sup.3, and R.sup.4 are NHAc. In some embodiments, remaining R.sup.2, R.sup.3, and R.sup.4 groups are independently selected from OH and OAc. In some such embodiments, the remaining R.sup.2, R.sup.3, and R.sup.4 groups are OH.
(87) In some embodiments, R.sup.1 is H, and each of R.sup.2, R.sup.3, and R.sup.4 is independently selected from the group consisting of H, NHAc, and OH.
(88) In some embodiments, R.sup.1 is H, and each of R.sup.2, R.sup.3, and R.sup.4 is independently selected from the group consisting of H, N.sub.3, NH.sub.2, and OH. In some embodiments, R.sup.1 is H, and each of R.sup.2, R.sup.3, and R.sup.4 is independently selected from the group consisting of H, N.sub.3, and OH.
(89) In some embodiments, the compound is selected from Group C consisting of:
(90) ##STR00008##
(91) In some embodiments, R.sup.5a is Ac in compounds of Group C. In some embodiments, R.sup.5a is Gc in compounds of Group C.
(92) In some embodiments, the compound is selected from Group D consisting of:
(93) ##STR00009## ##STR00010##
(94) In some embodiments, R.sup.5 is OH in compounds of Group D. In some embodiments, R.sup.5 is OAc in compounds of Group D. In some embodiments, R.sup.5 is N.sub.3 or NH.sub.2 in compounds of Group D. In some embodiments, R.sup.5 is N.sub.3 in compounds of Group D. In some embodiments, R.sup.5 is NHAc in compounds of Group D. In some embodiments, R.sup.5 is NHGc in compounds of Group D.
(95) In some embodiments, the compound is selected from Group E consisting of:
(96) ##STR00011## ##STR00012##
(97) In some embodiments, the compound is selected from Group F consisting of:
(98) ##STR00013##
(99) In some embodiments, R.sup.5a is Ac in compounds of Group E or Group F. In some embodiments, R.sup.5a is Gc in compounds of Group E or Group F.
(100) In some embodiments, the compound is selected from Group G consisting of:
(101) ##STR00014##
(102) In some embodiments, the compound is selected from Group H consisting of:
(103) ##STR00015##
(104) In some embodiments, R.sup.5a is Ac in compounds of Group H. In some embodiments, R.sup.5a is Gc in compounds of Group H.
(105) In some embodiments, the compound is selected from Group J consisting of:
(106) ##STR00016##
IV. Synthesis of N-Acetyl Mannosamine-Based Sialic Acid Precursors
(107) ManNAc6N.sub.3 (1A) and ManNAc6NAc (1) can be synthesized as shown in Scheme 1. ManNAc6N.sub.3 (1A) was synthesized as described previously. The azido group in ManNAc6N.sub.3 (1A) can be converted to N-acetyl group in ManNAc6NAc (1) by simultaneous reduction of azide and N-acetylation using AcSH in pyridine. ManNAc6NAc (1) is a suitable precursor for Neu5Ac9NAc and for one-pot three-enzyme synthesis of a library of 2-3- and 2-6-linked Neu5Ac9NAc-containing sialosides using a Pasteurella multocida sialic acid aldolase (PmAldolase), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), and Pasteurella multocida 2-3-sialyltransferase 1 M144D mutant (PmST1_M144D) or Photobacterium species 2-6-sialyltransferase (Psp2,6ST).
(108) ##STR00017##
(109) ManNAc4N.sub.3 (2A) and ManNAc4NAc (2) can be prepared as shown in Scheme 2. ManNAc4N.sub.3 (2A) can be synthesized using the method of Thomson (Carbohydrate Research 1995; 274:29-44). The azido group in ManNAc4N.sub.3 (2A) can be converted to an N-acetyl group in ManNAc4NAc (2) in one step using AcSH in pyridine as described above for the conversion of ManNAc6N.sub.3 (1A) to ManNAc6NAc (1). ManNAc4NAc (2) is a suitable substrate for synthesizing Neu5Ac7NAc and 2-3- and 2-6-linked Neu5Ac7NAc-containing sialosides using a one-pot three-enzyme sialylation strategy.
(110) ##STR00018##
(111) 5-azido-ManNAc (ManNAc5N.sub.3, 3A) can be synthesized from commercially available 1,2:5,6-di-O-isopropylidene--D-glucopyranose as shown in Scheme 3. After benzylation, the 5,6-isopropylidene protecting group in 3.1 can be selectively removed by mild acid hydrolysis and the resulting intermediate diol 3.2 is treated with methyl chloroformate to produce carbonate 3.3. Treatment of 3.3 with benzyl alcohol in the presence of acid ion exchange resin affords benzyl furanoside 3.4 as a mixture of - and -anomers, which can be separated by flash chromatography. The C-3 OH of the -anomer 3.4 can be converted to the corresponding triflate ester by the treatment with Tf.sub.2O followed by the reaction with NaN.sub.3 in DMF to produce 2-azido-2-deoxy-mannopyranoside 3.5. The carbonate protecting group can be removed by treatment of 3.5 with sodium methoxide in methanol, selective 6-O-benzylation of the azido diol can be achieved by forming a dibutylstannylene derivative followed by alkylation with this intermediate with benzyl bromide to produce 3.6. The 2-azido group of 3.6 can be converted to acetamido group to produce 3.7 by treating with AcSH in pyridine. Epimerization of 1,6-di-O-benzoyl-2,3-O-isopropylidene-s-D-mannofuranose (3.7) to the corresponding epi-hydroxyl stereoisomer (3.8) can be achieved by activation of the hydroxyl group by triflic anhydride in a mixture of pyridine and DCM followed by an S.sub.N2 reaction using a nucleophilic reagent (NaNO.sub.2). The product 3.8 can be converted to triflate ester by the treatment with Tf.sub.2O and then reacted with NaN.sub.3 in DMF to yield 3.9. The azide group in 3.9 can be converted to an acetamido group to produce 3.10 by treating with AcSH in pyridine. After hydrogenation in the presence of H.sub.2 and Pd/C, ManNAc5NAc (3) can be obtained. ManNAc5N.sub.3 (3A) can be readily accessible from 3.9 by amino-azido conversion using trifluoromethanesulfonyl azide via intermediates 3.11 and 3.12.
(112) ##STR00019##
(113) ManNAc4N.sub.36N.sub.3 (4A) and ManNAc4,6NAc.sub.2 (4) (Scheme 4) can be synthesized from ManNAc4N.sub.3 (2A). The 6-OH in 3 can be converted into O-tosylate (4.1), which can be subsequently displaced by sodium azide in DMF to produce 4,6-diazido-ManNAc (ManNAc4N.sub.36N.sub.3, 4A). Treating 4A with AcSH in pyridine affords ManNAc4,6NAc.sub.2 (4) smoothly.
(114) ##STR00020##
(115) ManNAc5N.sub.36N.sub.3 (5A), and ManNAc5,6NAc.sub.2 (5) can be synthesized as shown in Scheme 5. Selective p-toluenesulfonylation of ManNAc5N.sub.3 (3A) forms tosylate (5.1), which can be converted to ManNAc5N.sub.36N.sub.3 (5A). Treating 5A with AcSH in pyridine provides ManNAc5,6NAc.sub.2 (5).
(116) ##STR00021##
V. Synthesis of N-Acetyl Sialic Acids from ManNAc Precursors
(117) N-acyl sialic acids can be prepared enzymatically from the precursors described above. For example, Neu5Ac9NAc can be obtained in good yield from ManNAc6NAc (1, Scheme 1) using an enzymatic reaction catalyzed by Pasteurella multocida sialic acid aldolase (PmAldolase). Neu5Ac9NAc can be used together with its 9-O-acetyl counterpart Neu5,9Ac.sub.2 for metabolic incorporation studies as described below. Additional N-acetyl Neu5Ac derivatives including Neu5Ac7NAc, Neu5Ac8NAc, Neu5Ac7,9NAc.sub.2, and Neu5Ac8,9NAc.sub.2 can be synthesized from the corresponding precursors ManNAc4NAc (2), ManNAc5NAc (3), ManNAc4,6NAc.sub.2 (4), and ManNAc5,6NAc.sub.2 (5), respectively.
(118) Accordingly another aspect of the invention provides method for preparing a compound according to Formula II:
(119) ##STR00022## the method comprising forming a reaction mixture comprising a sialic acid aldolase, pyruvic acid, and a compound according to Formula III:
(120) ##STR00023## or an isomer thereof, under conditions sufficient to form the compound of Formula II; wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5a is selected from the group consisting of Ac, Gc, GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; Ac is C(O)CH.sub.3; Gc is C(O)CH.sub.2OH; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; and GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3.
(121) In some embodiments, methods for preparing compounds according to Formula II are provided as described above wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, OAc, OH, and hydrogen; and R.sup.5a is selected from the group consisting of Ac and Gc.
(122) In some embodiments, R.sup.1, R.sup.2, and R.sup.3 are independently selected from the group consisting of NHAc and OH; at least one of R.sup.1, R.sup.2, and R.sup.3 is NHAc; and R.sup.5 is NHAc.
(123) Any suitable sialic acid aldolase (i.e., N-Acetylneuraminate pyruvate lyase, EC 4.1.3.3) can be used in the methods of the invention. For example, sialic acid aldolases from E. coli, L. plantarum, P. multocida, or N. meningitidis can be used.
(124) In some embodiments, the sialic acid aldolase is PmAldolase (NCBI Accession No. WP_005723432.1) or a catalytically active variant thereof. In some embodiments, the sialic acid aldolase comprises the polypeptide sequence: TNIAIIPARAGSKGIPDKNLQPVGGHSLIGRAILAAKNADVFDMIVVTSDGDNILREAE KYGALALKRPAELAQDNSRTIDAILHALESLNIREGTCTLLQPTSPLRDHLDIKNAMD MYVNGGVHSVVSACECEHHPYKAFALSKDHEVLPVREIADFEAVRQTLPKMYRAN GAIYINDIAQLLKEKYFFIPPLKFYLMPTYHSVDIDVKQDLELAEILSNK (SEQ ID NO: 4), or a catalytically active variant thereof.
(125) In some embodiments, the sialic acid aldolase E. coli sialic acid aldolase.
VI. Synthesis of N-Acetyl Sialic Acids from Neu5Ac
(126) Neu5Ac4NAc (6) can be synthesized from Neu5Ac as shown in Scheme 6. Target Neu5Ac4N.sub.3 (6A) and Neu5Ac4NAc (6) can be synthesized by following the method of Zbiral (Carbohydrate Research. 1989; 194:c15-8). As shown in Scheme 6, sialic acid derivative 6.1 can be obtained from Neu5Ac. It is transformed via the 4-oxo-derivative 6.2 into the 4-epi-sialic acid derivative 6.3. Reacting 6.3 with PPh.sub.3-diethylazodicarboxylate (DEAD)-3M ammonia (toluene) in THF produces compound 6.4 as the main product. Compound 6.4 can be treated with 80% HOAc and then go through saponification to produce Neu5Ac4N.sub.3 (6A). The 4-azido group in 6.4 can be converted to an acetamido group to produce 6.5 by treating with AcSH in pyridine. Neu5Ac4NAc (6) can be produced from compound 6.5 after deprotection steps.
(127) ##STR00024##
(128) The preparation of Neu5Ac8NAc precursors is described above and depicted in Scheme 3. Alternatively, 8-azido-8-deoxy-N-acetylneuraminic acid (Neu5Ac8N.sub.3) and 8-acetamido-8-deoxy-N-acetylneuraminic acid (Neu5Ac8NAc) can be prepared using 2,7-anhydro-N-acetylneuraminic acid (2,7-anhydro-Neu5Ac, 7.1) as a synthon. Using 2,7-anhydro-Neu5Ac as a starting material has several advantages. It can be readily obtained from Neu5Ac by a one-pot multienzyme (OPME) system containing cytidine 5-triphosphate (CTP), a CMP-sialic acid synthetase, (e.g., Neisseria meningitidis CMP-sialic acid synthetase, NmCSS), an 2-3-sialyltransferase (e.g., Pasteurella multocida 2-3-sialyltransferase 1, PmST1, or its mutant PmST1 M144D), a sialyltransferase acceptor (e.g., a galactoside such as lactose), and Streptococcus pneumoniae sialidase SpNanB as shown in Scheme 7A. The Neu5Ac can be obtained from N-acetylmannosamine using a sialic acid aldolase (e.g., from P. multocida), as shown in Scheme 7A. Also advantageously, the C-2 and C-7 positions of 2,7-anhydro-Neu5Ac (7.1) are already protected and less complicated protection scheme can be used.
(129) ##STR00025##
(130) As shown in Scheme 7B, treatment of 2,7-anhydro-Neu5Ac (7.1) with H.sup.+ ion exchange resin in methanol can be used to produce ester 7.2. A benzylidene acetal can be used to protect hydroxyl groups at C-8 and C-9 simultaneously to produce 7.3. Acetylation of the C-4 hydroxyl group in 7.3 provides fully protected 2,7-anhydro-Neu5Ac 7.4. The C-8 hydroxyl group can be selectively deprotected using borane trimethylamine with aluminum chloride to provide 7.5. Double inversion of the stereocenter at the C-8 position of 7.5 can be achieved using trifluoromethanesulfonic anhydride (Tf.sub.2O) and sodium nitrite, followed by trifluoromethanesulfonic anhydride (Tf.sub.2O) and sodium azide, to produce 8-azido-8-deoxy compound 7.6. Thioacetic acid (AcSH) in pyridine can be used to covert the azido group to an acetamido group to produce compound 7.7. Finally, deprotection of compounds 7.6 and 7.7 (e.g., by sequential treatment with sodium methoxide in methanol; hydrochloric acid; and catalytic hydrogenation) provides target compounds 2,7-anhydro-Neu5Ac8N.sub.3 (7A) and 2,7-anhydro-Neu5Ac8NAc (7). An analogous approach for the preparation of Neu5Ac4N.sub.3 and Neu5Ac4NAc is described below in Example 17.
(131) ##STR00026## ##STR00027##
VII. Chemoenzymatic Synthesis of Sialosides
(132) 2-3- and/or 2-6-linked sialosides containing Neu5Ac4NAc, Neu5Ac7NAc, and Neu5Ac8NAc, Neu5Ac7,9NAc.sub.2, or Neu5Ac8,9NAc.sub.2 can be synthesized using one-pot two enzyme (OP2E) and one-pot three enzyme (OP3E) systems, such as the systems depicted in Scheme 8.
(133) ##STR00028##
(134) Similarly, 2,7-anhydro-Neu5Ac8N.sub.3 and 2,7-anhydro-Neu5Ac8NAc (prepared according to Scheme 7B) can be utilized in one-pot multienzyme (OPME) sialylation systems containing SpNanB, NmCSS, and a sialyltransferase (PmST1, PmST1 M144D, Pd2,6ST, Psp2,6ST, or Psp2,6ST A366G) to synthesize Neu5Ac8N.sub.3-containing glycosides and Neu5Ac8NAc-containing glycosides as shown below. The azido group in Neu5Ac8N.sub.3-glycosides can be converted to Neu5Ac8NAc-glycosides using thioacetic acid (AcSH) in saturated sodium bicarbonate (NaHCO.sub.3) in water.
(135) ##STR00029##
(136) ##STR00030##
(137) While a number of exemplary protecting groups are set forth herein, one of skill in the art will appreciate that still other protecting strategies can be employed in the methods for the synthesis of particular sugars and/or glycosides. Such protecting groups are described, for example, in Protective Groups in Organic Synthesis, 4th edition, T. W. Greene and P. G. M. Wuts, John Wiley & Sons, New York, 2006.
(138) Accordingly, also provided are compounds according to Formula IV:
(139) ##STR00031## wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5a is selected from the group consisting of Ac, Gc, GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; Ac is C(O)CH.sub.3; Gc is C(O)CH.sub.2OH; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3; and R.sup.6 is selected from the group consisting of a galactoside, an N-acetylgalactosaminide, a glucoside, an N-acetylglucosaminide, and a sialoside.
(140) In some embodiments, compounds according to Formula IV are provided as described above wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, OAc, OH, and hydrogen; and R.sup.5a is selected from the group consisting of Ac and Gc.
(141) A variety of sialic acids and sialic derivatives can be used in the methods for forming sialosides according to Formula IV, including the sialic acid compounds described above. Sialosides according to Formula IV can include any combination of R.sup.1, R.sup.2, R.sup.3, R.sup.4, and R.sup.5 set forth above, but are not limited to such combinations. In some embodiments, the methods provide sialosides where: i) when R.sup.5 is OH or OAc, at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3; ii) when R.sup.5 is NHR.sup.5a, at least one of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 is NHAc or N.sub.3; iii) when R.sup.5 and R.sup.1 are NHAc, at least one of R.sup.2, R.sup.3, and R.sup.4 is NHAc; and iv) when R.sup.5 and R.sup.4 are NHAc, at least one of R.sup.1, R.sup.2, and R.sup.3 is NHAc.
(142) In some embodiments, compounds according to Formula IV are provided wherein R.sup.5 is OH or OAc, and at least two of R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently NHAc or N.sub.3. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of N.sub.3 and OH. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH.
(143) In some embodiments, compounds according to Formula IV are provided wherein R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.5 is NHAc. In some embodiments, R.sup.5 is NHGc.
(144) In some embodiments, a galactoside R.sup.6 is bonded to the compound via a 2-3 linkage or a 2-6 linkage; an N-acetylglucosaminide R.sup.6 is bonded to the compound via a 2-6 linkage; a glucoside R.sup.6 is bonded to the compound via a 2-6 linkage; or an N-acetylglucosaminide R.sup.6 is bonded to the compound via a 2-6 linkage.
(145) In some embodiments, R.sup.6 is a sialoside comprising a Sia-2,3-Gal moiety, a Sia-2,8-Sia moiety, or a Sia-2,9-Sia moiety, wherein each Sia is independently selected from Neu5Ac, Kdn, and Neu5Gc.
(146) In some embodiments, R.sup.6 is present as a member of an oligosaccharide, a polysaccharide, a glycosylated natural product, a glycopeptide, a glycoprotein, or a glycolipid. Suitable natural products include non-ribosomal glycopeptides (such as bleomycin), glycoalkaloids (such as solanine), ginsenosides (such as sanchinoside C1), aminoglycosides (such as gentamicin, kanamycin, neomycin, and streptomycin), avermectins, and anthracyclines (such as daunorubicin). Suitable glycolipids include glycoglycerolipids (such as monogalactosyldiacylglycerols, digalactosylmonoacylglycerols, and sulfoquinovosyl diacylglycerols), glycosphingolipids (such as lacto-, neolacto-, ganglio-, globo-, and iso-globo-series glycosphingolipids), and glycophosphatidylinositols (e.g., 1-phosphatidyl-L-myo-inositol 2,6-di-O--D-mannopyranoside). Suitable glycoproteins include mucins, immunoglobulins, lectins, and collagens.
(147) In some embodiments, compounds according to Formula IVa are provided:
(148) ##STR00032##
In compound according to Formula IVa, R.sup.6a is a monosaccharide, disaccharide or oligosaccharide, and subscript x is 0 or 1. R.sup.6b is a linker, and subscript y is 0 or 1. In some embodiments, the linker is selected from C.sub.1-6 alkylene; C.sub.1-6 alkylene-NHC(O)C.sub.1-6 alkylene; and C.sub.1-6 alkylene-NHC(O)(CH.sub.2(CH.sub.2CH.sub.2O).sub.pNHC(O)).sub.mC.sub.1-6 alkylene, where subscript m is 0 or 1, and subscript p is an integer from 1 to 6. In some embodiments, subscript y is 1 and R.sup.6c is C.sub.1-6 alkylene (e.g., n-propylene, denoted as Pro in Table 1 below).
(149) In some embodiments, R.sup.6c in compounds of Formula IVa is a glycosylated natural product, a glycopeptide, a glycoprotein, or a glycolipid, as described above. In some embodiments, R.sup.6c is a functional group that can be used for further synthetic manipulations. For example, compounds wherein R.sup.6cN.sub.3, halo, or thiotolyl can be used for the synthesis of more complex glycosides. Alternatively, compounds wherein R.sup.6c is NH.sub.2, SH, ONH.sub.2, or NHNH.sub.2, can be used for reaction with a suitably functionalized surface as described more detail below. In some embodiments, R.sup.6c is a chromophore or a chromogenic moiety (e.g., p-nitrophenyl) which can be used to assay the activity of enzymes such as glycosidases.
(150) R.sup.6a can be any suitable monosaccharide, disaccharide, or oligosaccharide. Examples of monosaccharides include, but are not limited to, dioses such as glycoaldehyde; trioses such as D and L-glyceraldehyde; tetroses such as D and L-erythrose, threose, and erythrulose; pentoses such as D and L-arabinose, lyxose, ribose, xylose, ribulose, and xylulose; hexoses such as D and L-allose, altrose, glucose, mannose, gulose, idose, galactose, fructose, and talose; aminosugars such as N-acetylglucosamine, galactosamine, glucosamine, sialic acid, and D and L-duanosamine; and sulfosugars such as sulfoquinovose. Deuterated, oxidized, and N-acetyl derivatives of the foregoing are also suitable sugars. Oxidized derivatives can be carboxylic acid derivatives of the respective sugar at any carbon in the sugar capable of being oxidized to a carboxylic acid in the sugar.
(151) Disaccharides are two monosaccharides linked together by glycosidic bonds. The glycosidic bonds can be O-, N-, or S-glycosidic bonds, and can be either - or -glycosidic bonds. Exemplary disaccharides include sucrose, lactose, maltose, and lactulose. However, any hydrolytically stable combination of two monosaccharides can be a suitable disaccharide. Oligosaccharides contain three or more monosaccharides linked by glycosidic bonds in the same manner as the aforementioned disaccharides.
(152) Sialosides that can be synthesized via the methods disclosed herein also include, but are not limited to, those listed in Table 1.
(153) TABLE-US-00001 TABLE 1 N-acetyl Neu5Ac Link Symbol Underlying Glycan Neu5Ac4NAc 2-3 Gal GalProN.sub.3 2-3 Lac/GM3 LacProN.sub.3 (Gal1-4GlcProN.sub.3) 2-3 Type 1 Gal1-3GlcNAcProN.sub.3 2-3 Type 1 Gal1-3GlcNAcProN.sub.3 2-3 Type 2 LacNAcProN3 (Gal1-4GlcNAcProN.sub.3) 2-3 Core 1 Gal1-3GalNAcProN.sub.3 2-3 LNnT Gal1-4GlcNAc1-3Gal1-4GlcProN.sub.3 2-3 LNT Gal1-3GlcNAc1-3Gal1-4GlcProN.sub.3 2-3 GM2 (GalNAc1-4)Gal1-4GlcProN.sub.3 2-3 GM1 (Gal1-3GalNAc1-4)Gal1-4GlcProN.sub.3 2-3 Core 1 Gal1-3GalNAcProN.sub.3 2-3 iGb5 Gal1-3GalNAc1-3Gal1-3Gal1- 4GlcProN.sub.3 2-3 iGb5NAc Gal1-3GalNAc1-3Gal1-3Gal1- 4GlcNAcProN.sub.3 2-3 Gb5 Gal1-3GalNAc1-3Gal1-4Gal1- 4GlcProN.sub.3 2-3 Gb5NAc Gal1-3GalNAc1-3Gal1-4Gal1- 4GlcNAcProN.sub.3 Neu5Ac9NAc, 2-3 Gal GalProN.sub.3 Neu5Ac7NAc, 2-6 Gal GalProN.sub.3 Neu5Ac8NAc, 2-6 GalNAc GalNAcProN.sub.3 Neu5Ac7, 9NAc.sub.2, 2-6 Tn GalNAcProN.sub.3 or 2-3 Lac/GM3 LacProN.sub.3 (Gal1-4GlcProN.sub.3) Neu5Ac8, 9NAc.sub.2 2-6 Lac/GM3 LacProN.sub.3 (Gal1-4GlcProN.sub.3) Neu5Ac9NAc, 2-3 Type 1 Gal1-3GlcNAcProN.sub.3 Neu5Ac7NAc, 2-3 Type 1 Gal1-3GlcNAcProN.sub.3 Neu5Ac8NAc 2-3 Type 2 LacNAcProN.sub.3 (Gal1-4GlcNAcProN.sub.3) Neu5Ac7, 9NAc.sub.2, 2-6 Type 2 LacNAcProN.sub.3 (Gal1-4GlcNAcProN.sub.3) or 2-3 Type 2-6S 6S-LacNAcProN.sub.3 (Gal1- Neu5Ac8, 9NAc.sub.2 4GlcNAc6SO.sub.3ProN.sub.3) 2-6 Type 2-6S 6S-LacNAcProN.sub.3 (Gal1- 4GlcNAc6SO.sub.3ProN.sub.3) 2-3 Type 2-6S 6S-LacNAcProN.sub.3 (Gal6SO.sub.31- 4GlcNAcProN.sub.3) 2-3 Core 1 Gal1-3GalNAcProN.sub.3 2-3 Lewis.sup.X Gal1-4(Fuc1-3)GlcNAcProN.sub.3 2-3 6S-Lewis.sup.X Gal1-4(Fuc1-3)GlcNAc6SO.sub.3ProN.sub.3 2-3 LNnT Gal1-4GlcNAc1-3Gal1-4GlcProN.sub.3 2-6 LNnT Gal1-4GlcNAc1-3Gal1-4GlcProN.sub.3 2-3 LNT Gal1-3GlcNAc1-3Gal1-4GlcProN.sub.3 2-3 GM2 (GalNAc1-4)Gal1-4GlcProN.sub.3 2-3 GM1 (Gal1-3GalNAc1-4)Gal1-4GlcProN.sub.3 2-8 GD3 Neu5Ac2-3Gal1-4GlcProN.sub.3 2-8 GD2 Neu5Ac2-3(GalNAc1-4)Gal1- 4GlcProN.sub.3 2-8 GD1a Neu5Ac2-3(Gal1-3GalNAc1-4)Gal1- 4GlcProN.sub.3 2-3 Core 1 Gall-3GalNAcProN.sub.3 2-3 iGb5 Gal1-3GalNAc1-3 Gal1-3Gal1- 4GlcProN.sub.3 2-3 iGb5NAc Gal1-3GalNAc1-3Gal1-3Gal1- 4GlcNAcProN.sub.3 2-3 Gb5 Gal1-3GalNAc1-3Gal1-4Gal1- 4GlcProN.sub.3 2-3 Gb5NAc Gal1-3GalNAc1-3Gal1-4Gal1- 4GlcNAcProN.sub.3
(154) In some embodiments, sialosides according to Formula IV are selected from
(155) ##STR00033## ##STR00034## ##STR00035##
(156) In some embodiments, sialosides according to Formula IV are selected from:
(157) ##STR00036## ##STR00037##
(158) In a related aspect, methods are provided for preparing a compound according to Formula IV:
(159) ##STR00038##
The methods include: forming a reaction mixture comprising cytidine triphosphate, a CMP sialic acid synthetase, a sialyltransferase, a compound according to Formula V
(160) ##STR00039##
and an acceptor according to Formula VI
HOR.sup.6(VI), under conditions sufficient to form the compound according to Formula IV. wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, NH.sub.2, OAc, OH, and hydrogen; R.sup.5a is selected from the group consisting of Ac, Gc, GcAc, GcN.sub.3, GcNH.sub.2, GcNAc, and hydrogen; Ac is C(O)CH.sub.3; Gc is C(O)CH.sub.2OH; GcAc is C(O)CH.sub.2OC(O)CH.sub.3; GcN.sub.3 is C(O)CH.sub.2N.sub.3; GcNH.sub.2 is C(O)CH.sub.2NH.sub.2; GcNAc is C(O)CH.sub.2NHC(O)CH.sub.3; and R.sup.6 is a glycoside selected from the group consisting of a galactoside, N-acetylgalactosaminide, a glucoside, an N-acetylglucosaminide, and a sialoside.
