Anti-idiotypic antibodies against anti-KLK2 antibodies
12162951 ยท 2024-12-10
Assignee
Inventors
- Zemeda AINEKULU (San Diego, CA, US)
- Qiang Chen (San Diego, CA, US)
- Ellen Chi (Del Mar, CA, US)
- Wilson Edwards (Cardiff by the Sea, CA, US)
- Matt HUSOVSKY (Ramona, CA, US)
- Ann Lacombe (San Diego, CA, US)
- Quynh NGUYEN (San Diego, CA, US)
- Paul H. KIM (Encinitas, CA, US)
- H. Mimi ZHOU (San Diego, CA, US)
- John T. LEE (Ambler, PA, US)
Cpc classification
C07K1/22
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K16/3069
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K16/4283
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
G01N33/53
PHYSICS
C07K1/22
CHEMISTRY; METALLURGY
C12N15/00
CHEMISTRY; METALLURGY
C12P21/06
CHEMISTRY; METALLURGY
Abstract
In certain aspects, the disclosure relates to anti-idiotype antibodies and antigen-binding portions thereof that specifically bind a KL2B413 containing protein, e.g., an antibody or antigen-binding portions thereof. In some aspects, the anti-idiotype antibodies and antigen-binding portions of the present disclosure can be used in methods to detect and quantify cells expressing chimeric antigen receptors that include KL2B413.
Claims
1. An anti-idiotype antibody or antigen-binding portion thereof that specifically binds to a target antibody or antigen-binding portion thereof wherein the target antibody comprises a VH domain comprising SEQ ID NO: 41 and a VL domain comprising SEQ ID NO: 42, wherein the anti-idiotype antibody or antigen-binding portion comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs:4-7, a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs:11-14 and a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs:19-20, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs:25-26, a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs:29-30 and a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:33-34.
2. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion thereof comprises a VH domain comprising SEQ ID NO:45 and a VL domain comprising SEQ ID NO:46.
3. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion comprises a heavy chain comprising SEQ ID NO:37 and further comprises a light chain comprising SEQ ID NO:39.
4. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion thereof comprises an antigen-binding portion selected from a Fab, F(ab).sub.2, or scFv.
5. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion thereof is a monoclonal antibody.
6. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion thereof is a chimeric antibody.
7. The anti-idiotype antibody or antigen-binding portion of claim 6, wherein the anti-idiotype antibody or antigen-binding portion thereof comprises a murine IgG2a constant region.
8. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion thereof is in a human constant region.
9. A nucleic acid encoding the heavy chain, the light chain, or both, of the anti-idiotype antibody or antigen-binding portion of claim 1.
10. A nucleic acid encoding the heavy chain, the light chain, or both, of an anti-idiotype antibody or an antigen-binding portion thereof that specifically binds KL2B413, wherein said nucleic acid comprises: a) the nucleotide sequence of SEQ ID NO: 38; b) the nucleotide sequence of SEQ ID NO: 40; c) both a) and b).
11. A vector comprising the nucleic acid of claim 10.
12. The vector of claim 11, wherein the vector is an expression vector.
13. A host cell comprising the vector of claim 12.
14. The host cell of claim 13, wherein the cell is a mammalian cell.
15. A method of producing an anti-idiotype antibody or antigen-binding portion thereof that specifically binds KL2B413, said method comprising culturing the host cell of claim 13 under conditions that allow said antibody or antigen-binding portion to be expressed, wherein the host cell comprises nucleotide sequences coding the heavy chain and light chain of the antibody or antigen-binding portion, and isolating said antibody or antigen-binding portion from the culture.
16. A method for detecting KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of claim 1; and (c) detecting the anti-idiotype antibody or antigen-binding portion, wherein the KL2B413 comprises a VH domain comprising SEQ ID NO: 41 and a VL domain comprising SEQ ID NO: 42.
17. A method for detecting expression of a chimeric antigen receptor (CAR) comprising KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of claim 1; and (c) detecting the anti-idiotype antibody or antigen-binding portion, and thereby detecting the expression of the CAR comprising SEQ ID NO: 41 and a VL domain comprising SEQ ID NO: 42.