(161) In some embodiments, methods for preparing compounds according to Formula IV are provided as described above wherein: R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc, N.sub.3, OAc, OH, and hydrogen; R.sup.5 is selected from the group consisting of NHR.sup.5a, N.sub.3, OAc, OH, and hydrogen; and R.sup.5a is selected from the group consisting of Ac and Gc.
(162) A described above, sialic acid compounds according to Formula VI can contain any combination of R.sup.1, R.sup.2, R.sup.3, R.sup.4, and R.sup.5 set forth above, but are not limited to such combinations. In some embodiments, R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently selected from the group consisting of NHAc and OH. In some embodiments, R.sup.5 is selected from the group consisting of NHR.sup.5a, OH, and OAc. In some embodiments, R.sup.5 is NHAc.
(163) Any suitable CMP-sialic acid synthetase (i.e., N-acylneuraminate cytidylyltransferase, EC 2.7.7.43, also referred to as CSS) can be used in the methods for forming the sialosides disclosed herein. For example, CMP-sialic acid synthetases from E. coli, C. thermocellum, S. agalactiae, or N. meningitidis can be used. In some embodiments, the CMP sialic acid synthetase is Neisseria meningitidis CMP-sialic acid synthetase (NmCSS).
(164) In some embodiments, the CMP-sialic acid synthetase is NmCSS (NCBI Accession No. WP_025459740.1) or a catalytically active variant thereof. In some embodiments, the CMP-sialic acid synthetase comprises the polypeptide sequence: EKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEE AKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAF SLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNG AIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILHHKES (SEQ ID NO: 5), or a catalytically active variant thereof.
(165) Any suitable sialyltransferase (also referred to as ST) can be used in the methods for forming the sialosides disclosed herein. In some embodiments, the sialyltransferase is a beta-galactoside alpha-2,3-sialyltransferases belonging to Glycosyltransferase family 80 (GT80 using CAZy nomenclature), which catalyzes the following conversion: CMP-sialic acid+-D-galactosyl-R=CMP+-sialic acid-(2.fwdarw.3)--D-galactosyl-R, where the acceptor is GalOR, where R is H, a monosaccharide, an oligosaccharide, a polysaccharide, a glycopeptide, a glycoprotein, a glycolipid, or a hydroxyl-containing compound. GT80 family sialyltransferases also include galactoside or N-acetylgalactosaminide alpha-2,6-sialyltransferases that catalyze the following conversion: CMP-sialic acid+galactosyl/GalNAc-R=CMP+-sialic acid-(2.fwdarw.6)--D-galactosyl/GalNAc-R, where the acceptor is GalOR or GalNAcOR, where R is H, serine or threonine on a peptide or protein, a monosaccharide, an oligosaccharide, a polysaccharide, a glycopeptide, a glycoprotein, a glycolipid, or a hydroxyl-containing compound.
(166) Sialyltransferases in family EC 2.4.99, such as beta-galactosaminide alpha-2,6-sialyltransferase (EC 2.4.99.1), alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (EC 2.4.99.3), beta-galactoside alpha-2,3-sialyltransferase (EC 2.4.99.4), N-acetyllactosaminide alpha-2,3-sialyltransferase (EC 2.4.99.6), alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase (EC 2.4.99.8), and lactosylceramide alpha-2,3-sialyltransferase (EC 2.4.99.9), can also be used in the methods for preparing sialosides.
(167) In some embodiments, the sialyltransferase is selected from the group consisting of PmST1, a PmST1 variant, PmST2, a PmST2 variant, PmST3, a PmST3 variant, Pd2,6ST, Psp2,6ST, CstII, and a polysialyltransferase.
(168) In some embodiments, the sialyltransferase is PmST1 (NCBI Accession No. WP_005753497.1) or a catalytically active variant thereof. In some embodiments, the sialyltransferase is PmST1_M144D or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence: KTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKD NRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSD EYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLST DYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEV QQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPR GGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTS NKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQL (SEQ ID NO: 6), or a catalytically active variant thereof.
(169) In some embodiments, the sialyltransferase is PmST2 (UniProtKB Accession No. Q9CNC4) or a catalytically active variant thereof. PmST2 are variants thereof are described in U.S. Pat. No. 9,102,967, which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase comprises the polypeptide sequence: NLIICCTPLQVLIAEKIIAKFPHTPFYGVMLSTVSNKKFDFYAKRLAQQCQGFFSMVQ HKDRFNLLKEILYLKRTFSGKHFDQVFVANINDLQIQFLLSAIDFNLLNTFDDGTINIV PNSLFYQDDPATLQRKLINVLLGNKYSIQSLRALSHTHYTIYKGFKNIIERVEPIELVA ADNSEKVTSAVINVLLGQPVFAEDERNIALAERVIKQFNIHYYLPHPREKYRLAQVN YIDTELIFEDYILQQCQTHKYCVYTYFSSAIINIMNKSDNIEVVALKIDTENPAYDACY DLFDELGVNVIDIRE (SEQ ID NO: 7), or a catalytically active variant thereof.
(170) In some embodiments, the sialyltransferase is PmST3 or a catalytically active variant thereof, as described in U.S. Pat. No. 9,783,838, which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase is PmST3A35 or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence: DKFAEHEIPKAVIVAGNGESLSQIDYRLLPKNYDVFRCNQFYFEERYFLGNKIKAVFF TPGVFLEQYYTLYHLKRNNEYFVDNVILSSFNHPTVDLEKSQKIQALFIDVINGYEKY LSKLTAFDVYLRYKELYENQRITSGVYMCAVAIAMGYTDIYLTGIDFYQASEENYAF DNKKPNIIRLLPDFRKEKTLFSYHSKDIDLEALSFLQQHYHVNFYSISPMSPLSKHFPIP TVEDDCETTFVAPLKENYINDILLVDKLAAALE (SEQ ID NO: 8), or a catalytically active variant thereof.
(171) In some embodiments, the sialyltransferase is Psp2,6ST or a catalytically active variant thereof, as described in U.S. Pat. Appl. Pub. No. 2016/0177275, which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase is Psp26ST(15-501) A366G or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence: CNNSEENTQSIIKNDINKTIIDEEYVNLEPINQSNISFTKHSWVQTCGTQQLLTEQNKES ISLSVVAPRLDDDEKYCFDFNGVSNKGEKYITKVTLNVVAPSLEVYVDHASLPTLQQ LMDIIKSEEENPTAQRYIAWGRIVPTDEQMKELNITSFALINNHTPADLVQEIVKQAQ TKHRLNVKLSSNTAHSFDNLVPILKELNSFNNVTVTNIDLYDDGSAEYVNLYNWRDT LNKTDNLKIGKDYLEDVINGINEDTSNTGTSSVYNWQKLYPANYHFLRKDYLTLEPS LHELRDYIGDSLKQMQWDGFKKFNSKQQELFLSIVNFDKQKLQNEYNSSNLPNFVFT GTTVWAGNHEREYYAKQQINVINNAINESSPHYLGNSYDLFFKGHPGGGIINTLIMQ NYPSMVDIPSKISFEVLMMTDMLPDAVAGIASSLYFTIPAEKIKFIVFTSTETITDRETA LRSPLVQVMIKLGIVKEENVLFWA (SEQ ID NO: 9), or a catalytically active variant thereof.
(172) In some embodiments, the sialyltransferase is Pd2,6ST (GenBank Accession No. BAA25316) or a catalytically active variant thereof. Pd2,6ST are variants thereof are described, for example by Sun and Chen, et al. (Biotechnol Lett (2008) 30:671-676), which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase is 15Pd2,6ST(N) or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence: CNSDNTSLKETVSSNSADVVETETYQLTPIDAPSSFLSHSWEQTCGTPILNESDKQAIS FDFVAPELKQDEKYCFTFKGITGDHRYITNTTLTVVAPTLEVYIDHASLPSLQQLIHIIQ AKDEYPSNQRFVSWKRVTVDADNANKLNIHTYPLKGNNTSPEMVAAIDEYAQSKN RLNIEFYTNTAHVFNNLPPIIQPLYNNEKVKISHISLYDDGSSEYVSLYQWKDTPNKIE TLEGEVSLLANYLAGTSPDAPKGMGNRYNWHKLYDTDYYFLREDYLDVEANLHDL RDYLGSSAKQMPWDEFAKLSDSQQTLFLDIVGFDKEQLQQQYSQSPLPNFIFTGTTT WAGGETKEYYAQQQVNVINNAINETSPYYLGKDYDLFFKGHPAGGVINDIILGSFPD MINIPAKISFEVLMMTDMLPDTVAGIASSLYFTIPADKVNFIVFTSSDTITDREEALKSP LVQVMLTLGIVKEKDVLFWA (SEQ ID NO: 10), or a catalytically active variant thereof.
(173) In some embodiments, the sialyltransferase is CstII (GenBank Accession No. CS299360) or a catalytically active variant thereof. CstII are variants thereof are described by Cheng and Chen, et al. (Glycobiology, 18(9): 686-697, 2008), which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase is C-His.sub.6-tagged CstII-32.sup.I53S (SEQ ID NO: 1) or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence: KKVIIAGNGPSLKEIDYSRLPNDFDVFRCNQFYFEDKYYLGKKCKAVFYNPSLFFEQY YTLKHLIQNEYETELIMCSNYNQAHLENENFVKTFYDYFPDAHLGYDFFKQLKDFNA YFKFHEIYFNQRITSGVYMCAVAIALGYKEIYLSGIDFYQNGSSYAFDTKQKNLLKLA PNFKNDNSHYIGHSKNTDIKALEFLEKTYKIKLYCLCPNSLLANFIELAPNLMSNFIIQ EKNNYTKDILIPSSEAYGKFSKNIN (SEQ ID NO: 11), or a catalytically active variant thereof.
(174) Sialidases can also be use in methods for forming sialic acids, as described above. In some embodiments, the sialidase is SpNanB (NCBI Accession No. NP_359124.1) or a catalytically active variant thereof. In some embodiments, the sialidase comprises the polypeptide sequence: NELNYGQLSISPIFQGGSYQLNNKSIDISPLLLDKLSGDSQTVVMKFKADKPNSLQAL FGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQKGINYLFSRPASLWGKHKGQAVEN TLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNINGIDKATLGAVNREGKEHYLAK GSIDEISLFNKAISDQEVSTIPLSNPFQLIFQSGDSTQANYFRIPTLYTLSSGRVLSSIDAR YGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFNDYEEQLVYWPRDNKLKNSQISG SASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADSGFKEINGHYYLKLKKNGD NDFRYTVRENGVVYDETTNKPTNYTINDKYEVLEGGKSLTVEQYSVDFDSGSLRER HNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPFLGEKHNGTYL CPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFENATAEAQMVELR DGVIRTFFRTTTGKIAYMTSRDSGETWSEVSYIDGIQQTSYGTQVSAIKYSQLIDGKE AVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELPNHHI GVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK (SEQ ID NO: 12), or a catalytically active variant thereof.
(175) In some embodiments, the sialidase is SpNanC (NCBI Accession No. WP_024478413.1) or a catalytically active variant thereof. In some embodiments, the sialidase comprises the polypeptide sequence: KKNIKQYVTLGTVVVLSAFVANSVAAQETETSEVSTPELVQPVAPTTSISEVQHKSGN SSEVTVQPRTVETTVKDPSSTAEETLVLEKNNVTLTGGGENVTKELKDKFTSGDFTV VIKYNQSSEKGLQALFGISNSKPGQQNSYVDVFLRDNGELGMEARDTSSNKNNLVSR PASVWGKYKQEAVTNTVAVVADSVKKTYSLYANGTKVVEKKVDNFLNIKDIKGID YYMLGGVKRAGKTAFGFNGTLENIKFFNSALDEETVKKMTTNAVTGHLIYTANDTT GSNYFRIPVLYTFSNGRVFSSIDARYGGTHDFLNKINIATSYSDDNGKTWTKPKLTLA FDDFAPVPLEWPREVGGRDLQISGGATYIDSVIVEKKNKQVLMFADVMPAGVSFRE ATRKDSGYKQIDGNYYLKLRKQGDTDYNYTIRENGTVYDDRTNRPTEFSVDKNFGI KQNGNYLTVEQYSVSFENNKKTEYRNGTKVHMNIFYKDALFKVVPTNYIAYISSND HGESWSAPTLLPPIMGLNRNAPYLGPGRGIIESSTGRILIPSYTGKESAFIYSDDNGAS WKVKVVPLPSSWSAEAQFVELSPGVIQAYMRTNNGKIAYLTSKDAGTTWSAPEYLK FVSNPSYGTQLSIINYSQLIDGKKAVILSTPNSTNGRKHGQIWIGLINDDNTIDWRYHH DVDYSNYGYSYSTLTELPNHEIGLMFEKFDSWSRNELHMKNVVPYITFKIEDLKKN (SEQ ID NO: 13), or a catalytically active variant thereof.
(176) In some embodiments, the sialidase is S. pneumoniae TIGR4 SpNanC (NCBI Accession No. AAK75424.1) or a catalytically active variant thereof. In some embodiments, the sialidase comprises the polypeptide sequence:
(177) TABLE-US-00002 (SEQIDNO:14) KKNIKQYVTLGTVVVLSAFVANSVAAQETETSEVSTPKLVQPVAPTTPIS EVQPTSDNSSEVTVQPRTVETTVKDPSSTAEETPVLEKNNVTLTGGGENV TKELKDKFTSGDFTVVIKYNQSSEKGLQALFGISNSKPGQQNSYVDVFLR DNGELGMEARDTSSNKNNLVSRPASVWGKYKQEAVTNTVAVVADSVKKTY SLYANGTKVVEKKVDNFLNIKDIKGIDYYMLGGVKRAGKTAFGFNGTLEN IKFFNSALDEETVKKMTTNAVTGHLIYTANDTTGSNYFRIPVLYTFSNGR VFSSIDARYGGTHDFLNKINIATSYSDDNGKTWTKPKLTLAFDDFAPVPL EWPREVGGRDLQISGGATYIDSVIVEKKNKQVLMFADVMPAGVSFREATR KDSGYKQIDGNYYLKLRKQGDTDYNYTIRENGTVYDDRTNRPTEFSVDKN FGIKQNGNYLTVEQYSVSFENNKKTEYRNGTKVHMNIFYKDALFKVVPTN YIAYISSNDHGESWSAPTLLPPIMGLNRNAPYLGPGRGIIESSTGRILIP SYTGKESAFIYSDDNGASWKVKVVPLPSSWSAEAQFVELSPGVIQAYMRT NNGKIAYLTSKDAGTTWSAPEYLKFVSNPSYGTQLSIINYSQLIDGKKAV ILSTPNSTNGRKHGQIWIGLINDDNTIDWRYHHDVDYSNYGYSYSTLTEL PNHEIGLMFEKFDSWSRNELHMKNVVPYITFKIEDLKKN.
(178) In some embodiments, galactoside R.sup.6 is bonded to the compound via a 2-3 linkage or a 2-6 linkage; or wherein N-acetylglucosaminide R.sup.6 is bonded to the compound via a 2-6 linkage; or wherein glucoside R.sup.6 is bonded to the compound via a 2-6 linkage; or wherein N-acetylglucosaminide R.sup.6 is bonded to the compound via a 2-6 linkage.
(179) In some embodiments, R.sup.6 is a sialoside comprising a Sia-2,3-Gal moiety, a Sia-2,8-Sia moiety, or a Sia-2,9-Sia moiety, wherein each Sia is independently selected from Neu5Ac, Kdn, and Neu5Gc.
(180) In some embodiments, R.sup.6 is present as a member of an oligosaccharide, a polysaccharide, a glycopeptide, a glycoprotein, or a glycolipid.
(181) Methods for preparing N-acetyl sialic acids sialosides generally include providing reaction mixtures that contain the one or more enzymes as described herein, e.g., a sialic acid aldolase (SAA), a CMP-sialic acid synthetase (CSS) or a sialyltransferase (ST). An SAA, a CSS, or an ST can be, for example, isolated or otherwise purified prior to addition to the reaction mixture. As used herein, a purified enzyme refers to an enzyme which is provided as a purified protein composition wherein the enzyme constitutes at least about 50% of the total protein in the purified protein composition. For example, the enzyme can constitute about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the total protein in the purified protein composition. In some embodiments, the enzymes in the reaction mixture are provided as purified protein compositions wherein the enzyme constitutes at least about 95% of the total protein in purified protein composition (prior to addition to the reaction mixture). The amount of the enzyme in a purified protein composition can be determined by any number of known methods including, for example, by polyacrylamide gel electrophoresis (e.g., SDS-PAGE) followed by detection with a staining reagent (e.g., Coomassie Brilliant Blue G-250, a silver nitrate stain, and/or a reagent containing a Psp26ST antibody). The enzymes used in the methods for forming sialosides can also be secreted by a cell present in the reaction mixture. Alternatively, the enzymes can catalyze the reaction within a cell expressing the variant.
(182) Reaction mixtures can contain additional reagents for use in glycosylation techniques. For example, in certain embodiments, the reaction mixtures can contain buffers (e.g., 2-(N-morpholino)ethanesulfonic acid (MES), 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid (HEPES), 3-morpholinopropane-1-sulfonic acid (MOPS), 2-amino-2-hydroxymethyl-propane-1,3-diol (TRIS), potassium phosphate, sodium phosphate, phosphate-buffered saline, sodium citrate, sodium acetate, and sodium borate), cosolvents (e.g., dimethylsulfoxide, dimethylformamide, ethanol, methanol, tetrahydrofuran, acetone, and acetic acid), salts (e.g., NaCl, KCl, CaCl.sub.2), and salts of Mn.sup.2+ and Mg.sup.2+), detergents/surfactants (e.g., a non-ionic surfactant such as N,N-bis[3-(D-gluconamido)propyl]cholamide, polyoxyethylene (20) cetyl ether, dimethyldecylphosphine oxide, branched octylphenoxy poly(ethyleneoxy)ethanol, a polyoxyethylene-polyoxypropylene block copolymer, t-octylphenoxypolyethoxyethanol, polyoxyethylene (20) sorbitan monooleate, and the like; an anionic surfactant such as sodium cholate, N-lauroylsarcosine, sodium dodecyl sulfate, and the like; a cationic surfactant such as hexdecyltrimethyl ammonium bromide, trimethyl(tetradecyl) ammonium bromide, and the like; or a zwitterionic surfactant such as an amidosulfobetaine, 3-[(3-cholamidopropyl)dimethyl-ammonio]-1-propanesulfonate, and the like), chelators (e.g., ethylene glycol-bis(2-aminoethylether)-N,N,N,N-tetraacetic acid (EGTA), 2-({2-[bis(carboxymethyl)amino]ethyl} (carboxymethyl)amino)acetic acid (EDTA), and 1,2-bis(o-aminophenoxy)ethane-N,N,N,N-tetraacetic acid (BAPTA)), reducing agents (e.g., dithiothreitol (DTT), -mercaptoethanol (BME), and tris(2-carboxyethyl)phosphine (TCEP)), and labels (e.g., fluorophores, radiolabels, and spin labels). Buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels can be used at any suitable concentration, which can be readily determined by one of skill in the art. In general, buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels are included in reaction mixtures at concentrations ranging from about 1 M to about 1 M. For example, a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, or a label can be included in a reaction mixture at a concentration of about 1 M, or about 10 M, or about 100 M, or about 1 mM, or about 10 mM, or about 25 mM, or about 50 mM, or about 100 mM, or about 250 mM, or about 500 mM, or about 1 M. In some embodiments, the reaction mixture can contain CTP, a CSS, an ST, a compound according to Formula V, and an acceptor according to Formula VI as described herein, and one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, and a label. In some embodiments, the reaction mixture can contain CTP, a CSS, an ST, a compound according to Formula V, and an acceptor according to Formula VI as described herein, and one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent. In some embodiments, the reaction mixture consists essentially of CTP, a CSS, an ST, a compound according to Formula V, and an acceptor according to Formula VI as described herein, and one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent.
(183) The enzymatic reactions can be conducted at any suitable temperature. In general, the reactions are conducted at a temperature of from about 4 C. to about 40 C. The reactions can be conducted, for example, at about 25 C. or about 37 C. The reactions can be conducted at any suitable pH. In general, the reactions are conducted at a pH of from about 4.5 to about 10. The reactions can be conducted, for example, at a pH of from about 5 to about 9. The reactions can be conducted for any suitable length of time. In general, the reaction mixtures are incubated under suitable conditions for anywhere between about 1 minute and several hours. The reactions can be conducted, for example, for about 1 minute, or about 5 minutes, or about 10 minutes, or about 30 minutes, or about 1 hour, or about 2 hours, or about 4 hours, or about 8 hours, or about 12 hours, or about 24 hours, or about 48 hours, or about 72 hours. Other reaction conditions may be employed in the methods of the invention, depending on the identity of a particular enzymes, sialic acids, or acceptor molecules employed.
VIII. Cellular Metabolic Incorporation of Free N-Acetyl and O-Acetyl Sialic Acids
(184) Free sialic acids added to culture media are taken up by cells via macropinocytosis and transported into the cytosol by the lysosomal transporter sialin. The cytosolic sialic acids can then be activated into CMP-Sias and utilized for biosynthesis, as if they were endogenously produced. Incorporation and cell surface expression of the sialic acids can then be detected by flow cytometry using specific probes (informed by glycan array studies as described herein), and also by biochemical analysis via derivatization with DMB and HPLC analysis of the fluorescent adducts. Free and CMP bound Sias can be differentiated by borohydride reduction without prior acid hydrolysis (CMP-Sias are resistant). Sias incorporated into glycans can be detected after being released by acid hydrolysis and/or use of specific sialidases.
(185) BJA-B human lymphoma cells, Chinese Hamster Ovary (CHO) cells, or their counterparts incapable of endogenous sialic acid production (due to UDP-N-acetylglucosainne 2-epimerase/N-acetylmannosamine kinase deficiency can be cultured in presence of chemoenzymatically synthesized Neu5Ac4NAc, Neu5Ac7NAc, Neu5Ac8NAc, Neu5Ac9NAc, Neu5Ac7,9NAc.sub.2 or Neu5Ac8,9NAc.sub.2 for monitoring of metabolic incorporation, followed by pulse-chase analysis. Corresponding O-acetylated Neu5Ac counterparts can also be studied in this manner.
(186) Accordingly, another aspect of the invention provides a method for sialylating the surface of a cell. The method includes culturing the cell in the presence of a sialic acid compound as described herein (e.g., a compound of Formula I, Formula Ia, or Formula II) under conditions sufficient to covalently link the compound to the surface of the cell
(187) A method for sialylating a glycoprotein is also provided. The method includes forming a mixture comprising the glycoprotein, a sialic acid compound as described herein (e.g., a compound of Formula I, Formula Ia, or Formula II), and a sialyltransferase under conditions sufficient to covalently bond the compound to the glycoprotein.
(188) In a related aspect, a method for sialylating a glycolipid is provided. The method includes forming a mixture comprising the glycolipid, a sialic acid compound as described herein (e.g., a compound of Formula I, Formula Ia, or Formula II), and a sialyltransferase under conditions sufficient to covalently bond the compound to the glycolipid.
IX. Glycan Microarrays
(189) p-Nitrophenol-tagged sialosides (e.g., Neu5Ac9NAc3GalpNP and Neu5Ac9NAc6GalpNP) can be used for substrate specificity studies of various sialidases using a microtiter-plate-based colorimetric high-throughput screening method. In this method, pNP-tagged sialosides obtained by the chemical and/or enzymatic routes described above are incubated with a sialidase and an excess amount of exogalactosidase. When the sialoside is a substrate for the sialidase, the terminal sialic acid residue is cleaved by the sialidase to produce GalpNP, which is quickly hydrolyzed by the excess amount of galactosidase in the reaction mixture to produce para-nitrophenol (pNP) and Gal. Upon adjustment of the reaction mixture pH to higher than 9.6, the assay is stopped and the amount of the para-nitrophenolate formed is determined spectrophotometrically at A.sub.405 nm. The amount of the para-nitrophenolate formed is equivalent to that of the sialic acid released from the sialoside by the sialidase. A comparison of the color developed for different sialosides by different sialidases reveals the effect of the structural diversity of the sialoside substrate on the hydrolytic activity of different sialidases. Sia3GalpNP and Sia6GalpNP containing different N-acetylated derivatives of O-acetylneuraminic acid mimetics can be used to test the substrate specificities of various sialidases including those from humans, bacteria, and viruses.
(190) Propyl azide aglycones in sialosides of the invention can be reduced to an amino group by catalytic hydrogenation and printed on epoxide-derivatized slides using an appropriate printer (e.g., a SpotBot Extreme Microarray Spotter) with micron and sub-micron feature sizes. Glycans at a suitable concentration (e.g., 100 M) in a printing buffer (e.g., 300 mM phosphate buffer, pH 8.4) can be distributed into a 384-well source plate. Humidity level can be maintained at a desired level (e.g., 60-65% RH) during printing. Slides are then blocked by 0.1 M Tris-HCl, 0.05 M ethanolamine, pH 9.0 (50 C., 1 h), washed twice with 50 C. water, dried, packed, vacuum-sealed, and stored at RT until use.
X. Examples
(191) Materials. Cy3 and PE affinipure goat anti-human IgG (H+L) antibodies were obtained from Jackson ImmunoResearch Laboratories. Arthrobacter ureafaciens sialidase (AUS) and Vibrio cholerae neuraminidase were purchased from EY Labs and Roche, respectfully. Chemical and biological material were purchased from commercial sources and used as received. Nuclear Magnetic Resonance (NMR) spectra were recorded in the NMR facility of the University of California, Davis on a Bruker Avance-400 NMR spectrometer (400 MHz for .sup.1H, 100 MHz for .sup.13C). Chemical shifts are reported in parts per million (ppm) on the scale. High resolution electrospray ionization (ESI) mass spectra were obtained using a Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility at the University of California, Davis. Column chromatography was performed using RediSep Rf silica columns or an ODS-SM column (51 g, 50 m, 120 , Yamazen) on the CombiFlash Rf 200i system. Thin layer chromatography (TLC) was performed on silica gel plates (Sorbent Technologies) using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm2.5 cm) packed with Bio-Gel P-2 Fine resins (Bio-Rad). Pasteurella multocida sialic acid aldolase (PmNanA), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), and Pasteurella multocida sialyltransferase 1 M144D mutant (PmST1 M144D) were expressed and purified as described previously.
Example 1. Chemical Synthesis of Neu5Ac9NAc Precursor 6-Acetamido-6-deoxy-N-acetylmannosamine (ManNAc6NAc) and Enzymatic Synthesis of Neu5Ac9NAc
(192) A new efficient chemoenzymatic synthetic strategy was developed for the synthesis of Neu5Ac9NAc. The design was to chemically synthesize ManNAc6NAc, a precursor of Neu5Ac9NAc, followed by a sialic acid aldolase-catalyzed reaction for the synthesis of desired Neu5Ac9NAc. ManNAc6NAc was synthesized in a 82% yield from previously obtained 6-azido-6-deoxy-N-acetylmannosamine (ManNAc6N.sub.3) ENREF_46 using a simple one step reduction and simultaneous acetylation process achieved by adding thioacetic acid to a pyridine solution containing ManNAc6N.sub.3. ENREF_47 Neu5Ac9NAc was readily obtained from ManNAc6NAc and pyruvate with a 78% yield using a reaction catalyzed by a sialic acid aldolase from Pasteurella multocida (PmAldolase).
(193) Synthesis of 2,6-Diacetamido-2,6-dideoxy-D-mannopyranose (ManNAc6NAc) from 2-Acetamido-6-azido-2,6-dideoxy-D-mannopyranose (ManNAc6N.sub.3). To a solution of ManNAc6N.sub.3 ENREF_46 (300 mg, 1.14 mmol) in pyridine (8 mL), thioacetic acid (2 mL) was added and the mixture was stirred at room temperature for 24 h. The solvent was concentrated in vacuo. The crude product was purified by column chromatography (ethyl acetate/methanol=3:1) to produce ManNAc6NAc (262 mg, 82%) as a colorless amorphous solid. .sup.1H NMR (400 MHz, D.sub.2O) -isomer: 5.10 (d, J=1.5 Hz, 1H), 4.31 (dd, J=4.7, 1.5 Hz, 1H), 4.04 (dd, J=9.8, 4.7 Hz, 1H), 3.96-3.86 (m, 1H), 3.68-3.33 (m, 3H), 2.07 (s, 3H), 2.03 (s, 3H); -isomer: 5.00 (d, J=1.7 Hz, 1H), 4.46 (dd, J=4.5, 1.7 Hz, 1H), 3.82 (dd, J=9.0, 4.5 Hz, 1H), 3.68-3.33 (m, 4H), 2.11 (s, 3H), 2.04 (s, 3H); .sup.13C NMR (100 MHz, D.sub.2O) 175.70, 174.77, 174.54, 174.53, 93.01, 74.43, 71.73, 70.24, 68.58, 68.49, 68.20, 53.98, 53.21, 40.27, 40.16, 22.04, 21.90, 21.77; HRMS (ESI) Anal. Calcd for C.sub.10H.sub.19N.sub.2O.sub.2 [M+H].sup.+: 263.1243, Found: 263.1241.
(194) ##STR00040##
(195) Synthesis of 5,9-Diacetamido-3,5,9-Trideoxy-D-glycero-D-galacto-2-nonulopyranosylonic Acid (Neu5Ac9NAc). To a solution (10 mL) containing ManNAc6NAc (50 mg, 0.19 mmol), sodium pyruvate (210 mg, 1.9 mmol), and Tris-HCl buffer (100 mM, pH 7.5), PmAldolase (3.0 mg) was added and the reaction was incubated in an isotherm incubator for 48 h at 37 C. with agitation at 100 rpm. The reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 C. for 1 h. The solvent was removed and the crude product was purified by column chromatography (ethyl acetate/methanol/water=4:2:1) and followed by a short BioGel P-2 gel filtration column to give Neu5Ac9NAc (55.4 mg, 78%) as a colorless amorphous solid. .sup.1H NMR (400 MHz, D.sub.2O) 4.06-3.92 (m, 3H, H-4, H-6, H-5), 3.80 (ddd, J=9.0, 7.7, 3.1 Hz, 1H, H-8), 3.59 (dd, J=14.1, 3.1 Hz, 1H, H-9), 3.44 (dd, J=9.0, 1.1 Hz, 1H, H-7), 3.24 (dd, J=14.1, 7.6 Hz, 1H, H-9), 2.22 (dd, J=12.9, 4.8 Hz, 1H, H-3e), 2.06 (s, 3H, COCH.sub.3), 2.02 (s, 3H, COCH.sub.3), 1.83 (dd, J=12.9, 11.4 Hz, 1H, H-3a); .sup.13C NMR (100 MHz, D.sub.2O) 176.64, 174.68, 174.56, 96.36, 70.09, 69.77, 68.77, 67.25, 52.26, 42.76, 39.35, 22.08, 21.82; HRMS (ESI) Anal. Calcd for C.sub.13H.sub.21N.sub.2O.sub.9 [MH].sup.: 349.1247, Found: 349.1255.
Example 2. One-pot Multienzyme (OPME) Synthetic Approach for Facile Production of Neu5Ac9NAc3Gal4GlcProNH.SUB.2 .for Glycan Microarray Studies
(196) ManNAc6NAc was also used directly for synthesizing a sialoside analog Neu5Ac9NAc3Gal4GlcProN.sub.3 via an efficient one-pot multienzyme (OPME) sialylation system containing PmAldolase, ENREF_45 a CMP-sialic acid synthetase from Neisseria meningitidis (NmCSS), ENREF_44 and Pasteurella multocida sialyltransferase 1 M144D mutant (PmST1 M144D). Neu5Ac9NAc3Gal4GlcProN.sub.3 was obtained in 84% yield and was readily converted in a quantitative yield to Neu5Ac9NAc3Gal4GlcProNH.sub.2 by catalytic hydrogenation using H.sub.2 in the presence of Pd/C.
(197) Synthesis of 3-Azidopropyl O-(5,9-Diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.4)--D-glucopyranoside (Neu5Ac9NAc3Gal4GlcProN.sub.3). Neu5Ac9NAc3Gal4GlcProN.sub.3 was synthesized following the general procedure for enzymatic synthesis of sialosides. Gal4GlcProN.sub.3 ENREF_4 ((46 mg, 0.11 mmol), ManNAc6NAc (43 mg, 0.16 mmol), sodium pyruvate (91 mg, 0.83 mmol) and CTP (87 mg, 0.16 mmol) were dissolved in Tris-HCl buffer (100 mM, pH 8.5, 10 mL) containing 20 mM of MgCl.sub.2. The pH of the solution was further adjusted to 8.5 with 4 M NaOH. PmAldolase (1.5 mg), NmCSS (2.5 mg) and PmST1 M144D (2.5 mg) were added. The reaction was incubated in an isotherm incubator for 24 h at 37 C. with agitation at 100 rpm. The reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 C. for 1 h. The formed precipitates were removed by centrifugation and the supernatant was concentrated. The residue was purified by passing through a BioGel P-2 gel filtration column followed by a C18 column (H.sub.2O/CH.sub.3CN=10:1) (70.9 mg, Yield 84%). .sup.1H NMR (400 MHz, D.sub.2O) 4.52 (dd, J=12.8, 7.9 Hz, 2H), 4.10 (dd, J=9.9, 3.2 Hz, 1H), 4.06-3.86 (m, 4H), 3.88-3.53 (m, 13H), 3.54-3.43 (m, 3H), 3.37-3.23 (m, 2H), 2.76 (dd, J=12.4, 4.6 Hz, 1H), 2.04 (s, 3H), 2.04 (s, 3H), 1.92 (p, J=6.6 Hz, 2H), 1.81 (t, J=12.1 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.92, 174.39, 173.81, 102.60, 102.11, 99.87, 78.17, 75.53, 75.14, 74.78, 74.33, 72.79, 72.73, 69.96, 69.58, 69.36, 68.30, 67.46, 67.34, 61.01, 60.01, 51.66, 47.86, 42.11, 39.61, 28.22, 22.02, 21.81; HRMS (ESI) Anal. Calcd for C.sub.28H.sub.46N.sub.5O.sub.19 [MH].sup.: 756.2787, Found: 756.2792.
(198) Synthesis of 3-Aminopropyl O-(5,9-Diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.4)--D-glucopyranoside (Neu5Ac9NAc3Gal4GlcProNH.sub.2). A catalytic amount of 10% palladium on charcoal (Pd/C) was added to the solution of Neu5Ac9NAc3Gal4GlcProN.sub.3 (5.6 mg) in H.sub.2O (1 mL). The mixture was stirred under hydrogen atmosphere for 3 h. The solution was diluted with MeOH (2 mL) and passed through a filter to remove the catalyst. The solvent was concentrated in vacuo to give Neu5Ac9NAc3Gal4GlcProNH.sub.2 (5.4 mg, quant.) as a colorless amorphous solid. HRMS (ESI) Anal. Calcd for C28H.sub.48N.sub.3O.sub.19 [MH].sup.: 730.2882, Found: 730.2914.
(199) ##STR00041##
(200) Reduction of Neu5,9Ac.sub.23Gal4GlcProN.sub.3 to Neu5,9Ac.sub.23Gal4GlcProNH.sub.2. Neu5,9Ac.sub.23Gal4GlcProN.sub.3 (20 mg) was dissolved in H.sub.2O/MeOH (3 mL, 2:1 by volume) and a drop of glacial acetic acid was added. The mixture was stirred under hydrogen atmosphere in the presence of 10% palladium on charcoal for 1 h. The reaction mixture was then passed through a HyperSep C18 cartridge (1 g, 40-60 m, Thermo) and eluted with water. The collection fraction containing the desired product was collected and lyophilized. The obtained white power was stored at 20 C. for long-term storage.
(201) HPLC Analysis of Neu5,9Ac.sub.23Gal4GlcProNH.sub.2. Neu5,9Ac.sub.23Gal4GlcProNH.sub.2 was first hydrolyzed in glacial acetic acid (2 M) for 3 h at 80 C. AUS hydrolysis was performed based on the company protocol. DMB derivatization was performed as reported previously. ENREF_68 The DMB-derivatized samples were analyzed on a Dionex Ultra3000 HPLC System using a Phenomenex Gemini 5 m C18 2504.6 mm HPLC column at room temperature. The fluorescence was detected at 448 nm using excitation at 373 nm.
Example 3. Preparation of Hemagglutinin-Esterase Probes for 9-OAc Sia
(202) The sequences for expressing the ectodomains of the hemagglutinin-esterase (HE) of two nidoviruses (PToV-P4 and BCoV-Mebus) were synthesized by GenScript (Piscataway, NJ), with varied degrees of insect codon optimization. To generate the probe molecules, the esterase domains were inactivated by changing the active site of the Ser residue to Ala by site-directed mutagenesis using Q5 mutagenesis (New England Biolabs). The HE proteins were linked to the baculovirus gp64 signal sequence peptide at their N-termini, and the C-terminus fused to a linker containing a thrombin cleavage sequence, the Fc domain of Human IgG1, and a 6-His sequence (SEQ ID NO: 1). Constructs were cloned into pFastBac-1 (Life Technologies) to generate recombinant bacmids following the manufacturer's protocol. Recombinant baculoviruses were recovered by transfection of the bacmids into Sf9 insect cells using Cellfectin II (Life Technologies). Viruses were used to infect suspension High Five cells and the supernatant harvested 2-3 days post-infection. The proteins were purified by binding to a HiTrap ProteinG HP 5 ml column (GE Healthcare Life Sciences, Piscataway, NJ) and eluted with 0.1M citrate, pH 3.0 (pH neutralization to 7.8 with 1 M of Tris-HCl, pH 9.0) using AKTA FPLC system (GE Healthcare Life Sciences). The HE-Fc containing fractions were dialyzed in PBS and concentrated using 30 kD Amicon Ultra-15 filters (EMD Millipore). Purified proteins were stored at 80 C. in aliquots.
Example 4. Glycan Microarray Studies of Viral Proteins and Human Siglec-9 Binding to Sialosides Containing Neu5,9Ac.SUB.2 .and Neu5Ac9NAc
(203) The synthesized glycan Neu5Ac9NAc3Gal4GlcProNH.sub.2 was used in a glycan library for glycan microarray studies. Glycan microarrays were fabricated using epoxide-derivatized slides (Corning by Thermo Fisher Scientific) and Arrayit SpotBot Extreme Microarray Spotter. The arrays were printed with Stealth SMP3 microarray spotting pins from ArrayIt (Sunnyvale, CA, USA) generating 100 m diameter spots. 4 pins were used; with each pin printing 4 replicate spots/well. The glycoconjugates were prepared at 100 M concentration in an optimized printing buffer (300 mM phosphate buffer, pH 8.4). They were then distributed into a 384-well source plate in 20 L per well. To monitor printing quality, 4 replicate-wells of human IgG (Jackson ImmunoResearch) was used at 100 g/ml (in PBS) for each printing-pin. One complete array was printed on each slide (within approx 12 hour/28 slides). The humidity level in the arraying chamber was maintained at about 60-65% during printing. Printed slides were left on spotter deck overnight, allowing humidity to drop to ambient levels. Printed glycan microarray slides were blocked by 50 C. pre-warmed blocking solution (0.1 M Tris-HCl, 0.05 M ethanolamine, pH 9.0, 1 h). They were then washed twice with 50 C. pre-warmed water and dried. Slides were packed, vacuum-sealed and stored at RT until used.
(204) To assure the quality of the printed slides, one or two slides were used for quality control using antibodies, lectins and serum samples with known glycan binding specificity. For glycan array binding, slides were fitted in a multi-well microarray hybridization cassette (AHC4X8S, ArrayIt, Sunnyvale, CA, USA) to divide into 8 subarrays. The subarrays were blocked with Ovalbumin (1% w/v) in PBS (pH 7.4) for 1 h at RT, with gentle shaking. For the esterase activity studies on the array, after removing the blocking solution, slides were first treated with 20 g/mL PToV-P4-Fc (esterase active) in blocking buffer for 2 h at RT and then washed with PBS in 0.1% Tween 20 and then PBS (10 min/wash with shaking). Subsequently, diluted protein samples in blocking solution with various concentrations were added to each subarray (both esterase treated and non-treated slides). After incubating the protein samples for 2 h at RT with gentle shaking, the slides were washed with PBS in 0.1% Tween 20 and then PBS (10 min/wash with shaking). Cy3 affinipure goat anti-human IgG (H+L) antibody (Jackson ImmunoResearch) was used for the detection of BCoV-Mebus-Fc, PToV-P4-Fc and human Siglec-9-Fc. Diluted antibody in PBS was added to the subarrays and incubated for 1 h at RT. They were washed with PBS in 0.1% Tween 20, PBS and water (10 min/wash with shaking) and dried. The microarray slides were scanned using a Genepix 4000B microarray scanner (Molecular Devices Corp., Union City, CA, USA) at 100% laser power, PMT Gain 450 and 10 M pixels. Data analysis was performed using Genepix Pro 7.0 analysis software (Molecular Devices Corp., Union City, CA) and the outputs were saved as gpr and jpg files. The gpr files then were saved as xls. The data were further analyzed with Excel. Local background subtraction was performed and data were plotted separately for each subarray. The binding specificity to glycoconjugates for each protein was plotted based on the RFU (Relative Fluorescence Units), average fluorescence value for 4 replicates, versus glycan IDs. The standard deviations were calculated and the error bars were found for each glycan binding. The final graphs (
(205) Investigating and Minimizing 9-O-Acetyl Group Loss at Various Steps in Sample Preparation, Preparing and Using of Glycan Microarrays. The extent of de-O-acetylation at the final steps of the synthesis and entire glycan microarray process was investigated, for the model 9-OAc-glycan Neu5,9Ac.sub.23Gal4GlcProN.sub.3 and its reduced form Neu5,9Ac.sub.23Gal4GlcProNH.sub.2. The azide-containing glycan was analyzed using nuclear magnetic resonance (NMR) spectrometry and mass spectrometry (MS). It was found to be pure, without any loss of OAc group. The compound was then subjected to hydrogenolysis using H.sub.2 and PdC in water with a drop of glacial acetic acid. The reaction was completed in one hour as detected using MS. To minimize de-O-acetylation during the celite filtration step which uses Na.sub.2CO.sub.3 as a mild base, ENREF_33 filtration after catalytic hydrogenation was replaced by passing the reaction solution through a nylon syringe filter (0.2 m). The product was then purified using a short C-18 cartridge (water as an eluant) instead of the commonly and previously used Bio-Gel purification, as it is faster. The fractions containing the pure product were collected and lyophilized. No noticeable loss of the O-acetyl group was observed using the improved procedures described above.
(206) Then, the reduced glycan was quantified for the OAc loss at each step of glycan microarray process. The results revealed that 45% of the OAc group was either lost from the 9-position of Neu5Ac or migrated to 7- and 8-positions of the sialic acid upon conventional analysis procedures including release of sialic acids with acetic acid, derivatization with 1,2-diamino-4,5-methylenedioxybenzene (DMB), followed by high performance liquid chromatography (HPLC) analysis of fluorescent adducts (
(207) Overall, definitive conclusions about binding of probes can therefore only be made where binding is exclusively to the O-acetylated sialoglycan spots and not to the corresponding non-O-acetylated ones, as discussed later. A more general conclusion is that, even under the most carefully managed handling by skilled experimentalists, some loss of 9-O-acetylation appears inevitable. Taken together with the knowledge that esterases of bacterial ENREF_36 and vertebrate ENREF_41 origin are very common in biological systems, there is an intractable problem facing the systematic study of the chemistry and biology of sialic acid 9-O-acetylation.
(208) Results. Proteins known to recognize Neu5,9Ac.sub.2 were tested including immunoglobulin Fc-fused human Siglec-9-Fc (hSiglec-9), as well as viral proteins (hemagglutinins in an esterase inactivated form) of porcine torovirus (PToV-P4-Fc, PToV) and bovine coronavirus (BCoV-Mebus-Fc, BCoV). The results were compared to those obtained using Neu5,9Ac.sub.23Gal4GlcProNH.sub.2, and Neu5Ac3Gal4GlcProNH.sub.2 lacking 9-modification at sialic acid as probes in the same slides (
Example 5. Incorporation of Neu5Ac9NAc and Neu5,9Ac.SUB.2 .in Cell-Surface Glycans
(209) Cell Culture and Sugar Supplementation. BJA-B K20 cells were propagated as suspension with RPMI 1640 medium, supplemented with 10% heat-inactivated fetal calf serum, 2 mM glutamine, 100 U of penicillin per mL, 100 g of streptomycin per mL in a humidified 5% CO.sub.2, 37 C. atmosphere as described previously. For medium supplementation, Neu5Ac9NAc and Neu5,9Ac.sub.2 were dissolved in PBS, titrated to a neutral pH and filter sterilized. The sugars were added at the indicated concentrations. For the sugar turnover experiments, the cells were fed as mentioned above and on day 0, the cell culture media was switched to RPMI 1640 medium, supplemented with 1% Nutridoma (Roche), 100 U of penicillin per mL and 100 g of streptomycin without Neu5Ac9NAc and Neu5,9Ac.sub.2.
(210) Flow Cytometry. Cells were washed with PBS and incubated with 10 g/mL of PToV probes in PBS with 1% BSA and 10 mM EDTA for 30 minutes on ice. Subsequently, cells were washed with PBS and incubated with PE goat anti-human IgG antibody for 30 minutes on ice. After an additional washing step, the cells were analyzed by FACSCalibur (BD).
(211) Feeding of Free Neu5Ac9NAc and Neu5,9Ac.sub.2 to Human Cells Followed by Measuring Cell Surface Incorporation with PToV Probes. Human Burkitt lymphoma B cells (BJA-B K20) cells are hypo-sialylated due to the lack of UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase, therefore maximizing exogenous sialic acid incorporation. After three days of feeding with either 1 mM of free Neu5Ac9NAc or Neu5,9Ac.sub.2, cells were probed with PToV-P4-Fc (PToV) with or without active esterase to measure cell surface incorporation of the sugars. Both Neu5Ac9NAc and Neu5,9Ac.sub.2 were detected on the cell surface, but only Neu5Ac9NAc-fed ones were resistant to virus-hemagglutinin-esterase activity (
(212) Feeding of Free Neu5Ac, Neu5,9Ac.sub.2, Neu5Ac9NAc to Human BJA-B K20 Cells Followed by Measuring Cell Surface Incorporation of Sialic Acids with DMB Derivatization and HPLC Analysis. BJA-B K20 cells were fed with 1 mM of Neu5Ac (
(213) Monitoring Turnover of Neu5Ac9NAc and Neu5,9Ac.sub.2 on the Cell Surface. After feeding BJA-B K20 cells for two days with either 1 mM of free Neu5Ac9NAc or Neu5,9Ac.sub.2, the sugars were removed from the cell culture medium (day 0) and the presence of the sialic acids on the cell surface was monitored for 4 days with the PToV (esterase inactive) probe (
(214) Feeding of Neu5Ac, Neu5,9Ac.sub.2, and Neu5Ac9NAc to Human BJA-B K20 Cells Followed by Measuring Cell Surface Incorporation with Human CD22-Fc. BJA-B K20 cells were fed with 3 mM of Neu5Ac, Neu5Ac9NAc, or Neu5,9Ac.sub.2. After 3 days of feeding, BJA-B K20 cells were probed with human CD22-Fc/Siglec-2 to detect ligands (
Example 6. Comparison of N-Acetylated and O-Acetylated Sialosides Using Molecular Dynamics
(215) The molecular dynamics simulations were carried out using the AMBER15 software suite, principally using tleap for setup and pmemd.cuda for dynamics. ENREF_69 The simulations employed the GLYCAM force field and TIP3P water model; the sialoside was solvated in a rectangular water box with roughly 1000 water molecules. The simulations used a 2.0 fs time step and a Langevin thermostat set to 298.15 K and a collision frequency of 1.0 ps.sup.1. The equilibration simulations used a Berendsen barostat set to 1.0 atm, a compressibility of 44.610.sup.6 bar.sup.1 and a time constant of 1.0 ps.sup.1; the production simulations were carried out at constant volume. The particle mesh Ewald method was used to treat long range electrostatics with a real-space cutoff of 8.0 .