18. The method according to claim 16, wherein the antibody comprises a detectable label.
19. The method according to claim 16, wherein the method further comprises contacting the anti-idiotype antibody or antigen-binding portion with a detectable label before detecting the anti-idiotype antibody or antigen-binding portion.
20. The method according to claim 16, wherein the biological sample is blood, serum or urine.
21. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the target antibody or antigen-binding portion thereof is within the antigen-binding domain of the extracellular portion of a chimeric antigen receptor (CAR).
22. The anti-idiotype antibody or antigen-binding portion of claim 21 wherein the target antibody or antigen-binding portion thereof is an scFv and the anti-idiotype antibody or antigen-binding portion specifically binds an epitope in the scFv of the CAR.
23. The anti-idiotype antibody or antigen-binding portion of claim 21, wherein the target antibody or antigen-binding portion thereof binds KLK2.
24. The anti-idiotype antibody or antigen-binding portion of claim 21, wherein the anti-idiotype antibody or antigen-binding portion thereof does not cross-react to other KLK2 antibodies or other KLK2 binding CARs.
25. The anti-idiotype antibody or antigen-binding portion of claim 21, wherein the CAR has an amino acid sequence selected from the group consisting of SEQ ID NOs: 43-44.
26. A kit for detecting the target antibody or antigen-binding portion thereof of claim 1 in a biologic sample comprising: (a) the anti-idiotype antibody or antigen-binding portion of claim 1; and (b) instructions for detecting the target antibody or antigen-binding portion thereof.
27. The anti-idiotype antibody or antigen-binding portion of claim 1, wherein the anti-idiotype antibody or antigen-binding portion detects the target antibody or antigen-binding portion in a biologic sample.
28. A method of purifying KL2B413 from a sample comprising: (a) providing a biological sample comprising KL2B413; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of claim 1; and (c) capturing the anti-idiotype antibody or antigen-binding portion, and thereby purifying KL2B413 comprising SEQ ID NO: 41 and a VL domain comprising SEQ ID NO: 42.
29. A method of selecting CAR-T cell comprising SEQ ID NO: 43 or 44 from a cell population comprising: (a) providing a biological sample comprising CAR-T cells; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of claim 1; and (c) capturing the anti-idiotype antibody or antigen-binding portion, and thereby selecting CAR-T cells.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) For the purpose of illustrating the invention, there are depicted in the drawings certain embodiments of the disclosure. However, the disclosure is not limited to the precise arrangements and instrumentalities of the embodiments depicted in the drawings.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DETAILED DESCRIPTION OF THE INVENTION
Overview
(9) The disclosure provides anti-idiotype antibodies and antigen-binding portions thereof that specifically bind a KL2B413 containing protein, e.g., an antibody or antigen-binding portions thereof. The anti-idiotype antibodies and antigen-binding portions of the present disclosure can be used in methods to detect and quantify cells expressing CARs that include KL2B413. Such methods may allow a researcher to determine whether a given batch of in vitro generated CAR-T cells have expressed the desired CAR and thus whether the cells are therapeutically useful for targeting the desired proteins. In the present disclosure, the anti-idiotype antibodies and antigen-binding portions target KL2B413, which itself targets KLK2, a protein associated with prostatic tissue.
Definitions
(10) As used in this specification and the appended claims, the singular forms a, an, and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a cell includes a combination of two or more cells, and the like.
(11) The transitional terms comprising, consisting essentially of, and consisting of are intended to connote their generally accepted meanings in the patent vernacular; that is, (i) comprising, which is synonymous with including, containing, or characterized by, is inclusive or open-ended and does not exclude additional, unrecited elements or method steps; (ii) consisting of excludes any element, step, or ingredient not specified in the claim; and (iii) consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention. Embodiments described in terms of the phrase comprising (or its equivalents) also provide as embodiments those independently described in terms of consisting of and consisting essentially of.
(12) Activation or stimulation or activated or stimulated refers to induction of a change in the biologic state of a cell resulting in expression of activation markers, cytokine production, proliferation or mediating cytotoxicity of target cells. Cells may be activated by primary stimulatory signals. Co-stimulatory signals can amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity. A co-stimulatory signal refers to a signal, which in combination with a primary signal, such as TCR/CD3 ligation, leads to T cell and/or NK cell proliferation and/or upregulation or downregulation of key molecules.
(13) Anti-idiotype antibody or anti-idiotypic antibody refers to an antibody that specifically binds to the variable region of another antibody. In the case of KLK2, an anti-idiotype antibody specifically binds an anti-KLK2 antibody.
(14) Antigen-binding portion, antigen-binding fragment or antigen-binding domain refers to a portion of the protein that binds an antigen. Antigen binding portions may be synthetic, enzymatically obtainable or genetically engineered polypeptides and include portions of an immunoglobulin that bind an antigen, such as the VH, the VL, the VH and the VL, Fab, Fab, F(ab).sub.2, Fd and Fv fragments, domain antibodies (dAb) consisting of one VH domain or one VL domain, shark variable IgNAR domains, camelized VH domains, VHH domains, minimal recognition units consisting of the amino acid residues that mimic the CDRs of an antibody, such as FR3-CDR3-FR4 portions, the HCDR1, the HCDR2 and/or the HCDR3 and the LCDR1, the LCDR2 and/or the LCDR3, alternative scaffolds that bind an antigen, and multi specific proteins comprising the antigen binding portions. Antigen binding portions (such as VH and VL) may be linked together via a synthetic linker to form various types of single antibody designs where the VH/VL domains may pair intramolecularly, or intermolecularly in those cases when the VH and VL domains are expressed by separate single chains, to form a monovalent antigen binding domain, such as single chain Fv (scFv) or diabody. Antigen binding portions may also be conjugated to other antibodies, proteins, antigen binding portions or alternative scaffolds which may be monospecific or multispecific to engineer bispecific and multispecific proteins.
(15) Cancer refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division and growth results in the formation of malignant tumors that invade neighboring tissues and may also metastasize to distant parts of the body through the lymphatic system or bloodstream. A cancer or cancer tissue can include a tumor.
(16) Full length antibody is comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds as well as multimers thereof (e.g. IgM). Each heavy chain is comprised of a heavy chain variable domain (VH) and a heavy chain constant domain, the heavy chain constant domain comprised of subdomains CH1, hinge, CH2 and CH3. Each light chain is comprised of a light chain variable domain (VL) and a light chain constant domain (CL). The VH and the VL may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR). Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-to-carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
(17) Complementarity determining regions (CDR) are antigen binding sites in an antibody. CDRs may be defined using various terms: (i) Complementarity Determining Regions (CDRs), three in the VH (HCDR1, HCDR2, HCDR3) and three in the VL (LCDR1, LCDR2, LCDR3) are based on sequence variability (Wu and Kabat, J Exp Med 132:211-50, 1970; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991). (ii) Hypervariable regions, HVR, or HV, three in the VH (H1, H2, H3) and three in the VL (L1, L2, L3) refer to the regions of an antibody variable domains which are hypervariable in structure as defined by Chothia and Lesk (Chothia and Lesk, Mol Biol 196:901-17, 1987). The International ImMunoGeneTics (IMGT) database (http://www_imgt_org) provides a standardized numbering and definition of antigen-binding sites. The correspondence between CDRs, HVs and IMGT delineations is described in Lefranc et al., Dev Comparat Immunol 27:55-77, 2003. The term CDR, HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3 as used herein includes CDRs defined by any of the methods described supra, Kabat, Chothia or IMGT, unless otherwise explicitly stated in the specification.