(216) The parameters for the N-acetyl functional group were developed following the procedure outlined by Kirschner (J. Comput. Chem. 29, 622-655). The initial guess force field for Neu5Ac9NAc was constructed by replacing the 9-O-acetyl group with a copy of the 5-N-acetyl group and the corresponding force field parameters. After 100 ps of equilibration in the NPT ensemble, 50 ns of NVT dynamics were generated, and 50 snapshots at 1 ns intervals were saved. These snapshots were energy-minimized in the TeraChem software package with the dihedral angles constrained, employing the restricted Hartree-Fock method and 6-31G* basis set. ENREF_7 The energy-minimized geometries were used as input to a restrained electrostatic potential calculation carried out using the R.E.D. server using the RESP-C.sub.2 charge model as appropriate for the GLYCAM force field. ENREF_55 In the charge optimization, the charges for the terminal hydroxyl group were kept at the initial values and all hydrogen charges set to zero. The resulting final set of charges on the N-acetyl group has a slightly different total charge from the original 0-acetyl group; the charge on the carbon atom that the N-acetyl group is bonded to is increased by +0.0014, instead of the +0.008 value used for O-acetyl. An analogous calculation was carried out for the ProN.sub.3 functional group to obtain a complete set of charges for Neu5,9Ac.sub.23Gal4GlcProN.sub.3. The valence force field parameters for ProN.sub.3 were copied over from the general AMBER force field (GAFF) ENREF_75 by comparing GLYCAM atom types to GAFF atom types.
(217) After the parameterization was finished, the production simulations of Neu5,9Ac.sub.23Gal4GlcProN.sub.3 and Neu5Ac9NAc3Gal4GlcProN.sub.3 were carried out to collect data for the free energy plots. The simulations were unbiased and each simulation ran for 2.5 s, and configurations were saved every 10 ps. The free energy plot was constructed by projecting the ensemble of configurations onto the selected dihedral degrees of freedom.
(218) Classical molecular dynamics (MD) simulations of Neu5,9Ac.sub.23Gal4GlcProN.sub.3 and Neu5Ac9NAc3Gal4GlcProN.sub.3 were carried out to investigate any differences that the chemical modification would introduce into the conformational ensemble in aqueous solution. The simulations were based on the GLYCAM carbohydrate force field and TIP3P water model, with added electrostatic parameters for describing the N-acetylation. The total length of the simulation exceeded 2 s for each of the two sialosides studied, which has previously been noted to provide good sampling of oligosaccharide conformational degrees of freedom.
(219)
(220) The classical MD simulation approximates the effect of the chemical modification as changing the force field parameters at the acetylation site. In particular, only the partial charges on the N-acetyl functional group are modified. To test this assumption, density functional theory was used to calculate the difference in electrostatic potential as a result of changing O-acetylation to N-acetylation. The results are shown in
(221) The O-acetylated sialoside appears to display a slightly higher amount of flexibility, as there exists a cluster of conformations at 3-4 kcal/mol higher in energy than the minimum (dotted box in
Example 7. One-Pot Three-Enzyme Synthesis of 2-3/6-Linked Sialosides
(222) To synthesize a library of Neu5Ac9NAc-containing 2-3- and 2-6-linked sialosides, chemically synthesized ManNAc6NAc was used directly in an efficient one-pot multienzyme (OPME) sialylation system containing Pasteurella multocida sialic acid aldolase (PmAldolase), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), and a sialyltransferase (Scheme 10).
(223) ##STR00042##
(224) In this system, PmAldolase was used to catalyze the aldol addition reaction of ManNAc6NAc and sodium pyruvate (used in an excess to drive the reaction towards sialic acid formation) to obtain Neu5Ac9NAc. NmCSS was used for catalyzing the formation of the activated sugar nucleotide donor, cytidine 5-monophosphate-Neu5Ac9NAc (CMP-Neu5Ac9NAc), for the subsequent sialyltransferase-catalyzed glycosylation reaction. Pasteurella multocida sialyltransferase 1 M144D mutant (PmST1 M144D) with decreased sialidase and donor hydrolysis activities was used for synthesizing 2-3-linked sialosides. Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST) or Photobacterium sp. 2-6-sialyltransferase A366G mutant (Psp2,6ST A366G) with an improved expression level was used for synthesizing 2-6-linked sialosides. The reactions were carried out in Tris-HCl buffer (100 mM) with a pH of 8.5 to optimize the activity of NmCSS while retain high activity of PmAldolase and sialyltransferases used. The products were obtained in good to excellent (61-98%) yields after purification using a gel filtration column and a C18 reverse phase column. The structures and the purities of the products were confirmed by high resolution mass spectrometry (HRMS) and nuclear magnetic resonance (NMR) spectroscopy.
(225) An acceptor (30-50 mg, 10 mM) and ManNAc6NAc (1.2-1.5 equiv.) were incubated at 37 C. in Tris-HCl buffer (100 mM) (pH 8.5 for synthesizing 2-3-sialosides or 2-6-sialosides using Psp2,6STA366G, pH 7.5 for synthesizing 2-6-sialosides using Pd2,6ST) containing sodium pyruvate (6.0-7.5 equiv.), CTP (1.5 equiv.), MgCl.sub.2 (20 mM), an appropriate amount of PmAldolase (1.5 mg), NmCSS (2.5 mg), and Pd2,6ST (2.5 mg), Psp2,6ST A366G mutant (2.5 mg), or PmST1 M144D mutant (2.5 mg). The reaction was monitored by thin-layer chromatography (TLC) using a developing solvent consisting of EtOAc:MeOH:H.sub.2O=5:2:1 (by volume) and the TLC plates were stained with a p-anisaldehyde sugar stain. After 1-24 h, the reaction was quenched by adding the same volume of pre-chilled ethanol and the reaction mixture was centrifuged to remove precipitates. The supernatant was concentrated and passed through a BioGel P-2 gel filtration column eluting with water followed by a C18 column (H.sub.2O:CH.sub.3CN=1:0-4:1) to obtain the target products.
(226) As shown in Table 2, using PmST1 M144D as the sialyltransferase, 2-3-linked sialosides (2.1-2.7) were obtained in 61-86% yields. These are comparable to the synthesis of 2-3-sialyllactoside, Neu5Ac9NAc2-3Gal1-4GlcProN.sub.3, which was obtained in 84% yield. Two 2-6-sialyltransferases were used for synthesizing 2-6-linked sialosides (2.8-2.16). Psp2,6ST A366G mutant with an increased expression level and improved activities in sialylating Tn antigens was used for synthesizing Neu5Ac9NAc2-6GalNAcProN.sub.3 (2.16) with 71% yield. For other 2-6-linked Neu5Ac9NAc-containing sialosides (2.8-2.15) synthesized, both Pd2,6ST and Psp2,6ST A366G could provide similar yields in small scale reactions. Pd2,6ST was used for the synthesis of Neu5Ac9NAc2-6GalProN.sub.3 (2.9) and Neu5Ac9NAc2-6Gal1-3GalNAcProN.sub.3 (2.12) with excellent 92% and 98% yields, respectively. Due to the higher expression level of Psp2,6ST A366G, it was used for the synthesis of the rest of the 2-6-linked sialoside targets (2.8, 2.10-2.11, 2.13-2.15). Good to excellent yields (64-96%) were obtained.
(227) TABLE-US-00003 TABLE 2 Neu5Ac9NAc-containing sialosides synthesized via the OP3E sialylation system. Yield 2-3/6-Sialosides (No.)
(228) The 2-3/6-sialosides obtained include Neu5Ac9NAc2-3/6GalpNP (2.1 and 2.8) and propyl azide (ProN.sub.3)-containing ones (2.2-2.7 and 2.9-2.16) such as disaccharides Neu5Ac9NAc2-3/6GalProN.sub.3 (2.2 and 2.9), sialyl type I glycans Neu5Ac9NAc2-3/6Gal1-3GlcNAcProN.sub.3 (2.3 and 2.10), sialyl type II glycans Neu5Ac9NAc2-3/6Gal1-4GlcNAcProN.sub.3 (2.4 and 2.11), sialyl type III glycans Neu5Ac9NAc2-3/6Gal31-3GalNAcProN.sub.3 (2.5 and 2.12), sialyl type IV glycans Neu5Ac9NAc2-3/6Gal1-3GalNAcProN.sub.3 (2.6 and 2.13), Neu5Ac9NAc2-3/6Gal1-3GlcNAcProN.sub.3 (2.7 and 2.14), 2-6-sialyl type VI glycan Neu5Ac9NAc2-6Gal1-4GlcProN.sub.3 (2.15), and sialyl Tn antigen Neu5Ac9NAc2-6GalNAcProN.sub.3 (2.16). These represent common terminal sialyl glycan structures in vertebrates.
(229) 4-Nitrophenyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranoside (Neu5Ac9NAc2-3GalpNP, 2.1). Yield 80%; 87 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 8.32-8.15 (m, 2H), 7.32-7.17 (m, 2H), 5.29 (d, J=7.8 Hz, 1H), 4.25 (dd, J=3.2 and 9.8 Hz, 1H), 4.06 (d, J=3.2 Hz, 1H), 3.98-3.84 (m, 4H), 3.81-3.64 (m, 4H), 3.61-3.46 (m, 2H), 3.29 (dd, J=7.6 and 14.2 Hz, 1H), 2.80 (dd, J=4.6 and 12.4 Hz, 1H), 2.04 (s, 3H), 1.95 (s, 3H), 1.84 (t, J=12.1 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.95, 174.32, 173.75, 161.70, 142.47, 126.07 (2C), 116.41 (2C), 99.94, 99.70, 75.50, 75.45, 72.76, 70.00, 69.60, 68.77, 68.29, 67.29, 60.67, 51.67, 42.10, 39.67, 22.03, 21.75; HRMS (ESI) Anal. Calcd for C.sub.25H.sub.34N.sub.3O.sub.16 [MH].sup.: 632.1945, Found: 632.1957.
(230) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyrano-sylonic acid)-(2.fwdarw.3)-O--D-galactopyranoside (Neu5Ac9NAc2-3GalProN.sub.3, 2.2). Yield 72%; 73 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.47 (d, J=7.8 Hz, 1H), 4.08 (dd, J=3.2 and 9.8 Hz, 1H), 4.05-3.63 (m, 10H), 3.59-3.45 (m, 5H), 3.32 (dd, J=7.8 and 14.2 Hz, 1H), 2.76 (dd, J=4.6 and 12.4 Hz, 1H), 2.04-2.03 (m, 6H), 1.96-1.89 (m, 2H), 1.81 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.93, 174.40, 173.80, 102.54, 99.93, 75.85, 74.88, 72.70, 69.95, 69.54, 69.13, 68.31, 67.52, 67.14, 60.93, 51.66, 47.90, 42.09, 39.61, 28.25, 22.02, 21.82; HRMS (ESI) m/z calcd for C.sub.22H.sub.36N.sub.5O.sub.14 [MH].sup.: 594.2264, found 594.2282.
(231) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-glucopyranoside (Neu5Ac9NAc2-3Gal1-3GcNAcProN.sub.3, 2.3). Yield 61%; 38 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.58 (d, J=7.8 Hz, 1H), 4.50 (d, J=7.8 Hz, 1H), 4.07 (dd, J=3.2 and 9.8 Hz, 1H), 4.03-3.47 (m, 19H), 3.39 (t, J=6.4 Hz, 2H), 3.27 (dd, J=7.6 and 14.2 Hz, 1H), 2.76 (dd, J=4.8 and 12.8 Hz, 1H), 2.13-2.03 (m, 9H), 1.89-1.77 (m, 3H); .sup.13C NMR (100 MHz, D.sub.2O) 174.79, 174.35, 174.25, 173.79, 103.25, 100.76, 99.70, 82.41, 75.52, 75.25, 74.95, 72.54, 69.82, 69.40, 69.03, 68.64, 68.24, 67.17, 67.02, 60.89, 60.62, 54.33, 51.55, 47.67, 41.93, 39.56, 27.98, 22.14, 21.92, 21.69; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3064.
(232) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.4)-2-acetamido-2-deoxy--D-glucopyranoside (Neu5Ac9NAc2-3Gal1-4GlcNAcProN.sub.3, 2.4). Yield 86%; 48 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.56-4.52 (m, 2H), 4.11 (dd, J=3.2 and 10.0 Hz, 1H), 4.04-3.82 (m, 6H), 3.80-3.54 (m, 12H), 3.50 (dd, J=1.8 and 9.0 Hz, 1H), 3.39 (td, J=1.8 and 6.6 Hz, 2H), 3.28 (dd, J=7.8 and 14.0 Hz, 1H), 2.76 (dd, J=4.6 and 12.4 Hz, 1H), 2.12-1.98 (m, 9H), 1.92-1.74 (m, 3H); .sup.13C NMR (100 MHz, D.sub.2O) 174.93, 174.46, 174.39, 173.79, 102.54, 101.13, 99.87, 78.23, 75.53, 75.14, 74.76, 72.74, 72.33, 69.95, 69.58, 69.37, 68.30, 67.46, 67.11, 61.01, 59.99, 55.06, 51.65, 47.76, 42.12, 39.61, 28.08, 22.14, 22.02, 21.81; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3079.
(233) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-galactopyranoside (Neu5Ac9NAc2-3Gal1-3GalNAcProN.sub.3, 2.5). Yield 64%; 57 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.92 (d, J=3.8 Hz, 1H), 4.55 (d, J=7.8 Hz, 1H), 4.32 (dd, J=3.8 and 11.2 Hz, 1H), 4.28-4.23 (m, 1H), 4.16-3.39 (m, 20H), 3.28 (dd, J=7.6 and 14.2 Hz, 1H), 2.75 (dd, J=4.6 and 12.4 Hz, 1H), 2.13-2.03 (m, 9H), 1.95-1.88 (m, 2H), 1.80 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.92, 174.51, 174.37, 173.90, 104.35, 99.88, 97.15, 77.44, 75.64, 74.72, 72.65, 70.60, 69.93, 69.49, 69.14, 68.51, 68.34, 67.43, 64.92, 61.20, 60.97, 51.66, 48.84, 48.66, 48.17, 42.03, 39.62, 27.94, 22.01, 21.82; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3072.
(234) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-galactopyranoside (Neu5Ac9NAc2-3Gal1-3GalNAcProN.sub.3, 2.6). Yield 84%; 14.8 mg, White foam. .sup.1H NMR (600 MHz, D.sub.2O) 4.51-4.46 (m, 2H), 4.16 (d, J=3.2 Hz, 1H), 4.03-3.93 (m, 3H), 3.97-3.50 (m, 15H), 3.47-3.45 (m, 1H), 3.36 (td, J=1.5 and 6.8 Hz, 2H), 3.23 (dd, J=7.6 and 14.1 Hz, 1H), 2.71 (dd, J=4.6 and 12.3 Hz, 1H) 2.03-1.96 (m, 9H), 1.87-1.80 (m, 2H), 1.75 (t, J=12.1 Hz, 1H); .sup.13C NMR (151 MHz, D.sub.2O) 174.80, 174.56, 174.27, 173.85, 104.39, 101.28, 99.72, 79.95, 75.45, 74.63 (2C), 72.53, 69.82, 69.42, 68.95, 68.26, 67.71, 67.29, 66.88, 60.88, 60.83, 51.55, 51.04, 48.74, 41.94, 39.53, 28.00, 22.16, 21.92, 21.71. HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3064
(235) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-glucopyranoside (Neu5Ac9NAc2-3Gal1-3GlcNAcProN.sub.3, 2.7). Yield 63%; 85 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.88 (d, J=3.6 Hz, 1H), 4.53 (d, J=7.8 Hz, 1H), 4.09 (ddd, J=3.4, 7.4 and 10.0 Hz, 2H), 4.01-3.42 (m, 20H), 3.28 (dd, J=7.6 and 14.2 Hz, 1H), 2.76 (dd, J=4.6 and 12.4 Hz, 1H), 2.04-2.03 (m, 9H), 1.95-1.89 (m, 2H), 1.80 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.91, 174.35 (2C), 173.88, 103.26, 99.87, 97.04, 80.47, 75.67, 75.01, 72.66, 71.57, 69.94, 69.47, 69.22, 68.71, 68.34, 67.32, 64.96, 60.97, 60.51, 52.43, 51.66, 48.17, 42.01, 39.64, 27.93, 22.02, 21.99, 21.81; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3071.
(236) 4-Nitrophenyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranoside (Neu5Ac9NAc2-6GalpNP, 2.8). Yield 64%; 69 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 8.26-8.15 (m, 2H), 7.26-7.12 (m, 2H), 5.09 (d, J=7.6 Hz, 1H), 3.95 (dd, J=4.0 and 7.6 Hz, 2H), 3.91-3.56 (m, 8H), 3.47 (dd, J=2.8 and 14.2 Hz, 1H), 3.36 (dd, J=1.6 and 8.8 Hz, 1H), 3.14 (dd, J=8.0 and 14.2 Hz, 1H), 2.67 (dd, J=4.4 and 12.4 Hz, 1H), 1.94 (s, 3H), 1.86 (s, 3H), 1.67-1.49 (m, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.94, 174.30, 173.48, 161.84, 142.51, 126.12 (2C), 116.39 (2C), 100.42, 99.88, 74.04, 72.47, 72.33, 70.25, 69.96, 69.69, 68.36, 68.15, 63.02, 51.80, 42.15, 40.14, 21.98, 21.72; HRMS (ESI) Anal. Calcd for C.sub.25H.sub.34N.sub.3O.sub.16 [MH].sup.: 632.1945, Found: 632.1955.
(237) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranoside (Neu5Ac9NAc2-6GalProN.sub.3, 2.9). Yield 92%; 107 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.39 (d, J=7.8 Hz, 1H), 4.05-3.88 (m, 4H), 3.87-3.57 (m, 8H), 3.54-3.44 (m, 4H), 3.28 (dd, J=7.8 and 14.0 Hz, 1H), 2.73 (dd, J=4.8 and 12.4 Hz, 1H), 2.04-2.02 (m, 6H), 1.95-1.89 (m, 2H), 1.70 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.98, 174.37, 173.41, 102.90, 100.47, 73.39, 72.57, 72.48, 70.65, 69.94, 69.69, 68.54, 68.17, 67.45, 63.29, 51.83, 47.87, 42.13, 40.17, 28.30, 22.01, 21.82; HRMS (ESI) m/z calcd for C.sub.22H.sub.36N.sub.5O.sub.14 [MH].sup.: 594.2264, found 594.2285.
(238) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-glucopyranoside (Neu5Ac9NAc2-6Gal1-3GcNAcProN.sub.3, 2.10). Yield 68%; 34 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.58 (d, J=8.4 Hz, 1H), 4.39 (d, J=7.8 Hz, 1H), 4.05-3.45 (m, 20H), 3.39 (td, J=1.2 and 6.6 Hz, 2H), 3.30 (dd, J=7.6 and 14.2 Hz, 1H), 2.70 (dd, J=4.8 and 12.4 Hz, 1H), 2.10-1.89 (m, 9H), 1.89-1.83 (m, 2H), 1.70 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.84, 174.59, 174.38, 173.46, 103.89, 100.88, 100.11, 84.01, 75.46, 73.61, 72.37, 72.28, 70.48, 69.93, 68.91 (2C), 68.48, 68.25, 67.14, 63.56, 60.87, 54.30, 51.78, 47.78, 42.15, 40.12, 28.08, 22.19, 22.03, 21.83; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3065.
(239) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranosyl-(1.fwdarw.4)-2-acetamido-2-deoxy--D-glucopyranoside (Neu5Ac9NAc2-6Gal1-4GcNAcProN.sub.3, 2.11). Yield 91%; 56 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.62-4.52 (m, 1H), 4.45 (d, J=7.8 Hz, 1H), 4.04-3.89 (m, 5H), 3.88-3.51 (m, 14H), 3.45 (dd, J=1.8 and 9.0 Hz, 1H), 3.39 (td, J=1.4 and 6.6 Hz, 2H), 3.30 (dd, J=7.8 and 14.0 Hz, 1H), 2.76 (dd, J=4.6 and 12.4 Hz, 1H), 2.16-1.98 (m, 9H), 1.89-1.83 (m, 2H), 1.71 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.83, 174.51, 174.39, 173.49, 103.46, 100.95, 100.18, 80.74, 74.45, 73.68, 72.39 (2C), 70.70, 69.87 (2C), 68.39, 68.17, 67.09, 63.44, 61.75, 60.34, 54.83, 51.85, 47.77, 42.14, 40.06, 28.09, 22.27, 22.01, 21.83; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3063.
(240) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-galactopyranoside (Neu5Ac9NAc2-6Gal1-3GalNAcProN.sub.3, 2.12). Yield 98%; 86 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.91 (d, J=3.6 Hz, 1H), 4.46 (d, J=7.8 Hz, 1H), 4.33 (dd, J=3.8 and 11.2 Hz, 1H), 4.29-4.24 (m, 1H), 4.10-3.41 (m, 20H), 3.31 (dd, J=7.6 and 14.0 Hz, 1H), 2.74 (dd, J=4.8 and 12.4 Hz, 1H), 2.13-1.99 (m, 9H), 1.95-1.89 (m, 2H), 1.66 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.98, 174.51, 174.40, 173.40, 104.52, 100.39, 97.16, 77.27, 73.20, 72.43, 72.37, 70.73, 70.48, 69.81, 69.65, 68.67, 68.56, 68.20, 64.90, 63.48, 61.42, 51.86, 48.72, 48.19, 42.08, 40.19, 27.96, 22.00, 21.98, 21.82; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3079.
(241) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-galactopyranoside (Neu5Ac9NAc2-6Gal1-3GalNAcProN.sub.3, 2.13). Yield 96%; 16.8 mg, White foam. .sup.1H NMR (600 MHz, D.sub.2O) 4.47-4.38 (m, 2H), 4.17 (dd, J=3.2 Hz, 1H), 3.98-3.55 (m, 17H), 3.51-3.42 (m, 2H), 3.35 (td, J=4.5 and 6.5 Hz, 2H), 3.26-3.21 (m, 1H), 2.68 (dd, J=4.6 and 12.4 Hz, 1H), 2.11-1.89 (m, 9H), 1.84-1.77 (m, 2H), 1.64 (t, J=12.2 Hz, 1H); .sup.13C NMR (151 MHz, D.sub.2O) 174.85, 174.58, 174.28, 173.31, 104.79, 101.38, 100.35, 79.80, 74.85, 73.00, 72.40, 72.38, 70.43, 69.81, 69.60, 68.48, 68.08, 67.72, 67.11, 63.26, 60.85, 52.24, 51.70, 51.07, 42.07, 40.11, 28.06, 22.11, 21.90, 21.72, HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3067.
(242) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranosyl-(1.fwdarw.3)-2-acetamido-2-deoxy--D-glucopyranoside (Neu5Ac9NAc2-6Gal1-3GlcNAcProN.sub.3, 2.14). Yield 76%; 51 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.87 (d, J=3.6 Hz, 1H), 4.39 (d, J=7.8 Hz, 1H), 4.10 (dd, J=3.6 and 10.6 Hz, 1H), 4.03-3.37 (m, 21H), 3.30 (dd, J=7.7 and 14.1 Hz, 1H), 2.70 (dd, J=4.7 and 12.4 Hz, 1H), 2.09-1.94 (m, 9H), 1.94-1.90 (m, 2H), 1.71 (t, J=12.2 Hz, 1H); .sup.13C NMR (101 MHz, D.sub.2O) 174.83, 174.42, 174.38, 173.48, 103.71, 100.12, 96.91, 81.81, 73.60, 72.42, 72.29, 71.58, 70.53, 69.93, 69.91, 68.79, 68.50, 68.26, 64.91, 63.51, 60.64, 52.27, 51.78, 48.14, 42.15, 40.14, 27.96, 22.03, 21.93, 21.82; HRMS (ESI) m/z calcd for C.sub.30H.sub.49N.sub.6O.sub.19 [MH].sup.: 797.3058, found 797.3078.
(243) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranosyl-(1.fwdarw.4)--D-glucopyranoside (Neu5Ac9NAc2-6Gal1-4GlcProN.sub.3, 2.15). Yield 94%; 73 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.50 (d, J=8.0 Hz, 1H), 4.44 (d, J=7.8 Hz, 1H), 4.04-3.24 (m, 23H), 2.71 (dd, J=4.8 and 12.4 Hz, 1H), 2.14-2.03 (m, 6H), 1.96-1.89 (m, 2H), 1.74 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.82, 174.39, 173.43, 103.18, 101.98, 100.30, 79.62, 74.62, 74.59, 73.68, 72.71, 72.33, 70.75, 69.93, 69.89, 68.52, 68.33, 67.31, 63.62, 60.24, 51.75, 48.85, 47.86, 42.16, 40.06, 28.22, 22.04, 21.84; HRMS (ESI) m/z calcd for C.sub.28H.sub.46N.sub.5O.sub.19 [MH].sup.: 756.2792, found 756.2812.
(244) 3-Azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-2-acetamido-2-deoxy--D-galactopyranoside (Neu5Ac9NAc2-6GalNAcProN.sub.3, 2.16). Yield 71%; 78 mg, White foam. .sup.1H NMR (400 MHz, D.sub.2O) 4.89 (d, J=3.6 Hz, 1H), 4.15 (dd, J=3.8 and 11.2 Hz, 1H), 4.06-4.00 (m, 2H), 3.96-3.89 (m, 3H), 3.84-3.78 (m, 2H), 3.74-3.41 (m, 8H), 3.29 (dd, J=7.8 and 14.0 Hz, 1H), 2.73 (dd, J=4.8 and 12.4 Hz, 1H), 2.13-2.03 (m, 9H), 1.94-1.88 (m, 2H), 1.69 (t, J=12.2 Hz, 1H); .sup.13C NMR (100 MHz, D.sub.2O) 174.94, 174.51, 174.37, 173.37, 100.37, 97.04, 72.40, 69.96, 69.74, 69.49, 68.49, 68.21, 67.46, 65.15, 63.79, 51.82, 49.92, 48.14, 42.14, 40.23, 27.91, 22.01, 21.92, 21.82; HRMS (ESI) m/z calcd for C.sub.24H.sub.39N.sub.6O.sub.14 [MH].sup.: 635.2530, found 635.2554.
(245) 3-azidopropyl O-(5,9-diacetamido-3,5,9-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.8)-O-(5-acetamido-3,5-dideoxy-D-glycero--D-galacto-2-nonulopyrano-sylonic acid)-(2.fwdarw.3)-O--D-galactopyranosyl-(1.fwdarw.4)--D-glucopyranoside (Neu5Ac9NAc2-8Neu5Ac2-3LacProN.sub.3, 2.21). Sialoside 2.21 was synthesized according to Scheme 11.
(246) ##STR00059##
(247) Neu5Ac2-3LacProN.sub.3 (50 mg, 0.067 mmol), Man2,6NAc.sub.2 (22 mg, 0.084 mmol), sodium pyruvate (45 mg, 0.41 mmol) and CTP (50 mg, 0.089 mmol) were dissolved in Tris-HCl buffer (100 mM, pH=8.5, 10 mL) containing MgCl.sub.2 (20 mM). Pasteurella multocida sialic acid aldolase (PmAldolase) (1.5 mg), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS) (2.5 mg), and Campylobacter jejuni sialyltransferase CstII mutant (CstII32.sup.I53S) (2.5-3.0 mg) were added. The reaction was incubated in an incubator shaker at 37 C. for 1 h with agitation at 140 rpm and then at room temperature for 48 h. Product formation was monitored by thin layer chromatography (EtOAc:MeOH:H.sub.2O=5:3:1, by volume) and stained with p-anisaldehyde sugar stain. With the achievement of optimal yield, the reaction was quenched by adding the same volume (10 mL) of ice-cold MeOH and incubated at 4 C. for 30 min. The mixture was centrifuged and supernatant was concentrated, followed by passing through a BioGel P-2 gel filtration column and a C18 reverse phase column. Yield: 73%; 52 mg, White foam. .sup.1H NMR (800 MHz, D.sub.2O) 4.52 (d, J=7.9 Hz, 1H), 4.48 (d, J=8.0 Hz, 1H), 4.18-4.12 (m, 2H), 4.09 (dd, J=9.9, 3.1 Hz, 1H), 4.02-3.93 (m, 4H), 3.89-3.49 (m, 18H), 3.49-3.42 (m, 3H), 3.31 (m, 2H), 2.77 (dd, J=12.4, 4.6 Hz, 1H), 2.67 (dd, J=12.3, 4.4 Hz, 1H), 2.16-1.98 (m, 9H), 1.91 (p, J=6.7 Hz, 2H), 1.74 (td, J=12.1, 8.9 Hz, 2H); .sup.13C NMR (200 MHz, D.sub.2O) 174.84, 174.80, 174.42, 173.34, 173.26, 102.56, 102.02, 100.28, 100.23, 78.13, 77.92, 75.32, 75.08, 74.69, 74.17, 74.06, 72.72, 72.33, 69.69, 69.57, 69.25, 69.19, 68.39, 67.87, 67.44, 67.23, 61.49, 60.96, 59.87, 52.15, 51.59, 47.76, 42.19, 40.35, 39.45, 28.12, 22.17, 21.91, 21.70.
Example 8. Sialidase Substrate Specificity Study Using Neu5Ac9NAc-Containing Sialosides
(248) Among the compounds synthesized in Example 7, two pNP-tagged Neu5Ac9NAc-containing sialosides Neu5Ac9NAc2-3GalpNP (2.1) and Neu5Ac9NAc2-6GalpNP (2.8) were used conveniently in a 384-well plate-based high-throughput colorimetric assay for substrate specificity studies of nine sialidases. Four additional pNP-tagged sialosides including Neu5Ac-containing ones such as Neu5Ac2-3GalpNP (2.17) and Neu5Ac2-6GalpNP (2.18) as well as Neu5,9Ac.sub.2-containing ones such as Neu5,9Ac.sub.22-3GalpNP (2.19) and Neu5,9Ac.sub.22-6GalpNP (2.20) (
(249) In this assay method, individual sialosides were incubated in duplicates at 37 C. for 30 min with an appropriate amount of a sialidase as well as an excess amount of -galactosidase. The reactions were stopped by adding N-cyclohexyl-3-aminopropanesulfonic acid (CAPS) buffer (0.5 M, pH 10.5) to adjust the pH value of the solution to higher than 9.5 to convert the para-nitrophenol formed in the enzymatic reactions to para-nitrophenolate which was quantified by a microplate reader at A.sub.405 nm.
(250) Assays were carried out in duplicates. For each reaction in a final volume of 20 L, a sialoside was incubated with an appropriate amount of a sialidase and an excess amount of -galactosidase (12 g) in a buffer solution in a 384-well plate at 37 C. for 30 min. The sialidase amounts and buffers used were: A. ureafaciens sialidase (0.5 mU), NaOAc buffer (100 mM, pH 5.5); C. perfringens sialidase (0.75 mU), MES buffer (100 mM, pH 5.0); V. cholerae sialidase (1.5 mU), NaCl (150 mM), CaCl.sub.2 (10 mM), NaOAc buffer (100 mM, pH 5.5); SpNanA (1.5 ng), NaOAc buffer (100 mM, pH 6.0); SpNanB (3 ng), NaOAc buffer (100 mM, pH 6.0); SpNanC (20 ng), MES buffer (100 mM, pH 6.5); PmST1 (0.4 g), NaOAc buffer (100 mM, pH 5.5), CMP (0.4 mM); hNEU2 (1.3 pig), MES buffer (100 mM, pH 5.0); BiNanH2 (4 ng), NaOAc buffer (100 mM, pH 5.0). The reactions were stopped by adding 40 L of N-cyclohexyl-3-aminopropanesulfonic acid (CAPS) buffer (0.5 M, pH 10.5) to adjust pH to higher than 9.5 and A.sub.405 nm values of samples were read by a microplate reader.
(251) As shown in
Example 9. Kinetic Study of Sialidase Activity Using Neu5Ac9NAc-Containing Sialosides
(252) The results obtained by the microtiter plate-based assays for PmST1, SpNanC, C. perfringens sialidase, and BiNanH2 were further confirmed by high-performance liquid chromatography (HPLC)-based assays. In addition, time course studies for BiNanH2 and more detailed kinetics studies for SpNanC and BiNanH2 (Table 3) were carried out.
(253) HPLC-based assays were carried out as described above for microtiter plate-based assays. The reactions were stopped by adding 40 L of pre-chilled ethanol. The mixtures were then centrifuged and the supernatants were analyzed by Agilent 1290 Infinity HPLC system at 315 nm. A C14 reverse phase Rapid Resolution High Definition column (BONUS RP RRHD 1.8 m, 2.1150 mm, Agilent) was used for analyzing samples with Neu5Ac2-3GalpNP (2.17), Neu5,9Ac.sub.22-3GalpNP (2.19), Neu5Ac9NAc2-6GalpNP (2.8), or Neu5Ac2-6GalpNP (2.18). A C18 reverse phase Rapid Resolution High Definition column (EclipsePlusC18 RRHD 1.8 m, 2.150 mm, Agilent) was used for analyzing samples with Neu5Ac9NAc2-3GalpNP (2.1) or Neu5,9Ac.sub.22-6GalpNP (2.20). The mobile phases used were acetonitrile (ACN) in H.sub.2O mixed solvent with varied percentages of acetonitrile: 4.5% for Neu5Ac2-6GalpNP (2.18); 6.5% for Neu5Ac9NAc2-3GalpNP (2.1) or Neu5,9Ac.sub.22-6GalpNP (2.20); 9% for Neu5Ac9NAc2-6GalpNP (2.8); and 12% for Neu5Ac2-3GalpNP (2.17) or Neu5,9Ac.sub.22-3GalpNP (2.19).
(254) Time course studies for BiNanH2 were carried out in duplicate at 37 C. in reaction mixtures (200 L each) containing NaOAc buffer (100 mM, pH 5.0), BiNanH2 (220 ng/mL), and a sialidase substrate (0.3 mM) selected from Neu5Ac2-3GalpNP (2.17), Neu5Ac2-6GalpNP (2.18), Neu5Ac9NAc2-3GalpNP (1), and Neu5Ac9NAc2-6GalpNP (2.8). Aliquots (20 L each) were taken at 5, 10, 15, 20, 30, 45, or 60 min intervals and added to microcentrifuge tubes (500 L) containing 40 L of pre-chilled ethanol. The mixtures were centrifuged on a bench-top centrifuge (13,000 rpm3 min). The supernatants (45 L) were analyzed by Agilent 1290 Infinity HPLC system at 315 nm as described above.
(255) The kinetic studies for BiNanH2 were performed in duplicates at 37 C. for 10 min in a total volume of 20 L each containing NaOAc buffer (100 mM, pH 5.0), a sialidase substrate [selected from Neu5Ac9NAc2-3GalpNP (2.1), Neu5Ac9NAc2-6GalpNP (8), Neu5Ac2-3GalpNP (2.17), and Neu5Ac2-6GalpNP (2.18)], and BiNanH2 (5.8 ng when compound 2.1 or 2.17 was used as the substrate and 1.5 ng when compound 2.8 or 2.18 was used as the substrate). The reactions were stopped by adding 40 L of pre-chilled ethanol. The mixtures were then centrifuged and the supernatants were analyzed by the HPLC system described above for HPLC-based assays. Apparent kinetic parameters were obtained by varying substrate concentrations from 0.1-40 mM (0.1, 0.2, 0.4, 1, 2, 4, 10, 20, and 40 mM) and fitting the data (the average values of duplicate assay results) into the Michaelis-Menten equation using Grafit 5.0.
(256) The kinetic studies for SpNanC were performed in duplicates at 37 C. for 10 min in a total volume of 20 L each containing MES buffer (100 mM, pH 6.5), a sialidase substrate [selected from Neu5Ac9NAc2-3GalpNP (2.1), Neu5Ac2-3GalpNP (2.17), and Neu5,9Ac.sub.22-3GalpNP (2.19)], and SpNanC (2.5 ng when compound 2.1 or 2.17 was used as the substrate and 1.5 ng when compound 2.19 was used as the substrate). After stopping the reactions by adding 40 L of pre-chilled ethanol, the mixtures were centrifuged and the supernatants were analyzed by the HPLC system as described above. Apparent kinetic parameters were obtained by varying substrate concentrations from 0.1-40 mM (0.1, 0.2, 0.4, 1, 2, 4, 10, 20, and 40 mM) and fitting the data (the average values of duplicate assay results) into the Michaelis-Menten equation using Grafit 5.0.
(257) As shown in Table 3, SpNanC catalyzes the cleavage of Neu5Ac9NAc2-3GalpNP (2.1) and Neu5Ac2-3GalpNP (2.17) with similar efficiencies (k.sub.cat/K.sub.M=137 s.sup.1 mM.sup.1 and 130 s.sup.1 mM.sup.1, respectively). The catalytic efficiency of SpNanC for Neu5,9Ac.sub.22-3GalpNP (2.19) (k.sub.cat/K.sub.M=302 s.sup.1 mM.sup.1) is much (2.2-2.3 fold) higher. For BiNanH2, it has similar catalytic efficiencies towards Neu5Ac9NAc2-3GalpNP (2.1) and Neu5Ac2-3GalpNP (2.17) (k.sub.cat/K.sub.M=59.3 s.sup.1 mM.sup.1 and 66.7 s.sup.1 mM.sup.1, respectively). Its catalytic efficient towards Neu5Ac9NAc2-6GalpNP (2.8) (k.sub.cat/K.sub.M=179 s.sup.1 mM.sup.1) is slightly lower than that of Neu5Ac2-6GalpNP (2.18) (k.sub.cat/K.sub.M=242 s.sup.1 mM.sup.1). In comparison, its activity towards Neu5,9Ac.sub.22-3GalpNP (2.19) and Neu5,9Ac.sub.22-6GalpNP (2.20) are not high enough for obtaining apparent kinetics parameters. These results validated those shown in
(258) TABLE-US-00004 TABLE 3 Apparent kinetics parameters for SpNanC and BiNanH2. k.sub.cat/K.sub.M (s.sup.1 Sialidases Substrate k.sub.cat (s.sup.1) K.sub.M (mM) mM.sup.1) SpNanC Neu5Ac2-3GalpNP (3.65 2.66 0.3 137 (2.17) 0.10) 10.sup.2 Neu5Ac9NAc2-3GalpNP (3.38 2.60 0.4 130 (2.1) 0.15) 10.sup.2 Neu5,9Ac22-3GalpNP (3.78 1.25 0.2 302 (2.19) 0.12) 10.sup.2 BiNanH2 Neu5Ac2-3GalpNP (1.66 2.8 0.1 59.3 (2.17) 0.02) 10.sup.2 Neu5Ac9NAc2-3GalpNP (1.08 1.61 0.2 66.7 (2.1) 0.02) 10.sup.2 Neu5Ac2-6GalpNP (3.31 1.37 0.1 242 (2.18) 0.06) 10.sup.2 Neu5Ac9NAc2-6GalpNP (8.07 4.51 0.2 179 (2.8) 0.08) 10.sup.2
(259) In summary, a library of sixteen new 2-3/6-linked Neu5Ac9NAc-containing sialosides have been successfully synthesized in good to excellent (61-98%) yields using highly efficient one-pot three-enzyme sialylation systems. Among the sialosides synthesized, para-nitrophenylated 2-3- and 2-6-linked Neu5Ac9NAc-containing sialyl galactosides have been used together with their Neu5Ac-, and Neu5,9Ac.sub.2-sialoside analogs in microtiter plate-based high-throughput substrate specificity studies of various sialidases. In general, Neu5Ac9NAc-sialosides are good mimics of Neu5,9Ac.sub.2-sialosides in probing the activities of most sialidases. Nevertheless, exceptions do exist and different effects were observed for Neu5Ac 9-N- and 9-O-acetylation in affecting sialoside cleavage by SpNanC, C. perfringens sialidase, and BiNanH2. Further investigation will be needed to elucidate the mechanism for these differences.
Example 10. Chemical Synthesis of 6deoxyMan2,4diN.SUB.3 .(3-9) and 6deoxy ManNAc4NAc (3-4)
(260) An efficient method was developed for the production of 6deoxyManNAc4NAc (3-4), the six-carbon precursor of Leg5,7Ac.sub.2 (3-1). Commercially available D-fucose (3-5) was chosen as the starting material to allow simultaneous inversion of its stereochemistry at C-2 and C-4 for the formation of mannose derivative. See, Sanapala et al. J. Am. Chem. Soc. 2016, 138, 4938-4947. As shown in Scheme 12, per-O-acetylation of D-fucose (3-5) followed by BF.sub.3.Math.Et.sub.2O-catalyzed nucleophilic displacement of the anomeric acetate with p-methoxyphenol in CH.sub.2Cl.sub.2 produced intermediate 3-6 in 84% yield. De-O-acetylation with sodium methoxide in methanol produced triol. Dimethyltin chloride (Me.sub.2SnCl.sub.2)-catalyzed regio-selective benzoyl protection of 3-OH formed D-fucosyl-2,4-diol (3-7) in two steps in 94% yield.
(261) ##STR00060##
(262) Compound 3-7 was then treated with trifluoromethanesulfonic anhydride (Tf.sub.2O) and pyridine to form the corresponding 2,4-bistriflate which upon treating with 2.5 equivalent of tetrabutylammonium azide (TBAN.sub.3) in anhydrous toluene at 70 C. to reflux, 6-deoxy-D-mannose derivative 3-8 was formed in 2 hour in 93% yield. Debenzoylation and ceric ammonium nitrate-catalyzed removal of the p-methoxyphenyl group produced 2,4-diazido-2,4,6-trideoxy mannose (6deoxyMan2,4diN.sub.3, 3-9) in 81% yield. Overall, the production of 6deoxyMan2,4diN.sub.3 (3-9) from D-fucose (3-5) was achieved in eight steps with an overall yield of 60%. ManNAc derivative 6deoxyManNAc4NAc (3-4) was obtained readily from compound 9 in 73% yield by treating with thioacetic acid in pyridine at room temperature for 20 hours.
(263) ##STR00061##
(264) p-Methoxy phenyl-2,3,4-tri-O-acetyl--D-fucopyranoside (3-6). To a solution of D-fucose (5 g, 30.48 mmol) in 30 mL pyridine at 0 C., 25 mL acetic anhydride was added dropwise. After stirring at 0 C. for 1 h, the mixture was allowed to warm to room temperature and stirred for total 10 h. The solvent was removed in vacuo and co-evaporated with 30 mL of toluene 4 times. The peracetylated D-fucose was dried in vacuo for 5-6 h and directly used for next step without further purification.
(265) To a solution of peracetate (9.34 g, 28.10 mmol) and p-methoxyphenol (5.23 g, 42.15 mmol) in anhydrous CH.sub.2Cl.sub.2 (75 mL) under nitrogen at 0 C., BF.sub.3.Math.OEt.sub.2 (6.9 mL, 56.2 mmol) was added drop-wisely. After stirring at 0 C. for 2 h, the mixture was allowed to warm to room temperature, stirred for 12 h and diluted with another 50 mL of CH.sub.2Cl.sub.2. The organic layer was washed with water, saturated NaHCO.sub.3 and brine, dried over Na.sub.2SO.sub.4. After filtration, the solvent was removed under reduced pressure and the product was purified by silica gel chromatography using hexane:EtOAc=8:1 (by volume) as an eluent to produce the compound 3-6 (9.3 g, 84% in 2 steps) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) 6.97 (d, J=9.1 Hz, 2H), 6.82 (d, J=9.1 Hz, 2H), 5.62 (d, J=3.7 Hz, 1H), 5.59 (dd, J=10.8, 3.6 Hz, 1H), 5.36 (dd, J=3.4, 1.3 Hz, 1H), 5.28 (dd, J=10.8, 3.6 Hz, 1H), 4.31 (dd, J=13.2, 7.0 Hz, 1H), 3.77 (s, 3H), 2.18 (s, 3H), 2.07 (s, 3H), 2.02 (s, 3H), 1.13 (d, J=6.6 Hz, 3H). .sup.13C NMR (100 MHz, CDCl.sub.3) 170.70, 170.59, 170.24, 155.33, 150.76, 117.90, 114.81, 95.80, 71.17, 68.11, 68.07, 65.34, 55.78, 20.91, 20.86, 20.78, 16.01. .sup.1H NMR (400 MHz, Chloroform-d) 5.59 (dd, J=10.8, 3.6 Hz, 1H), 5.28 (dd, J=10.8, 3.6 Hz, 1H).
(266) ##STR00062##
(267) p-Methoxy phenyl-3-O-benzoyl--D-fucopyranoside (3-7). To a solution of 4-methoxy phenyl-2,3,4-tri-O-acetyl--D-fucopyranoside 3-6 (9 g, 22.7 mmol) in methanol (50 mL) was added sodium methoxide (0.5 g) at room temperature. After 4 h, the reaction mixture was neutralized with Dowex 50W (H.sup.+), filtered and concentrated under reduced pressure. This intermediate was dried in vacuo for 5-6 h used in the next step without further purification.
(268) To a stirred solution of intermediate (6.1 g, 22.7 mmol) in a mixture of THF (30 mL) and water (6 mL) and Me.sub.2SnCl.sub.2 (273 mg, 1.13 mmol) and DIPEA (15.8 mL, 2.37 mmol) were added and stirred for 15 min. To this BzCl (2.7 mL, 23.4 mmol) was added dropwise, after 1 h the reaction mixture was quenched with 1N HCl (50 mL) and extracted with EtOAc, dried over Na.sub.2SO.sub.4. After filtration, the solvent was removed under reduced pressure and the product was purified by silica gel chromatography using hexane:EtOAc=4:1 (by volume) as an eluent to produce compound 3-7 (7.9 g, 94% in 2 steps) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) 8.12 (d, J=8.2 Hz, 2H), 7.59 (t, J=7.4 Hz, 1H), 7.46 (t, J=7.7 Hz, 2H), 7.05 (d, J=9.0 Hz, 2H), 6.85 (d, J=9.1 Hz, 2H), 5.54-5.46 (m, 2H), 4.34-4.20 (m, 2H), 4.05 (s, 1H), 3.78 (s, 3H), 2.35-2.11 (m, 2H), 1.29 (d, J=6.6 Hz, 3H). .sup.13C NMR (100 MHz, CDCl.sub.3) 166.68, 155.41, 150.76, 133.58, 130.02, 129.75, 128.63, 118.13, 114.85, 98.77, 74.51, 70.95, 67.25, 66.86, 55.80, 16.17. HRMS (ESI) m/z calculated for C.sub.20H.sub.22O.sub.7 (M+Na) 397.1258 found 397.1243.
(269) ##STR00063##
(270) p-Methoxy phenyl-2,4-di-azido-3-O-benzoyl-6-deoxy--D-mannopyranoside (3-8). To a solution of compound 3-7 (3 g, 8.01 mmol) in anhydrous CH.sub.2Cl.sub.2 (30 mL) and anhydrous pyridine (6.48 mL) at 10 C. trifluoromethanesulfonic anhydride (10.8 mL, 64.08 mmol) was added. Temperature was slowly increased to 0 C. over a period of 1 h. The reaction was diluted with addition of 70 mL of CH.sub.2Cl.sub.2. The organic layer was washed with 1 N HCl, saturated NaHCO.sub.3, and brine solution, dried over anhydrous Na.sub.2SO.sub.4. After filtration, the solvent was removed under reduced pressure at room temperature, was dried in vacuo for 2 h and directly used for next step without further purification.
(271) To a solution of the 2,4-bistriflate in anhydrous toluene (50 mL) at 70 C., tetrabutylammonium azide (6.8 g, 24.03 mmol) was added and the mixture was stirred for 1 h. The temperature was then increased to 100 C. and the mixture was stirred for another 1 h. Then the solvent was removed and the condensed mixture was diluted with 75 mL of CH.sub.2Cl.sub.2. The organic layer was washed with brine solution, dried over anhydrous Na.sub.2SO.sub.4. After filtration, the solvent was removed under reduced pressure and the product was purified by silica gel chromatography using toluene:hexane=25:1 (by volume) as an eluent to produce compound 3-8 (3.1 g, 93% over 2 steps) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3 8.15 (d, J=8.0 Hz, 2H), 7.64 (t, J=8.0 Hz, 1H), 7.51 (t, J=8.0 Hz, 2H), 7.02 (d, J=8.8 Hz, 2H), 6.85 (d, J=8.8 Hz, 2H), 5.72 (dd, J=10.0, 4.4 Hz, 1H), 5.40 (s, 1H), 4.50-4.27 (m, 1H), 3.85 (dq, J=11.9, 5.9, 5.4 Hz, 1H), 3.78 (s, 3H), 3.75 (d, J=10.0 Hz, 1H), 1.38 (d, J=6.0 Hz, 3H). .sup.13C NMR (100 MHz, CDCl.sub.3) 165.71, 155.54, 149.98, 134.04, 130.25, 128.88, 117.77, 114.94, 97.20, 72.67, 68.01, 63.22, 61.48, 55.87, 18.62. HRMS (ESI) m z calculated for C.sub.20H.sub.20N.sub.6O.sub.5 (MH) 423.1422 found 423.1434.
(272) ##STR00064##
(273) 2,4-Diazido-2,4,6-trideox-D-mannose (3-9). To a solution of compound 3-8 (3 g, 7.06 mmol) in anhydrous methanol (30 mL) was added sodium methoxide (0.3 g) at room temperature. After 6 h, the reaction mixture was neutralized with Dowex 50W (H+), filtered and concentrated under reduced pressure. This intermediate was dried in vacuo and used in the next step without further purification.
(274) To a solution of the 2,4-diazido intermediate in 40 mL of acetonitrile:water=4:1 (by volume) at 0 C., ceric ammonium nitrate (12.32 g, 21.09 mmol) was added and the reaction mixture was stirred for 1 h. The reaction was warmed up to room temperature and was stirred for another 3 h. The acetonitrile was then removed under reduced pressure at room temperature and diluted with 100 mL of ethylacetate. The organic layer was washed with water saturated NaHCO.sub.3, and brine solution, dried over anhydrous Na.sub.2SO.sub.4. After filtration, the solvent was removed under reduced pressure and the product was purified by silica gel chromatography using hexane:EtOAc=1:2 (by volume) as an eluent to produce compound 3-9 (1.2 g, 81% over 2 steps) as a reddish solid. .sup.1H NMR (400 MHz, D.sub.2O) 5.24 (d, J=1.3 Hz, 1H), 4.98 (d, J=1.2 Hz, 1H), 4.14 (dd, J=10.0, 3.8 Hz, 1H), 4.07 (dd, J=3.7, 1.4 Hz, 1H), 4.02 (dd, J=3.8, 1.8 Hz, 1H), 3.94 (dd, J=9.7, 3.7 Hz, 1H), 3.89-3.79 (m, 1H), 3.44-3.26 (m, 3H), 1.33 (dd, J=7.8, 6.1 Hz, 6H). .sup.13C NMR (100 MHz, D.sub.2O) 92.79, 92.09, 71.80, 70.99, 69.21, 66.94, 65.66, 64.99, 64.47, 64.02, 17.40, 17.36. HRMS (ESI) m z calculated for C.sub.6H.sub.10N.sub.6O.sub.3 (M+Na) 269.1108 found 269.1098.
(275) ##STR00065##
(276) 6deoxyManNAc4NAc (3-4). To a solution of compound 9 (200 mg, 0.93 mmol) in pyridine (10 mL) was added thioacetic acid (0.530 mL, 7.44 mmol) under argon at room temperature and stir for 20 h and the product was purified by silica gel chromatography using a mixed solvent (EtOAc:methanol=10:1, by volume) as an eluent to produce compound 4 (167 mg, 73%) as a reddish solid. .sup.1H NMR (400 MHz, D.sub.2O) 5.03 (d, J=1.6 Hz, 1H), 4.88 (d, J=1.7 Hz, 1H), 4.39 (dd, J=4.4, 1.7 Hz, 1H), 4.22 (dd, J=4.6, 1.7 Hz, 1H), 3.99 (dd, J=10.7, 4.6 Hz, 2H), 3.94-3.84 (m, J=10.2, 6.3 Hz, 1H), 3.80-3.65 (m, 2H), 3.59 (t, J=10.4 Hz, 1H), 3.43 (m, 1H), 2.04 (s, 3H), 2.00 (s, 3H), 1.96 (s, 3H), 1.95 (s, 3H), 1.13 (dd, J=10.8, 6.2 Hz, 6H). .sup.13C NMR (100 MHz, D.sub.2O) 175.85, 174.92, 174.75, 174.68, 92.77, 92.74, 71.58, 69.97, 67.00, 66.53, 53.57, 53.54, 53.18, 52.72, 22.12, 22.10, 22.08, 21.92, 16.81, 16.77. HRMS (ESI) m z calculated for C.sub.10H.sub.18N.sub.2O.sub.5 (M+Cl.sup.) 281.0910, found 281.0917.
Example 11. Enzymatic synthesis of 5,7-di-N-acetyllegionaminic acid (Leg5,7Ac.SUB.2.) (3-1)
(277) To our delight, 6deoxyManNAc4NAc (3-4) was a suitable substrate for both recombinant Escherichia coli (EcAldolase) and Pasteurella multocida (PmAldolase) sialic acid aldolases. PmAldolase was found to be more efficient and was used for preparative-scale synthesis of Leg5,7Ac.sub.2 (3-1) with a 71% yield (Scheme 13). Nevertheless, the resulting Leg5,7Ac.sub.2 (3-1) was not a suitable substrate for Neisseria meningitidis CMP-sialic acid synthetase (NmCSS) for the synthesis of the corresponding CMP-Leg5,7Ac.sub.2.
(278) ##STR00066##
(279) The 6deoxyManNAc4NAc (3-4, 150 mg, 0.69 mmol) and sodium pyruvate (385 mg, 3.5 mmol) were dissolved in water in a 50 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 7.5) and MgCl.sub.2 (20 mM). After the addition of appropriate amount of PmAldolase (7 mg), water was added to bring the final volume of the reaction mixture to 30 mL. The reaction was carried out by incubating the solution at 37 C. with agitation at 125 rpm in an incubator for 72 h. The product formation was monitored by thin layer chromatography (TLC) developed with EtOAc:MeOH:H.sub.2O:HOAc=4:2:1:0.1 (by volume) and stained with p-anisaldehyde sugar stain. The mixture was then centrifuged. The supernatant was concentrated and passed through a BioGel P-2 gel filtration (water was used as an eluent). Then the product was further purified by silica gel chromatograph to produce 3-1 (144 mg, 71%). .sup.1H NMR (800 MHz, D.sub.2O) 4.28 (dd, J=10.5, 1.6 Hz, 1H), 3.97-3.92 (m, 1H), 3.89-3.85 (m, 1H), 3.85-3.80 (m, 1H), 3.70 (t, J=10.3 Hz each, 1H), 2.29 (dd, J=13.1, 4.8 Hz, 1H), 1.85 (t, J=12.3 Hz, 1H), 1.13 (d, J=6.4 Hz, 1H). .sup.13C NMR (200 MHz, D.sub.2O) 173.44, 173.27, 172.80, 94.87, 69.14, 66.66, 65.70, 52.68, 52.13, 38.60, 21.62, 21.30, 18.65. HRMS (ESI) m z calculated for C.sub.13H.sub.22N.sub.2O.sub.8 (MH) 333.1303, found 333.1289.
Example 12. One-Pot Three-Enzyme (OP3E) Preparative Scale Synthesis of 2-3-linked Leg5,7diN.SUB.3.-glycosides and 2-6-linked Leg5,7diN.SUB.3.-glycosides
(280) Azido derivatives of N-acetylmannosamine (ManNAc) and mannose have been shown to be suitable starting materials for OPME sialylation systems for the synthesis of various 2-3/6-linked sialosides including those containing 7-azido- or 9-deoxy-derivative of Neu5Ac. Here, the diazido-compound 3-9 was tested for the synthesis of glycosides. Advantageously, compound 3-9 was well tolerated by the OPME 2-3/6-sialylation systems as demonstrated with three different acceptors including para-nitrophenyl -galactoside (GalpNP, 3-10), thiotolyl -galactoside (GalSTol, 3-11), and lactosyl -propylchloride (LacProCl, 3-12). In these systems, compound 3-9 was coupled with pyruvate to formation the diazido-derivative of Leg (Leg5,7diN.sub.3) by a PmAldolase-catalyzed reaction. The Leg5,7diN.sub.3 was activated by cytidine 5-triphosphate (CTP) using an NmCSS-catalyzed reaction to form CMP-Leg5,7diN.sub.3 which was used by a sialyltransferase (e.g., PmST1_M144D or Psp2,6ST) to produce 2-3/6-linked Leg5,7diN.sub.3-containing glycosides (3-13-3-18) (Table 4).
(281) TABLE-US-00005 TABLE 4 One-pot multienzyme (OPME) synthesis of Leg5,7diN.sub.3-containing glycosides.
(282) Leg5,7diN.sub.32-3GalpNP (3-13). GalpNP (15 mg, 0.050 mmol), 2,4-di-azido-6-deoxy-mannose (16 mg, 0.075 mmol), sodium pyruvate (38 mg, 0.35 mmol), CTP (39 mg, 0.075 mmol) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.5) and MgCl.sub.2 (20 mM). After adding sialic acid aldolase (0.5 mg), NmCSS (0.5 mg), and a sialyltransferase PmST1_M144D (1.5 mg) water was added to bring the final volume to 5 mL. The reaction mixture was incubated at 30 C. for 48 h. The reaction progress was monitored using TLC (EtOAc:MeOH:H.sub.2O=6:1:1, by volume) and mass spectrometry. The reaction mixture was diluted with the same volume of ethanol and incubated at 4 C. for 30 min. The mixture was then centrifuged and concentrated, which was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to produce 3-13 (22 mg, 73%). .sup.1H NMR (800 MHz, D.sub.2O) 8.28 (d, J=9.2 Hz, 2H), 7.25 (d, J=9.2 Hz, 2H), 5.28 (d, J=7.8 Hz, 1H), 4.18-4.13 (m, 2H), 4.05-3.99 (m, 1H), 3.89 (q, J=8.4, 6.9 Hz, 2H), 3.79-3.72 (m, 3H), 3.70 (d, J=10.3 Hz, 1H), 3.61-3.55 (m, 1H), 3.42 (d, J=8.7 Hz, 1H), 2.75 (dd, J=12.7, 4.6 Hz, 1H), 1.91 (t, J=12.3 Hz, 1H), 1.37 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 172.87, 161.19, 142.04, 125.60, 115.93, 100.08, 99.08, 75.07, 74.91, 71.76, 68.94, 68.20, 67.12, 66.05, 64.80, 62.86, 60.14, 38.46, 18.33. HRMS (ESI) m z calculated for C.sub.21H.sub.27N.sub.7013 (MH) 585.1594, found 585.1583.
(283) Leg5,7diN.sub.32-3GalSTol (3-15). GalSTol (20 mg, 0.070 mmol), 2,4-di-azido-6-deoxy-mannose (22 mg, 0.10 mmol), sodium pyruvate (58 mg, 0.52 mmol), CTP (54 mg, 0.10 mmol) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.5) and MgCl.sub.2 (20 mM). After adding sialic acid aldolase (0.5 mg), NmCSS (0.5 mg), and a sialyltransferase PmST1_M144D (1.5 mg) water was added to bring the final volume to 5 mL. The reaction mixture was incubated at 30 C. for 48 h. The reaction progress was monitored using TLC (EtOAc:MeOH:H.sub.2O=6:1:1, by volume) and mass spectrometry. The reaction mixture was diluted with the same volume of ethanol and incubated at 4 C. for 30 min. The mixture was then centrifuged and concentrated, which was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to produce 3-15 (39 mg, 98%). .sup.1H NMR (800 MHz, D.sub.2O) 7.48 (d, J=8.0 Hz, 2H), 7.25 (d, J=8.0 Hz, 2H), 4.71 (d, J=9.9 Hz, 1H), 4.18-4.10 (m, 1H), 4.05 (dd, J=9.4, 3.2 Hz, 1H), 3.97-3.94 (m, 1H), 3.79-3.73 (m, 1H), 3.73-3.67 (m, 2H), 3.67-3.61 (m, 2H), 3.60-3.48 (m, 2H), 3.43 (dd, J=8.5, 2.2 Hz, 1H), 2.70 (dd, J=12.8, 4.7 Hz, 1H), 2.33 (s, 3H), 1.92 (t, J=12.4 Hz, 1H), 1.37 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 172.07, 138.37, 131.85, 129.41, 127.59, 99.74, 87.03, 78.20, 76.57, 71.91, 68.70, 67.68, 66.75, 66.04, 64.72, 62.83, 60.36, 38.11, 19.66, 18.51. HRMS (ESI) m z calculated for C.sub.22H.sub.30N.sub.6O.sub.10S (MH) 569.1671, found 569.1666.
(284) Leg5,7diN.sub.32-3LacProCl (3-17). LacProCl (20 mg, 0.048 mmol), 2,4-di-azido-6-deoxy-mannose (15 mg, 0.070 mmol), sodium pyruvate (37 mg, 0.34 mmol), CTP (38 mg, 0.073 mmol) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.5) and MgCl.sub.2 (20 mM). After adding sialic acid aldolase (0.5 mg), NmCSS (0.5 mg), and a sialyltransferase PmST1_M144D (1.5 mg) water was added to bring the final volume to 5 mL. The reaction mixture was incubated at 30 C. for 48 h. The reaction progress was monitored using TLC (EtOAc:MeOH:H.sub.2O=5:2:1, by volume) and mass spectrometry. The reaction mixture was diluted with the same volume of ethanol and incubated at 4 C. for 30 min. The mixture was then centrifuged and concentrated, which was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to produce 3-17 (32 mg, 91%). .sup.1H NMR (800 MHz, D.sub.2O) 4.51 (d, J=7.9 Hz, 1H), 4.50 (d, J=8.0 Hz, 1H), 4.17 (p, J=6.4 Hz, 1H), 4.08-4.01 (m, 2H), 3.99 (d, J=12.2 Hz, 1H), 3.92 (d, J=2.7 Hz, 1H), 3.83 (dq, J=11.3, 5.5, 4.9 Hz, 2H), 3.78-3.62 (m, 9H), 3.61-3.57 (m, 1H), 3.55 (t, J=9.6 Hz, 1H), 3.46-3.40 (m, 1H), 3.31 (t, J=8.2 Hz, 1H), 2.71 (dd, J=12.6, 4.6 Hz, 1H), 2.09 (p, J=6.2 Hz, 2H), 1.88 (t, J=12.3 Hz, 1H), 1.39 (d, J=6.3 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 172.92, 102.13, 101.70, 100.13, 77.85, 75.18, 74.63, 74.26, 73.88, 72.30, 71.74, 68.96, 68.85, 67.37, 66.65, 66.08, 64.80, 62.85, 60.49, 59.55, 41.26, 38.35, 31.29, 18.32. HRMS (ESI) m z calculated for C.sub.24H.sub.39ClN.sub.6O.sub.16 (MH) 701.2038, found 701.2028.
(285) Leg5,7diN.sub.32-6GalpNP (3-14). GalpNP (15 mg, 0.050 mmol), 2,4-di-azido-6-deoxy-mannose (16 mg, 0.075 mmol), sodium pyruvate (38 mg, 0.35 mmol), CTP (39 mg, 0.075 mmol) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.5) and MgCl.sub.2 (20 mM). After adding sialic acid aldolase (0.5 mg), NmCSS (0.5 mg), and Psp2,6ST (1.5 mg) water was added to bring the final volume to 5 mL. The reaction mixture was incubated at 30 C. for 48 h. The reaction progress was monitored using TLC (EtOAc:MeOH:H.sub.2O=6:1:1, by volume) and mass spectrometry. The reaction mixture was diluted with the same volume of ethanol and incubated at 4 C. for 30 min. The mixture was then centrifuged and concentrated, which was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to produce 3-14 (21 mg, 70%). .sup.1H NMR (800 MHz, D.sub.2O) 8.29 (d, J=8.8 Hz, 2H), 7.26 (d, J=9.6 Hz, 2H), 5.18 (d, J=7.2 Hz, 1H), 4.09-4.04 (m, 1H), 4.01 (d, J=3.3 Hz, 1H), 3.97 (dd, J=7.6, 4.5 Hz, 1H), 3.88 (dd, J=10.5, 7.8 Hz, 1H), 3.86-3.83 (m, 1H), 3.78 (dd, J=10.0, 3.4 Hz, 1H), 3.75-3.69 (m, 2H), 3.67 (dd, J=10.6, 4.4 Hz, 1H), 3.48 (dd, J=8.6, 2.2 Hz, 1H), 3.43 (t, J=9.8 Hz, 1H), 2.74-2.71 (m, 1H), 1.71 (t, J=12.3 Hz, 1H), 1.34 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 172.62, 161.33, 142.01, 125.58, 116.04, 100.08, 99.26, 73.56, 71.85, 71.37, 69.78, 68.82, 67.89, 66.25, 65.35, 63.13, 62.77, 39.50, 18.29. HRMS (ESI) m z calculated for C.sub.21H.sub.27N.sub.7O.sub.13 (MH) 585.1594, found 585.1589.
(286) Leg5,7diN.sub.32-6GalSTol (3-16). GalSTol (15 mg, 0.052 mmol), 2,4-diazido-6-deoxy-mannose (16 mg, 0.075 mmol), sodium pyruvate (41 mg, 0.37 mmol), CTP (42 mg, 0.080 mmol) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.5) and MgCl.sub.2 (20 mM). After adding sialic acid aldolase (0.5 mg), NmCSS (0.5 mg), and Psp2,6ST (1.5 mg) water was added to bring the final volume to 5 mL. The reaction mixture was incubated at 30 C. for 48 h. The reaction progress was monitored using TLC (EtOAc:MeOH:H.sub.2O=6:1:1, by volume) and mass spectrometry. The reaction mixture was diluted with the same volume of ethanol and incubated at 4 C. for 30 min. The mixture was then centrifuged and concentrated, which was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to produce 3-16 (29 mg, 93%). .sup.1H NMR (800 MHz, D.sub.2O) 7.48 (d, J=8.0 Hz, 2H), 7.26 (d, J=8.0 Hz, 2H), 4.63 (d, J=9.8 Hz, 1H), 4.10 (p, J=6.4 Hz, 1H), 3.96 (d, J=3.3 Hz, 1H), 3.86 (dd, J=10.1, 7.6 Hz, 1H), 3.80-3.77 (m, 1H), 3.75-3.69 (m, 2H), 3.64 (dd, J=9.4, 3.2 Hz, 1H), 3.59-3.53 (m, 2H), 3.51-3.47 (m, 2H), 2.69 (dd, J=12.8, 4.8 Hz, 1H), 2.34 (s, 3H), 1.70 (t, J=12.3 Hz, 1H), 1.36 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 172.30, 138.22, 131.51, 129.43, 128.14, 99.99, 87.65, 76.79, 73.33, 71.54, 68.76, 68.61, 68.14, 66.21, 65.29, 63.09, 62.99, 58.81, 39.41, 19.67, 18.40. HRMS (ESI) m z calculated for C.sub.22H.sub.30N.sub.6O.sub.10S (MH) 569.1671, found 569.1662.
(287) Leg5,7diN.sub.32-6LacProCl (3-18). LacProCl (25 mg, 0.060 mmol), 2,4-di-azido-6-deoxy-mannose (20 mg, 0.093 mmol), sodium pyruvate (51 mg, 0.47 mmol), CTP (49 mg, 0.093 mmol) were dissolved in water in a 15 mL centrifuge tube containing Tris-HCl buffer (100 mM, pH 8.5) and MgCl.sub.2 (20 mM). After adding sialic acid aldolase (0.5 mg), NmCSS (0.5 mg), and Psp2,6ST (1.5 mg) water was added to bring the final volume to 5 mL. The reaction mixture was incubated at 30 C. for 48 h. The reaction progress was monitored using TLC (EtOAc:MeOH:H.sub.2O=5:2:1, by volume) and mass spectrometry. The reaction mixture was diluted with the same volume of ethanol and incubated at 4 C. for 30 min. The mixture was then centrifuged and concentrated, which was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to produce 3-18 (42 mg, 97%). .sup.1H NMR (800 MHz, D.sub.2O) 4.50 (d, J=8.0 Hz, 1H), 4.41 (d, J=7.9 Hz, 1H), 4.18-4.13 (m, 1H), 4.06 (dt, J=11.0, 6.1 Hz, 1H), 3.97 (d, J=12.3 Hz, 1H), 3.93-3.88 (m, 2H), 3.84 (dt, J=11.0, 6.2 Hz, 1H), 3.82-3.75 (m, 3H), 3.71 (ddd, J=24.5, 10.4, 4.2 Hz, 4H), 3.64 (dd, J=10.0, 3.3 Hz, 1H), 3.61-3.54 (m, 4H), 3.53-3.50 (m, 1H), 3.46 (dd, J=8.7, 2.1 Hz, 1H), 3.32 (t, J=8.7 Hz, 1H), 2.69 (dd, J=12.8, 4.8 Hz, 1H), 2.09 (p, J=6.4 Hz, 2H), 1.79 (t, J=12.3 Hz, 1H), 1.38 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 172.71, 102.80, 101.60, 100.04, 79.41, 74.13, 74.11, 73.07, 72.13, 71.94, 71.53, 70.33, 68.93, 67.85, 66.62, 66.04, 65.27, 63.02, 62.86, 59.81, 41.29, 39.39, 31.30, 18.38. HRMS (ESI) m z calculated for C.sub.24H.sub.39ClN.sub.6O.sub.16 (MH) 701.2038, found 701.2031.
Example 13. Conversion of Leg5,7diN.SUB.3.-glycosides to Leg5,7Ac.SUB.2.-glycosides
(288) Different strategies were tested to convert the azido groups in the glycosides synthesized (3-13-3-18) to N-acetyl groups to form desired Leg5,7Ac.sub.2-containing glycosides (3-19-3-24). A conventional Perlman catalyst-mediated reduction of azide to amine followed by selective acetylation of the amine worked for 3-13, 3-15, 3-16, and 3-18 with 50% in two steps but hydrogenation also converted the aromatic nitro group of 3-13 and 3-14 to the corresponding amine which was undesirable. PMe.sub.3-mediated Staudinger reaction worked well for all compounds and quantitatively produced the corresponding di-amine derivatives. However, selective acetylation of amine by a combination of acetylchloride and trietyl amine in tetrahydrofuran and water (4:1 v/v) produced the di-N-acetyl derivative in poor yields (40%). An alternative N-acetylation strategy using thioacetic acid and catalytic copper sulfate in methanol produced Leg5,7Ac.sub.2-glycosides with very poor yields (<20%). Finally, thioacetic acid-mediated one-pot conversion of azido to acetamido group using saturated sodium bicarbonate in water was employed to afford Leg5,7Ac.sub.2-containing glycosides (3-19-3-24) in 69-88% yields (Table 5). See, Shangguan et al. J Am. Chem. Soc. 2003, 125, 7754-7755. In comparison, poorer yields (45-70%) were obtained when pyridine was used as the solvent in the same method (data not shown).
(289) Notably, Leg5,7Ac.sub.22-3Gal-containing structures have been found in O-antigens of Cronobacter turicensis HPB3287 and G3882, and Enterobacter cloacae C6285. Leg5,7Ac.sub.22-6Gal-containing structures have been found in an extracellular polysaccharide fraction of Enterococcus faecium. Therefore, the obtained thiotolyl -glycosides (Leg5,7Ac.sub.22-3GalSTol 3-21 and Leg5,7Ac.sub.22-6GalSTol 3-22) can be used as building blocks for efficient chemical synthesis of more complex glycosides similar to those described before for Neu5Ac-containing sialosides.
(290) To a stirred solution of azido glycoside (6-30 mg) in saturated sodium bicarbonate solution at 65 C. thioacetic acid (10 eq) was added drop-wisely under inert atmosphere after 12 h add another portion of thioacetic acid (15 eq) and stir the reaction for another 24 h. After completion of the reaction the reaction mixture passed through a BioGel P-2 gel filtration (water was used as an eluent). Then the product containing fractions concentrated was further purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to get pure compound.
(291) TABLE-US-00006 TABLE 5 Production of Leg5,7Ac.sub.2-containing glycosides via azide reduction.
(292) Leg5,7Ac.sub.22-3GalpNP (3-19). 8.5 mg, 81% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 8.28 (d, J=9.6 Hz, 1H), 7.26 (d, J=9.6 Hz, 1H), 5.29 (d, J=7.8 Hz, 1H), 4.25-4.21 (m, 1H), 4.03 (d, J=2.8 Hz, 1H), 3.99-3.94 (m, 1H), 3.94-3.88 (m, 2H), 3.85-3.80 (m, 3H), 3.76 (d, J=6.1 Hz, 2H), 3.73 (s, OH), 3.58 (td, J=11.2, 5.0 Hz, 1H), 2.81 (dd, J=12.8, 4.8 Hz, 1H), 1.96 (s, 2H), 1.94 (s, 2H), 1.77 (t, J=12.0 Hz, 1H), 1.13 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.49, 173.35, 173.24, 161.18, 142.05, 125.61, 115.93, 99.14, 99.13, 74.97, 74.94, 71.29, 68.31, 68.22, 66.84, 66.29, 60.17, 53.39, 51.50, 39.62, 21.62, 21.45, 17.56. HRMS (ESI) m z calculated for C.sub.25H.sub.35N.sub.3O.sub.15 (MH) 616.1995, found 616. 1991.
(293) Leg5,7Ac.sub.22-6GalpNP (3-20). 6.5 mg, 78% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 8.31 (d, J=8.8 Hz, 2H), 7.29 (d, J=9.6 Hz, 2H), 5.19 (d, J=7.2 Hz, 1H), 4.04-3.97 (m, 3H), 3.96-3.91 (m, 1H), 3.89-3.83 (m, 2H), 3.81-3.74 (m, 2H), 3.64 (dd, J=10.0, 2.2 Hz, 1H), 3.60-3.54 (m, 2H), 2.80 (dd, J=12.8, 4.8 Hz, 1H), 1.92 (s, 3H), 1.85 (s, 3H), 1.62 (t, J=11.2 Hz, 1H), 1.12 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.43, 173.06, 173.02, 161.45, 142.06, 125.63, 115.96, 99.67, 99.44, 73.61, 71.88, 71.10, 69.79, 68.10, 68.04, 66.63, 62.89, 53.46, 51.65, 39.92, 21.60, 21.34, 17.57. HRMS (ESI) m z calculated for C.sub.25H.sub.35N.sub.3O.sub.15 (MH) 616.1995, found 616. 1984.
(294) Leg5,7Ac.sub.22-3GalSTol (3-21). 27.8 mg, 88% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 7.49 (d, J=8.0 Hz, 2H), 7.26 (d, J=8.0 Hz, 2H), 4.73 (d, J=9.8 Hz, 1H), 4.11 (dd, J=9.3, 3.1 Hz, 1H), 3.96 (dd, J=12.9, 6.5 Hz, 2H), 3.82 (ddd, J=20.2, 9.8, 3.1 Hz, 2H), 3.71 (dd, J=12.7, 3.8 Hz, 2H), 3.69-3.65 (m, 2H), 3.61 (t, J=9.6 Hz, 1H), 3.58-3.54 (m, 1H), 2.76 (dd, J=12.8, 4.8 Hz, 1H), 2.33 (s, 3H), 1.98 (s, 3H), 1.93 (s, 3H), 1.74 (t, J=12.0 Hz, 1H), 1.14 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.48, 173.38, 173.28, 138.37, 131.82, 129.42, 127.63, 99.25, 87.12, 78.28, 76.63, 71.29, 68.23, 66.91, 66.81, 66.78, 60.44, 53.40, 51.49, 39.56, 21.62, 21.48, 19.65, 17.58. HRMS (ESI) m z calculated for C.sub.26H.sub.38N.sub.2O.sub.12S (MH) 601.2072, found 601.2078.
(295) Leg5,7Ac.sub.22-6GalSTol (3-22). 5.2 mg, 84% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 7.53 (d, J=8.0 Hz, 2H), 7.28 (d, J=8.0 Hz, 2H), 4.68 (d, J=9.6 Hz, 1H), 4.01-3.94 (m, 3H), 3.89 (dd, J=10.3, 2.9 Hz, 1H), 3.84-3.80 (m, 1H), 3.78 (dd, J=8.3, 3.1 Hz, 1H), 3.71-3.64 (m, 2H), 3.61 (t, J=9.6 Hz, 1H), 3.59-3.53 (m, 2H), 2.75 (dd, J=12.8, 4.8 Hz, 1H), 2.34 (s, 3H), 1.93 (s, 3H), 1.87 (s, 3H), 1.64 (t, J=12.0 Hz, 2H), 1.13 (d, J=6.3 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.43, 173.11, 173.00, 138.09, 130.87, 129.51, 128.64, 99.72, 87.52, 76.94, 73.36, 71.09, 68.66, 68.42, 68.15, 66.62, 63.53, 53.51, 51.64, 39.94, 21.63, 21.36, 19.62, 17.61. HRMS (ESI) m z calculated for C.sub.26H.sub.38N.sub.2O.sub.12S (MH) 601.2072, found 601.2063.
(296) Leg5,7Ac.sub.22-3LacProCl (3-23). 5.6 mg, 72% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 4.50 (t, J=8.0 Hz, 2H), 4.11 (dd, J=9.9, 2.9 Hz, 1H), 4.05 (dt, J=11.2, 6.0 Hz, 1H), 3.99 (dt, J=8.2, 4.7 Hz, 2H), 3.94 (d, J=2.8 Hz, 1H), 3.86-3.79 (m, 4H), 3.78-3.69 (m, 5H), 3.69-3.63 (m, 3H), 3.57 (ddt, J=20.3, 10.5, 5.8 Hz, 3H), 3.31 (t, J=8.2 Hz, 1H), 2.78 (dd, J=12.8, 4.8 Hz, 1H), 2.08 (p, J=6.2 Hz, 2H), 1.98 (s, 3H), 1.94 (s, 3H), 1.74 (t, J=12.0 Hz, 1H), 1.16 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.48, 173.47, 173.22, 102.15, 101.69, 99.00, 77.82, 74.88, 74.64, 74.26, 73.87, 72.30, 71.31, 68.90, 68.24, 66.74, 66.65, 66.39, 60.52, 59.59, 53.39, 51.53, 41.25, 39.62, 31.28, 21.63, 21.44, 17.58. HRMS (ESI) m z calculated for C.sub.28H.sub.47ClN.sub.2O.sub.18 (MH) 733.2439, found 734.2425.
(297) Leg5,7Ac.sub.22-6LacProCl (3-24). 7.1 mg, 69% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 4.51 (d, J=8.0 Hz, 1H), 4.43 (d, J=7.2 Hz, 1H), 4.06 (dt, J=10.9, 6.0 Hz, 1H), 4.02-3.96 (m, 3H), 3.94-3.87 (m, 2H), 3.86-3.78 (m, 4H), 3.75-3.69 (m, 3H), 3.69-3.60 (m, 4H), 3.59-3.52 (m, 3H), 3.36 (t, J=8.4 Hz, 1H), 2.72 (dd, J=12.8, 4.8 Hz, 1H), 2.09 (p, J=6.2 Hz, 2H), 2.00 (s, 3H), 1.94 (s, 3H), 1.73 (t, J=12.0 Hz, 1H), 1.15 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.43, 173.27, 172.92, 102.70, 101.57, 99.83, 78.93, 74.17, 74.12, 73.13, 72.37, 71.91, 71.12, 70.21, 68.26, 67.93, 66.62, 62.91, 59.72, 53.51, 51.57, 41.28, 39.63, 31.31, 21.64, 21.62, 17.57. HRMS (ESI) m z calculated for C.sub.28H.sub.47ClN.sub.2O.sub.18 (MH) 733.2439, found 734.2431.
Example 14. Production of Leg5,7Ac.SUB.2.-terminated propylazido--glycosides from propyl chloro--glycosides
(298) The propyl chloride linker in compounds 3-23 and 3-24 was readily converted to propyl azide by treating them with sodium azide (NaN.sub.3) and a catalytic amount of sodium iodide (NaI) in dimethylformamide (DMF) at 60 C. for a period of 12 hours to produce Leg5,7Ac.sub.22-3LacProN.sub.3 (3-25, shown below) and Leg5,7Ac.sub.22-6LacProN.sub.3 (3-26, shown below) in 85% and 92% yields, respectively. The azido group in the final products can be easily reduced to an amine group for microarray studies and for synthesizing glycoconjugates, as described above.
(299) ##STR00085##
(300) To a stirred solution of Leg5,7Ac.sub.22-3LacProCl (5.0 mg) or Leg5,7Ac.sub.22-6LacProCl (5.2 mg) in DMF, NaN.sub.3 (10 eq) and NaI (1 eq) were added and the reaction was left under 60 C. for 12 h. After completion of the reaction the solvent was concentrated in vaccuo. The crude product was purified by automated flash chromatograph using C18 column (CH.sub.3CN in H.sub.2O gradient was used as running solvents) to give the pure compounds.
(301) Leg5,7Ac.sub.22-3LacProN.sub.3 (3-25). 4.3 mg, 85% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 4.51 (d, J=7.8 Hz, 1H), 4.49 (d, J=8.0 Hz, 1H), 4.11 (dd, J=9.9, 3.0 Hz, 1H), 4.02-3.96 (m, 3H), 3.95 (d, J=2.9 Hz, 1H), 3.86-3.79 (m, 3H), 3.78-3.73 (m, 2H), 3.73-3.69 (m, 2H), 3.69-3.63 (m, 3H), 3.62-3.54 (m, 3H), 3.46 (t, J=6.7 Hz, 2H), 3.31 (t, J=8.4 Hz, 1H), 2.78 (dd, J=12.8, 4.8 Hz, 1H), 1.98 (s, 3H), 1.94 (s, 3H), 1.91 (q, J=6.6 Hz, 2H), 1.74 (t, J=12.0 Hz, 1H), 1.16 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.48, 173.47, 173.22, 102.15, 101.63, 99.00, 77.83, 74.88, 74.64, 74.26, 73.88, 72.29, 71.31, 68.90, 68.23, 66.87, 66.73, 66.39, 60.51, 59.59, 53.39, 51.53, 47.37, 39.61, 27.74, 21.63, 21.43, 17.57. HRMS (ESI) m z calculated for C.sub.28H.sub.47N.sub.5O.sub.18 (MH) 740.2843, found 740.2840.
(302) Leg5,7Ac.sub.22-6LacProN.sub.3 (3-26). 4.8 mg, 92% was obtained as a white solid. .sup.1H NMR (800 MHz, D.sub.2O) 4.50 (d, J=8.0 Hz, 1H), 4.43 (d, J=8.0 Hz, 1H), 4.03-3.96 (m, 4H), 3.92-3.88 (m, 2H), 3.86-3.79 (m, 3H), 3.79-3.74 (m, 1H), 3.71 (t, J=10.0 Hz, 1H), 3.69-3.64 (m, 4H), 3.64-3.60 (m, 3H), 3.59-3.53 (m, 2H), 3.46 (t, J=6.4 Hz, 1H), 3.36 (t, J=8.8 Hz, 1H), 2.72 (dd, J=12.8, 4.8 Hz, 1H), 2.00 (s, 3H), 1.94 (s, 3H), 1.91 (q, J=6.3 Hz, 1H), 1.73 (t, J=12.0 Hz, 1H), 1.15 (d, J=6.4 Hz, 3H). .sup.13C NMR (200 MHz, D.sub.2O) 173.43, 173.27, 172.93, 102.71, 101.51, 99.83, 78.97, 74.17, 74.13, 73.13, 72.36, 71.91, 71.12, 70.22, 68.26, 67.93, 66.84, 66.62, 62.91, 59.73, 53.51, 51.57, 47.39, 39.63, 27.75, 21.64, 21.62, 17.57. HRMS (ESI) m z calculated for C.sub.28H.sub.47N.sub.5O.sub.18 (MH) 740.2843, found 740.2807.
Example 15. Sialidase Substrate Specificity Studies
(303) Leg5,7diN.sub.32-3/6GalpNP (3-13 and 3-14) and Leg5,7Ac.sub.22-3/6GalpNP (3-19 and 3-20) were tested as potential substrates for recombinant human cytosolic sialidase hNEU2 and several bacterial sialidases (including three commercially available sialidases from Arthrobacter ureafaciens, Vibrio cholerae, and Clostridium perfringens (CpNanH), as well as five recombinant bacterial sialidases such as PmST1, Bifidobacterium infantis sialidase BiNanH2, Streptococcus pneumoniae sialidases SpNanA, SpNanB, and SpNanC). It was interesting to note that Leg5,7Ac.sub.22-3GalpNP (3-19), but not Leg5,7diN.sub.32-3GalpNP (3-13), was a substrate for the 2-3-sialidase activity of wild-type PmST1. Other sialidases tested did not show activity for any of the compounds (3-13, 3-14, 3-19, and 3-20).
(304) Assays were carried out in duplicate. For each reaction in a final volume of 20 L, a sialoside was incubated with an appropriate amount of a sialidase in a buffer solution in a 0.5 mL microcentrifuge tube at 37 C. for 16 hs. The sialidase amounts and buffers used were: A. ureafaciens sialidase (0.5 mU), NaOAc buffer (100 mM, pH 5.5); C. perfringens sialidase (0.75 mU), MES buffer (100 mM, pH 5.0); V. cholerae sialidase (1.5 mU), NaCl (150 mM), CaCl.sub.2 (10 mM), NaOAc buffer (100 mM, pH 5.5); SpNanA (1.5 ng), NaOAc buffer (100 mM, pH 6.0); SpNanB (3 ng), NaOAc buffer (100 mM, pH 6.0); SpNanC (20 ng), MES buffer (100 mM, pH 6.5); PmST1 (0.4 g), NaOAc buffer (100 mM, pH 5.5), CMP (0.4 mM); hNEU2 (1.3 g), MES buffer (100 mM, pH 5.0); BiNanH2 (4 ng), NaOAc buffer (100 mM, pH 5.0). The reactions were stopped by adding 20 L of pre-chilled ethanol. The mixtures were then centrifuged and the supernatants were analyzed by Agilent 1290 Infinity HPLC system at 315 nm or P/ACE MDQ Capillary Electrophoresis at 315 nm. A C14 reverse phase Rapid Resolution High Definition column (BONUS RP RRHD 1.8 m, 2.1150 mm, Agilent) was used for analyzing samples with Neu5Ac2-3GalpNP and Neu5Ac2-6GalpNP, which are used as control. A C18 reverse phase Rapid Resolution High Definition column (EclipsePlusC18 RRHD 1.8 m, 2.150 mm, Agilent) was used for analyzing samples with Leg5,7Ac.sub.22-3GalpNP (3-19) and Leg5,7Ac.sub.22-6GalpNP (3-20). The mobile phases used were acetonitrile in H.sub.2O mixed solvent with varied percentages of acetonitrile: 12% for Neu5Ac2-3GalpNP; 4.5% for Neu5Ac2-6GalpNP; 6% for Leg5,7 Ac.sub.22-3GalpNP (3-19) and Leg5,7Ac.sub.22-6GalpNP (3-20). P/ACE MDQ Capillary Electrophoresis was used for analyzing Leg5,7diN.sub.32-3GalpNP (3-13) and Leg5,7diN.sub.32-6GalpNP (3-14).
Example 16. Kinetic Studies for PmST1
(305) Kinetic studies for PmST1 were performed in duplicates at 37 C. for 10 min. Each reaction in a total volume of 20 L contained NaOAc buffer (100 mM, pH 5.5), CMP (0.4 mM), a sialidase substrate Neu5Ac2-3GalpNP or Leg5,7Ac.sub.22-3GalpNP (3-19), and PmST1 (0.2 g when Neu5Ac2-3GalpNP was used as the substrate and 4 g when Leg5,7Ac.sub.22-3GalpNP (3-19) was used as the substrate). The reactions were stopped by adding 20 L of pre-chilled ethanol. The mixtures were then centrifuged and the supernatants were analyzed by the HPLC system described above for sialidase substrate specificity studies assays. Apparent kinetic parameters were obtained by varying substrate concentrations from 0.1-40 mM (0.1, 0.2, 0.4, 1, 2, 4, 10, 20, and 40 mM) and fitting the data (the average values of duplicate assay results) into the Michaelis-Menten equation using Grafit 5.0.
(306) The kinetics studies showed that in the presence of 0.4 mM CMP, 2-3-sialidase activity of PmST1 for Leg5,7Ac.sub.22-3GalpNP (3-19) (k.sub.cat/K.sub.M=4 min.sup.1 mM.sup.1) was about 30-fold less efficient than for Neu5Ac2-3GalpNP (k.sub.cat/K.sub.M=117 min.sup.1 mM.sup.1) which was contributed by both a lower k.sub.cat value and a higher K.sub.M value when Leg5,7Ac.sub.22-3GalpNP (3-19) was used as the substrate. (See Table 6)
(307) Therefore, the PmST1 2-3-sialidase activity is not a concern for synthesizing 2-3-linked Leg5,7diN.sub.3-glycosides described here but is a factor for consideration for the synthesis of 2-3-linked Leg5,7Ac.sub.2-glycosides.
(308) TABLE-US-00007 TABLE 6 Apparent kinetics parameters for PmST1. k.sub.cat/K.sub.M (min.sup.1 Sialidase Substrate k.sub.cat (min.sup.1) K.sub.M (mM) mM.sup.1) PmST1 Neu5Ac2-3GalpNP 555.4 11.1 4.73 0.31 117 Leg5,7Ac.sub.22- 69.3 1.3 17.38 0.70 4 3GalpNP (3-19)
(309) Indeed, commercially available wild-type PmST1 was found to be as effective as its M144D mutant (with decreased sialidase activity) in synthesizing 2-3-linked Leg5,7Ac.sub.2-glycosides 3-13, 3-15, and 3-17 (data not shown). Psp2,6ST A336G mutant with a higher expression level and commercially available Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST) are also suitable sialyltransferases for OPME synthesis of 2-6-linked Leg5,7diN.sub.3-glycosides 3-14, 3-16, and 3-18 (data not shown).
(310) In conclusion, 2,4-diazido-2,4,6-trideoxy mannose (6deoxyMan2,4diN.sub.3) has been designed as an easy-to-obtained and highly effective chemoenzymatic synthon. It was readily synthesized from commercially available D-fucose by chemical methods in eight steps with an overall yield of 60% and was successfully used for highly efficient chemoenzymatic synthesis of a library of 2-3- and 2-6-linked di-N-acetyllegionaminic acid (Leg5,7Ac.sub.2)-containing glycosides in 57-86% yields. The chemoenzymatic method described here allows high-yield synthesis of a diverse array of biologically important Leg5,7Ac.sub.2-containing glycosides using commercially available enzymes. The method of designing chemoenzymatic synthons for enzymatic formation of glycosides followed by chemical derivatization can be a general strategy for producing complex N-acetyl-containing glycosides.
Example 17. 4-Azido-2,3-Dehydro-2,4-dideoxy-N-acetylneuraminic Acid (Neu5Ac4N.SUB.3.2en) as a Chemoenzymatic Synthon for Neu5Ac4N.SUB.3.-glycosides and Neu5Ac4NAc-glycosides
(311) 4-Azido-4-deoxy-N-acetylneuraminic acid (Neu5Ac4N.sub.3, 6A) and 4-acetamido-4-deoxy-N-acetylneuraminic acid (Neu5Ac4NAc, 6) were synthesized by chemoenzymatic methods via 4-azido-2,3-dehydro-2,4-dideoxy-N-acetylneuraminic acid (Neu5Ac4N.sub.32en, 4-5) as a key intermediate (Scheme 14). C-4 modified sialic acid cannot be achieved by sialic acid aldolase-catalyze reactions due to the mandatory installation of a hydroxyl group on C-4 during the aldolase reactions. Described herein is the first enzymatic enzymatic method to obtain Neu5Ac4N.sub.3 (7) by the hydration of Neu5Ac4N.sub.32en catalyzed by Streptococcus pneumoniae sialidase SpNanC,.sup.1-2 a sialidase that catalyzed the formation and also hydration of Sia2ens.
(312) The starting material N-acetylneuraminic acid (Neu5Ac) was fully protected to produce compound 4-2. Compound 4-2 was then converted to a 4,5-oxazoline intermediate (4-3), which was conveniently converted to the protected compound 4. Deprotection of compound 4-4 formed Neu5Ac4N.sub.32en (4-5). Hydration of Neu5Ac4N.sub.32en by SpNanC was slower compared to the hydration of Neu5Ac. However, the reaction could be driven to completion with a long reaction time. A yield of 60-80% was obtained for a 3-day reaction. Neu5Ac4N.sub.3 (6A) was converted to the target product Neu5Ac4NAc (6) by treating with thioacetic acid (AcSH) in saturated sodium bicarbonate (NaHCO.sub.3) in water. The new chemoenzymatic method for synthesizing 4-modified sialic acids has significant advantages compared to previously reported chemical methods (Carbohydrate Research. 1989; 194:c15-8).
(313) ##STR00086##
Example 18. Chemoenzymatic Synthesis of Neu5Ac7NAc-glycosides
(314) O-Acetylation at the C7 position of sialic acid is notoriously challenging to study. It can easily migrate to the C8 position and then to the C9 position and is commonly presented as a mixture of the multi-O-acetylated forms. It is also labile and can be lost easily, particularly when pH is above 6 or below 3. It is also subjected to esterase-catalyzed hydrolysis. To overcome the challenges in study of 7-O-acetyl Neu5Ac (Neu5,7Ac.sub.2), its stable analog 7-acetamido-7-deoxy-N-acetylneuraminic acid (Neu5Ac7NAc) is described here. Neu5Ac7NAc-containing sialosides can be prepared as described above and used for functional studies.
(315) Chemical syntheses of 2,4-diacetamido-2,4-dideoxy-mannose (Man2,4NAc.sub.2, 2) have been successfully achieved by two methods: a route from N-acetylmannosamine (ManNAc, 4.0) via modified 1,6-anhydro sugar and 4-azido-4-deoxy-N-acetylmannosamine (ManNAc4N.sub.3, 2A) (Scheme 15), and a route from commercially available D-galactose (4-10) via formation of mannose derivative 4-14 as an intermediate for the formation of Man2,4NAc.sub.2 (2) (Scheme 16). The route shown in Scheme 15 is particularly advantageous for preparation of purified Man2,4NAc.sub.2 in good yield.
(316) ##STR00087##
(317) ManNAc4N.sub.3 (2A) and Man2,4NAc.sub.2 (2) were prepared via a modified 1,6-anhydro sugar as shown in Scheme 15. 2-Acetamido-2-deoxy-D-mannopyranose (4.0) (2.00 g, 9.04 mmol) was dissolved in anhydrous pyridine (20 mL), cooled in an ice-water bath, a solution of p-toluene sulfonylchloride (2.09 g, 5.42 mmol) in anhydrous pyridine (5.0 mL) was slowly added. The reaction was stirred for 5.0 h in an ice-water bath to produce 2-acetamido-2-deoxy-6-O--tolylsulfonyl-D-mannopyranose. The reaction was stopped and quenched by adding methanol and the solution was concentrated under reduced pressure. The compound was purified by silica gel column chromatography (dichloromethane:acetone=1:2, by volume).
(318) 2-Acetamido-2-deoxy-6-O--tolylsulfonyl-D-mannopyranose (1.3 g, 3.56 mmol) was dissolved in anhydrous ethanol (30 mL) at room temperature. 1,8-Diazabicyclo[5.4.0]undec-7-ene (1.1 mL, 7.19 mmol) was added slowly to the reaction mixture, and the reaction was stirred for 20 h under nitrogen. The solvent was removed under reduced pressure, and the compound was purified by silica gel column chromatography (ethyl acetate:methanol=15:1, by volume) to produce compound 4.2 (0.70 g, 38% over two step). .sup.1H NMR (400 MHz, CD.sub.3OD) 2.05 (s, 3H), 3.38 (s, 1H), 3.70 (t, 1H, J=6.8 Hz), 3.76 (bs, 1H), 3.83 (m, 1H), 4.13 (dd, 1H, J=2 Hz, 5.6H), 4.29 (dd, 1H, J=1.2 Hz, 6.8 Hz), 4.503 (1H, m), 5.27 (bs, 1H). .sup.13C NMR (100 MHz, CD.sub.3OD) 21.3, 48.5, 64.2, 69.4, 72.0, 75.9, 100.5, 171.7.
(319) 2-Acetamido-1,6-anhydro-2-deoxy--D-mannopyranose (4.2) (0.51 g, 2.52 mmol) and triphenylphosphine (0.79 g, 3.03 mmol) were added to a round bottom flask and dissolved in anhydrous tetrahydrofuran (23 mL) under nitrogen. The reaction mixture was cooled in an ice-water bath, and diisopropylazodicarboxylate (0.59 mL, 3.03 mmol) was added drop-wisely. The reaction mixture was stirred in an ice-water bath for 4 h before it was concentrated under reduced pressure. The compound was purified by silica gel column chromatography (acetone:dichloromethane=1:20, by volume) to produce 2-acetamido-1,6:3,4-dianhydro-2-deoxy--D-talopyranose (4.3) in 76% yield. .sup.1H NMR (400 MHz, CD.sub.3OD) 2.03 (s, 3H), 3.23 (bt, 1H, J=4 Hz), 3.47 (m, 1H), 3.73 (t, 1H, J=4 Hz), 3.93 (d, 1H, J=8 Hz), 4.22 (m, 1H), 4.85 (m, 1H), 5.23 (d, 4 Hz). .sup.13C NMR (100 MHz, CD.sub.3OD) 21.1, 48.3, 48.5, 55.3, 63.8, 71.9, 96.6, 171.9.
(320) 2-Acetamido-1,6:3,4-dianhydro-2-deoxy--D-talopyranose (4.3) (0.47 g, 2.52 mmol), anhydrous Dowex H.sup.+ resin (120 mg) and sodium azide (0.66 g, 10.15 mmol) were added to a round bottom flask and anhydrous N, N-dimethylformamide (15 mL) was added. The solution was stirred for 10 h at 100 C. in an oil bath. Resin was removed by filtration on celite and washed with ethyl acetate. The reaction mixture was concentrated under reduced pressure on high vacuum and the compound was purified by silica gel column chromatography (dichloromethane:acetone=3:1, by volume) to produce 2-acetamido-1,6-anhydro-4-azido-2,4-dideoxy--D-mannopyranose (4.4) in 71% yield. .sup.1H NMR (400 MHz, CD.sub.3OD) 2.04 (s, 3H), 3.62 (bs, 1H), 3.75 (dd, 1H, J=6 Hz, 8 Hz), 3.91 (m, 1H), 4.04 (m, 1H), 4.34 (dd, 1H, J=1.2 Hz, 7.2 Hz), 4.673 (m, 1H), 5.29 (s, 1H).
(321) A mixture of 2-acetamido-1,6-anhydro-4-azido-2,4-dideoxy--D-mannopyranose (4.4) was acetylated in the presence of acetic anhydride and pyridine. The solution was stirred for 5 h at room temperature. The reaction was stopped by adding MeOH and the reaction mixture was subjected to silica gel column chromatography (hexane:ethyl acetate=1:2, by volume) to produce 2-acetamido-3-O-acetyl-1,6-anhydro-4-azido-2,4-dideoxy--D-mannopyranose (4.5). .sup.1H NMR (400 MHz, CD.sub.3Cl) 1.99 (s, 3H), 2.14 (s, 3H), 3.56 (s, 1H), 3.83 (dd, 1H, J=5.6 Hz, 8.4 Hz), 4.31 (dd, 1H, 7.6 Hz), 4.43 (m, 1H), 4.59 (m, 1H), 5.05 (dd, 1H, J=5.2 Hz), 5.53 (bs, 1H). .sup.13C NMR (100 MHz, CD.sub.3Cl) 20.9, 23.2, 466.7, 60.5, 65.9, 69.2, 73.8, 100.7, 169.7, 169.7.
(322) 2-Acetamido-3-O-acetyl-1,6-anhydro-4-azido-2,4-dideoxy--D-mannopyranose (4.5) (0.72 g, 2.65 mmol) was dissolved in acetic anhydride (10 mL) under nitrogen at 0 C. Trimethylsilyl triflate (0.48 mL, 2.65 mmol) was added slowly. The reaction was stirred under ice-cold water for 3 h. The reaction was stopped by adding sodium bicarbonate solution. The reaction mixture was extracted by ethyl acetate. Organic layer was washed using a sodium chloride solution and dried over Na.sub.2SO.sub.4. The reaction mixture was concentrated under reduced pressure on high vacuum and the compound was purified by silica gel column chromatography (dichloromethane:methanol=40:1, by volume) to produce 2-acetamido-1,3,6-tri-O-acetyl-4-azido-2,4-dideoxy-D-mannopyranose (6) in 80% yield. .sup.1H NMR (400 MHz, CD.sub.3Cl) 2.06 (s, 3H), 2.06 (s, 3H), 2.07 (s, 3H), 2.07 (s, 3H), 2.08 (s, 3H), 2.10 (s, 3H), 2.11 (s, 3H), 2.12 (s, 3H), 2.15 (s, 3H), 3.55-3.73 (m, 2H), 3.78-3.83 (m, 1H), 4.24-4.35 (m, 3H), 4.59-4.63 (m, 1H), 4.71-4.74 (m, 1H), 4.99 (dd, 1H, J=4.8 Hz, 9.6 Hz), 5.24 (dd, 1H, 4.4 Hz, 10.4 Hz), 5.79 (1H, bs), 5.97 (1H, bs), 6.05 (d, 1H, J=8.4 Hz), 6.23 (d, 1H, J=9.6 Hz). .sup.13C NMR (400 MHz, CD.sub.3Cl) 20.7, 20.7, 20.7, 20.7, 20.7, 20.8, 23.0, 23.2, 48.6, 49.5, 56.2, 56.5, 62.8, 63.0, 70.5, 70.6, 73.4, 73.6, 90.5, 91.7, 168.2, 168.2, 169.8, 169.9, 170.6, 170.6, 170.7, 171.1
(323) 2-Acetamido-1,3,6-tri-O-acetyl-4-azido-2,4-dideoxy-D-mannopyranose (4.6) (0.78 g, 2.09 mmol) was dissolved in dry MeOH and 0.2 mL of sodium methoxide solution (5.4 M) was added. After the reaction was completed, the reaction mixture was neutralized by H.sup.+ resin. Product was purified by silica gel column chromatography (dichloromethane:methanol=25:1, by volume) to produce 0.43 g of 2-acetamido-4-azido-2,4-dideoxy-D-mannopyranose (2A). .sup.1H NMR (400 MHz, CD.sub.3OD) 2.02 (s, 3H), 2.04 (s, 3H), 3.41-3.49 (m, 2H), 3.61 (d, 1H, J=8 Hz), 3.66-3.78 (m, 4H), 3.79-3.87 (m, 2H), 3.93 (dd, 1H, J=3.6 Hz, 10.4 Hz), 4.10-4.15 (m, 1H), 4.26 (dd, 1H, J=1.2 Hz, 4.8 Hz), 5.03 (bs, 1H), 5.12 (d, 1H, J=3.6 Hz). 13C NMR (400 MHz, CD.sub.3OD) 21.2, 21.3, 53.4, 54.6, 59.5, 61.1, 61.2, 63.0, 68.4, 70.1, 70.2, 70.6, 91.3, 93.6, 172.4, 172.7.
(324) 2-Acetamido-4-azido-2,4-dideoxy-D-mannopyranose (2A) was dissolved in pyridine (4 mL) and thioacetic acid (1.8 mL) was added. The reaction mixture was stirred for 24 h under argon at room temperature. The reaction was quenched by adding methanol and the solvent was removed under reduced pressure. The compound was purified by silica gel column chromatography (ethyl acetate:methanol=15:1, by volume) to produce 2,4-diacetamido-2,4-dideoxy-D-mannopyranose (2). .sup.1H NMR (800 MHz, D.sub.2O) 1.92 (s, 3H), 1.93 (s, 3H), 1.96 (s, 3H), 2.00 (s, 2H), 3.35 (m, 1H), 3.50 (s, 1H), 3.54-3.58 (m, 2H), 3.61 (dd, 1H, J=1.6 Hz, 12.8 Hz), 3.73 (t, 1H, J=10.4 Hz), 3.77-3.82 (m, 2H), 3.85 (t, 1H, J=11.2 Hz), 4.02 (dd, 1H, J=4 Hz, 10.4 Hz), 4.22 (bd, 1H, J=4 Hz), 4.37 (bd, 1H, J=4.8 Hz), 4.89 (s, 1H), 5.06 (s, 1H). .sup.13C NMR (200 MHz, D.sub.2O) 21.9, 22.0, 22.0, 22.0, 47.9, 48.2, 52.5, 53.5, 60.8, 66.8, 70.1, 70.8, 75.5, 93.0, 174.7, 174.8, 174.8 175.8.
(325) ##STR00088## ##STR00089##
(326) Man2,4diN.sub.3 (4-16) and Man2,4NAc.sub.2 (2) were prepared from galactose as shown in Scheme 16. D-Galactopyranose (4-10) (7.00 g, 38.8 mmol) and sodium acetate (3.7 g, 0.045 mole) were dissolved in acetic anhydride (50 mL). The reaction mixture was heated at 120 C. for 1 h and neutralized using sodium bicarbonate. The compound was extracted by washing with dichloromethane and the dichloromethane solution was washed with brine. Organic layer was dried on sodium sulfate and the solvent was removed under reduced pressure to produce 1,2,3,4,6-penta-O-acetyl-D-galactopyranose (4-11) in quantitative yield.
(327) Compound 4-11 (21.67 g, 0.055 mmol) and 4-methoxyphenol (10.33 g, 0.083 mmol) were added to a round bottom flask and dissolved in dichloromethane (50 mL). The reaction mixture was cooled in ice-water bath. Boron trifluoride diethyl etherate (11.86 g, 0.0832 mmol) was added slowly in to the reaction mixture. The reaction was stirred for 6 h and quenched by MeOH. The solvent was removed under reduced pressure and the residue was subjected to silica gel column chromatography (hexane:ethyl acetate=3:1, by volume) to produce 1-(4-methoxybenzyl)-2,3,4,6-tetra-O-acetyl-D-galactopyranose in 81% yield..sup.11
(328) 1-(4-Methoxybenzyl)-2,3,4,6-tetra-O-acetyl-D-galactopyranose was dissolved in dry MeOH and 0.2 mL of sodium methoxide solution (5.4 M) was added. After the reaction was completed, the reaction mixture was neutralized by H.sup.+ resin. The product was purified by silica gel column chromatography (ethyl acetate; methanol=20:1, by volume) to produce 1-(4-methoxybenzyl)-D-galactopyranosides (4-12) in 95% yield. -isomer .sup.1H NMR (400 MHz, CD.sub.3OD) 3.64 (d, 2H, J=6.4 Hz), 3.75 (s, 3H), 3.75-3.81 (m, 1H), 4.08-4.18 (m, 2H), 4.21-4.26 (m, 1H), 5.42 (d, 1H, J=1.6 Hz), 6.82-6.87 (m, 2H), 6.98-7.04 (m, 2H). .sup.13C NMR (100 MHz, CD.sub.3OD) 54.76, 63.0, 70.9, 76.9, 82.2, 83.4, 107.3, 114.2, 114.2, 117.9, 117.9, 151.1, 155.0. -isomer .sup.1H NMR (400 MHz, CD.sub.3OD) 3.31-3.34 (m, 2H), 3.36 (s, 1H), 3.56 (dd, 1H, J=3.2 Hz, 9.6 Hz), 3.63-3.67 (m, 1H), 3.76 (s, 3H), 3.77-3.81 (m, 1H), 3.91 (bs, 1H, J=3.6 Hz), 6.81-6.86 (m, 2H), 7.06-7.09 (m, 2H). .sup.13C NMR (100 MHz, CD.sub.3OD) 54.6, 61.0, 68.8, 70.9, 73.5, 75.5, 102.7, 113.9, 113.9, 117.8, 117.8, 151.9, 155.2.
(329) Compound 4-12 (0.60 g, 2.10 mmol) and bis(tri-n-butyltin) oxide (1.78 g, 3.15 mmol) were dissolved in toluene (70 mL). The reaction mixture was heated to 140 C. in oil bath for 15 minutes. Reaction mixture was cooled down to 0 C. in ice-water bath and benzoyl chloride (0.88 g, 6.30 mmol) was added. The reaction was stirred for 6 h at low temperature and quenched by adding methanol. The solvent was removed under reduced pressure. Compound was purified by silica gel column chromatography (toluene:ethyl acetate=7:1, by volume) to produce 3,6-dibenzoyl-1-(4-methoxybenzyl)--D-galactopyranose (4-13) in 79% yield. .sup.1H NMR (400 MHz, CD.sub.3OD) 3.76 (s, 3H), 4.09 (t, 1H, J=6.8 Hz), 4.30-4.37 (m, 2H), 4.59-4.73 (m, 2H), 4.90 (d, 1H, J=7.2 Hz), 5.24 (dd, 1H, J=3.2 Hz, 10.4 Hz), 6.71-6.79 (m, 2H), 7.02-7.12 (m, 2H), 7.42-7.53 (m, 4H), 7.57-7.66 (m, 2H), 8.03-8.17 (m, 4H). .sup.13C NMR (100 MHz, CD.sub.3OD) 55.7, 62.9, 67.3, 69.3, 72.6, 75.3, 102.8, 114.5, 118.8, 128.5, 128.6, 129.4, 129.6, 129.8, 129.9, 133.4, 133.6, 151.0, 155.6, 166.2, 166.4
(330) 3,6-Dibenzoyl-1-(4-methoxybenzyl)--D-galactopyranose (4-13) (0.40 g, 0.81 mmol) was dissolved in dichloromethane (25 mL) at 0 C. Pyridine (0.65 mL, 8.09 mmol) was added followed by slow addition of trifluoromethanesulfonic anhydride (0.68 mL 4.04 mmol) at 0 C. After stirring at the same temperature for 30 min, the reaction was quenched by adding sodium bicarbonate. The organic layer was washed with hydrochloric acid (1 N) and brine. Organic layer was combined and concentrated under reduced pressure to produce a crude product, which was used for the next step without any purification. To a solution of 2,4-bistriflate in toluene (20 mL), tetrabutylammonium azide (0.76 g, 2.67 mmol) was added at room temperature. The reaction was stirred at 70 C. for 1 h and then at 90 C. for another 1 h. The solvent was removed under reduced pressure and the residue was purified by silica gel column chromatography (toluene) to produce 2,4-diazido-3,6-dibenzoyl-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-14) in 95.9% yield. .sup.1H NMR (400 MHz, CD.sub.3Cl) 3.71-3.74 (m, 1H), 3.75 (s, 3H), 4.11 (t, 1H, J=10.4 Hz), 4.53-4.65 (m, 2H), 4.80 (dd, 1H, J=2.4, 12.8 Hz) 5.24 (bs, 1H), 5.30 (dd, 1H, J=3.6 Hz, 10 Hz), 6.73-6.78 (m, 2H), 6.99-7.06 (m, 2H), 7.47-7.56 (m, 4H), 7.60-7.69 (m, 2H), 8.09-8.20 (m, 4H). .sup.13C NMR (200 MHz, CD.sub.3Cl) 55.5, 57.4, 61.5, 63.7, 73.0, 74.1, 98.8, 114.5, 118.5, 125.3, 128.2, 128.5, 128.8, 129.1, 129.7, 129.9, 130.1, 133.4, 134.1, 150.3, 155.8, 165.6, 166.1.
(331) 2,4-Diazido-3,6-dibenzoyl-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-14) (0.50 g, 0.92 mmol) was dissolved in dry MeOH and 0.2 mL of sodium methoxide solution (5.4 M) added. After the reaction was completed, the reaction mixture was neutralized using H.sup.+ resin. The product was purified by silica gel column chromatography (toluene:ethyl acetate=7:1, by volume) to produce 0.28 g of 2,4-diazido-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-15). .sup.1H NMR (400 MHz, CD.sub.3Cl) 2.06-2.10 (m, 1H), 2.61 (d, 1H, J=4.8 Hz), 3.22-3.25 (m, 1H), 3.64 (t, 1H, J=5.2 Hz), 3.77 (s, 3H), 3.91-3.95 (m, 1H), 4.18 (d, 1H, J=1.6 Hz), 5.11 (bs, 1H), 6.82-6.85 (m, 2H), 6.93-6.96 (m, 2H). .sup.13C NMR (100 MHz, CD.sub.3Cl) 55.69, 59.4, 62.0, 63.8, 72.4, 75.11, 98.8, 114.7, 117.6, 150.1, 155.6.
(332) 2,4-Diazido-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-15) (0.28 g 0.84 mmol) was added to a round bottom flask and dissolved in acetonitrile (6 mL). Ammonium cerium nitrate (1.4 g) dissolved in water (1.5 mL) was added slowly while stirring. The reaction was run for 2.5 h at room temperature. The reaction mixture was concentrated, and the residue was purified by silica gel column chromatography (toluene:ethyl acetate=2:1, by volume) to produce 2,4-diazido-2,4-dideoxy-D-mannopyranose (4-16) in 60% yield. .sup.1H NMR (800 MHz, D.sub.2O) 3.30-3.33 (m, 1H), 3.54 (t, 1H, J=11.2 Hz), 3.66 (t, 1H, J=8.8 Hz), 3.64-3.68 (m, 2H), 3.77-3.80 (m, 1H), 3.83 (dd, 1H, J=1.6 Hz, 12.8 Hz), 3.87 (dd, 1H, J=2.4 Hz, 12.8 Hz), 3.99-7.03 (m, 2H), 4.07 (bd, 1H, J=3.2 Hz), 4.21 (dd, 1H, J=3.2 Hz, 9.6 Hz), 4.99 (bs, 1H), 5.29 (bs, 1H).sup.13C NMR (200 MHz, D.sub.2O) 58.7, 59.1, 60.9, 61.0, 63.9, 65.6, 69.5, 70.7, 72.1, 74.7, 92.2, 92.9.
(333) 2,4-Diazido-3,6-dibenzoyl-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-14) (0.22 g, 0.41 mmol) was dissolved in pyridine 4 (mL) and thioacetic acid (1.0 mL) was added. The reaction mixture was stirred for 24 h under reduced pressure at room temperature. The reaction was quenched by adding methanol and the solvent was removed under reduced pressure. The compound was purified by silica gel column chromatography (toluene:ethyl acetate=2:1, by volume) to produce 2,4-diacetamido-3,6-dibenzoyl-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-17) in 88.9% yield. .sup.1H NMR (800 MHz, CD.sub.3Cl,): 1.89 (s, 3H), 2.06 (s, 3H), 3.65 (s, 3H), 3.98 (bt, 1H, J=9.6 Hz), 4.47 (q, 1H, J=9.9), 4.55 (1H, dd, J=11.9, 8.6), 4.65 (bd, J=12 Hz), 5.10 (dd, 1H, J=9.7, 4.0), 5.19 (s, 1H), 5.42 (dd, 1H, J=10.6, 4.0), 6.56-6.52 (m, 2H), 6.90 (d, 2H, J=8.7), 7.36 (t, 2H, J=7.7), 7.43 (t, 2H, J=7.6), 7.51 (t, 1H, J=7.5), 7.59 (t, 1H, J=7.5), 7.95 (d, 2H, J=7.8), 8.00 (d, 2H, J=7.8). .sup.13C NMR (200 MHz, D.sub.2O) 23.1, 23.4, 47.6, 50.6, 55.5, 64.4, 72.0, 74.4, 97.9, 114.4, 118.2, 128.3, 128.4, 128.6, 129.1, 129.3, 129.7, 129.8, 129.8, 133.2, 133.5, 150.6, 155.3, 166.2, 166.8, 171.1, 171.3.
(334) 2,4-Diacetamido-3,6-dibenzoyl-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-17) (0.51 g, 0.88 mmol) was dissolved in dry MeOH and 0.2 mL of sodium methoxide solution (5.4 M) was added. After the reaction was completed, the reaction mixture was neutralized using H.sup.+ resin. Compound was purified by silica gel column chromatography (ethyl acetate:methanol=9:1, by volume) to produce 2,4-diacetamido-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-18) in 79.5% yield. .sup.1H NMR (800 MHz, CD.sub.3OD) 2.02 (s, 3H), 2.12 (s, 3H), 3.38-3.41 (m, 1H), 3.67-3.71 (m, 2H), 3.74 (s, 3H), 3.87-3.93 (m, 2H), 4.69 (bd, 1H, J=2.4 Hz), 5.12 (bd, 1H, J=1.6 Hz), 6.82-6.84 (m, 2H), 6.95-6.98 (m, 2H). .sup.13C NMR (200 MHz, CD.sub.3OD) 22.7, 22.8, 49.7, 54.4, 56.0, 62.4, 71.7, 77.5, 99.6, 115.5, 119.1, 152.4, 156.7, 174.6, 174.9.
(335) 2,4-Diacetamido-2,4-dideoxy-1-(4-methoxybenzyl)--D-mannopyranose (4-18) (0.13 g, 0.34 mmol) was added to a round bottom flask and dissolved in acetonitrile (6 mL). Ammonium cerium nitrate (0.6 g) was dissolved in water (1.5 mL) and was added slowly while stirring. The reaction was run for 4.5 h at room temperature. The reaction mixture was concentrated, and the residue was purified by silica gel column chromatography (ethyl acetate:methanol:water=9:1:0.5, by volume) to produce 2,4-diacetamido-2,4-dideoxy-D-mannopyranose (2) in 80% yield. .sup.1H NMR (800 MHz, D.sub.2O) 1.92 (s, 3H), 1.93 (s, 3H), 1.96 (s, 3H), 2.00 (s, 2H), 3.35 (m, 1H), 3.50 (s, 1H), 3.54-3.58 (m, 2H), 3.61 (dd, 1H, J=1.6 Hz, 12.8 Hz), 3.73 (t, 1H, J=10.4 Hz), 3.77-3.82 (m, 2H), 3.85 (t, 1H, J=11.2 Hz), 4.02 (dd, 1H, J=4 Hz, 10.4 Hz), 4.22 (bd, 1H, J=4 Hz), 4.37 (bd, 1H, J=4.8 Hz), 4.89 (s, 1H), 5.06 (s, 1H). .sup.13C NMR (200 MHz, D.sub.2O) 21.9, 22.0, 22.0, 22.0, 47.9, 48.2, 52.5, 53.5, 60.8, 66.8, 70.1, 70.8, 75.5, 93.0, 174.7, 174.8, 174.8 175.8.
(336) ##STR00090##
(337) Neu5Ac7NAc (4-19) was synthesized from Man2,4diNAc (2) and sodium pyruvate by a Pasteurella multocida sialic acid aldolase (PmAldolase)-catalyzed reaction. Sodium pyruvate (0.94 g, 8.52 mmol) and 2,4-diacetamido-2,4-dideoxy-D-mannopyranose (2) (0.28 g, 20 mM, 1.07 mmol) were dissolved in water in 50 mL centrifuge tubes. An appropriate amount of PmNanA was added. The reaction mixture was incubated at 37 C. for 4-5 days. The reaction was quenched by adding an equal amount of cold methanol. Reaction mixture was centrifuged to remove precipitates. The supernatant was concentrated under reduced pressure and the residue was purified using a Biogel P-2 gel filtration column using water as the eluant, followed by silica gel column chromatography (ethyl acetate:methanol:water=6:2:1, by volume) to produce 5,7-diacetamido-3,5,7-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid (4-19) in 72% yield. .sup.1H NMR (400 MHz, D.sub.2O) 1.83 (t, 1H, J=12.4 Hz), 1.98 (s, 3H), 2.00 (s, 3H), 2.22 (dd, 1H, J=4.8 Hz, 12.8 Hz), 3.43-3.50 (m, 1H), 3.62 (dd, 1H, J=2.8 Hz, 12.4 Hz), 3.69-3.78 (m, 2H), 3.90-4.00 (m, 2H), 4.23 (dd, 1H, J=2.4 Hz, 10.4 Hz). .sup.13C NMR (100 MHz, D.sub.2O) 21.7, 22.1, 39.2, 49.2, 52.4, 63.2, 67.2, 69.6, 70.1, 95.7, 173.9, 174.0, 174.2.
(338) A library of 2-3 and 2-6-linked Neu5Ac7NAc-glycosides can be produced readily from chemically synthesized 2,4-diazido-2,4-dideoxy-D-mannopyranose (Man2,4diN.sub.3) as a chemoenzymatic synthon using highly efficient one-pot multienzyme (OPME) sialylation systems containing a sialic acid aldolase, a CMP-sialic acid synthetase, and a sialyltransferase. As examples, para-nitrophenyl -galactoside (GalpNP) was used as a sialyltransferase acceptor for the synthesis of the corresponding 2-3 and 2-6-linked Neu5Ac7NAc-glycosides.
(339) ##STR00091##
(340) GalpNP (1.0 equiv, 10 mM, 0.043 mmol), 2,4-diazido-2,4-dideoxy-D-mannopyranose (4-16) (1.5 equiv, 15 mM, 0.065 mmol), sodium pyruvate (7.5 equiv, 75 mM, 0.217 mmol), and CTP (2.0 equiv, 20 mM, 0.086 mmol) were dissolved in water in a 50 mL centrifuge tube. Tris-HCl buffer (1 M, pH 8.5, 0.43 mL) and MgCl.sub.2 (200 mM, 0.43 mL) were added. Appropriate amounts of Pasteurella multocida sialic acid aldolase (PmNanA, 2 mg), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS, 2.5 mg), and a sialyltransferase (PmST1 M144D, 5 mg) were added. Water was then added to bring the volume of the reaction mixture to 4.3 mL. The reaction was incubated at 37 C. for 24 h and quenched by adding 5 mL of ice-cold EtOH. The mixture was incubated on ice for 30 min and centrifuged to remove precipitates. The product 4-nitrophenyl-O-(5,7-diacetamido-3,5,7-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.3)-O-s-D-galactopyranoside (4-20) was observed via HRMS; m/z 622.1243 observed for M+Na.sup.+2H.
(341) GalpNP (1.0 equiv, 10 mM, 0.043 mmol), 2,4-diazido-2,4-dideoxy-D-mannopyranose (4-16) (1.5 equiv, 15 mM, 0.065 mmol), sodium pyruvate (7.5 equiv, 75 mM, 0.217 mmol), and CTP (2.0 equiv, 20 mM, 0.086 mmol) were dissolved in water in a 50 mL centrifuge tube. Tris-HCl buffer (1 M, pH 8.5, 0.43 mL) and MgCl.sub.2 (200 mM, 0.43 mL) were added. Appropriate amounts of Pasteurella multocida sialic acid aldolase (PmNanA, 2 mg), Neisseria meningitides CMP-sialic acid synthetase (NmCSS, 2.5 mg), and a sialyltransferase (Psp2,6ST, 3.5 mg) were added. Water was then added to bring the volume of the reaction mixture to 4.3 mL. The reaction was incubated at 37 C. for 24 h. The reaction was quenched by adding 5 mL of ice-cold EtOH. The mixture was incubated on ice for 30 min and centrifuged to remove precipitates. The product 4-nitrophenyl-O-(5,7-diacetamido-3,5,7-trideoxy-D-glycero--D-galacto-2-nonulopyranosylonic acid)-(2.fwdarw.6)-O--D-galactopyranoside (4-21) was observed via HRMS; m/z 622.1241 observed for M+Na.sup.+ 2H.
(342) Although the foregoing has been described in some detail by way of illustration and example for purposes of clarity and understanding, one of skill in the art will appreciate that certain changes and modifications can be practiced within the scope of the appended claims. All publications, patents, patent applications, and sequence accession numbers cited herein are hereby incorporated by reference in their entirety for all purposes.