(18) Human antibody refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibody are derived from human immunoglobulin sequences. If human antibody contains a constant region or a portion of the constant region, the constant region is also derived from human immunoglobulin sequences. Human antibody comprises heavy and light chain variable regions that are derived from sequences of human origin if the variable regions of the human antibody are obtained from a system that uses human germline immunoglobulin or rearranged immunoglobulin genes. Such exemplary systems are human immunoglobulin gene libraries displayed on phage, and transgenic non-human animals such as mice or rats carrying human immunoglobulin loci. Human antibody typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to differences between the systems used to obtain the human antibody and human immunoglobulin loci, introduction of somatic mutations or intentional introduction of substitutions into the frameworks or CDRs, or both. Typically, human antibody is at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical in amino acid sequence to an amino acid sequence encoded by human germline immunoglobulin or rearranged immunoglobulin genes. In some cases, human antibody may contain consensus framework sequences derived from human framework sequence analyses, for example as described in Knappik et al., (2000) J Mol Biol 296:57-86, or a synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in Shi et al., (2010) J Mol Biol 397:385-96, and in Int. Patent Publ. No. WO2009/085462. Antibodies in which at least one CDR is derived from a non-human species are not included in the definition of human antibody.
(19) Humanized antibody refers to an antibody in which at least one CDR is derived from non-human species and at least one framework is derived from human immunoglobulin sequences. Humanized antibody may include substitutions in the frameworks so that the frameworks may not be exact copies of expressed human immunoglobulin or human immunoglobulin germline gene sequences.
(20) Isolated refers to a homogenous population of molecules (such as synthetic polynucleotides or polypeptides) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step. Isolated refers to a molecule that is substantially free of other cellular material and/or chemicals and encompasses molecules that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.
(21) Modulate refers to either enhanced or decreased ability of a test molecule to mediate an enhanced or a reduced response (i.e., downstream effect) when compared to the response mediated by a control or a vehicle.
(22) Natural killer cell and NK cell are used interchangeably and synonymously herein. NK cell refers to a differentiated lymphocyte with a CD16.sup.+ CD56.sup.+ and/or CD57.sup.+ TCR.sup. phenotype. NK cells are characterized by their ability to bind to and kill cells that fail to express self MHC/HLA antigens by the activation of specific cytolytic enzymes, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
(23) Specifically binds, specific binding, specifically binding or binds refer to a proteinaceous molecule binding to an antigen or an epitope within the antigen with greater affinity than for other antigens. Typically, the proteinaceous molecule binds to the antigen or the epitope within the antigen with an equilibrium dissociation constant (K.sub.D) of about 110.sup.7 M or less, for example about 510.sup.8 M or less, about 110.sup.8 M or less, about 110.sup.9 M or less, about 110.sup.10 M or less, about 110.sup.11 M or less, or about 110.sup.12 M, 110.sup.13 M, 110.sup.14 M, 110.sup.15 M or less, typically with the K.sub.D that is at least one hundred fold less than its K.sub.D for binding to a non-specific antigen (e.g., BSA, casein). In the context of the prostate neoantigens described here, specific binding refers to binding of the proteinaceous molecule to the prostate neoantigen without detectable binding to a wild-type protein the neoantigen is a variant of.
(24) Tumor cell or a cancer cell refers to a cancerous, pre-cancerous or transformed cell, either in vivo, ex vivo, or in tissue culture, that has spontaneous or induced phenotypic changes. These changes do not necessarily involve the uptake of new genetic material. Although transformation may arise from infection with a transforming virus and incorporation of new genomic nucleic acid, uptake of exogenous nucleic acid or it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene. Transformation/cancer is exemplified by morphological changes, immortalization of cells, aberrant growth control, foci formation, proliferation, malignancy, modulation of tumor specific marker levels, invasiveness, tumor growth in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo.
(25) The term chimeric antigen receptor or CAR as used herein is defined as a cell-surface receptor comprising an extracellular target-binding domain, a transmembrane domain and an intracellular signaling domain, all in a combination that is not naturally found together on a single protein. This particularly includes receptors wherein the extracellular domain and the intracellular signaling domain are not naturally found together on a single receptor protein. The chimeric antigen receptors of the present invention are intended primarily for use with lymphocyte such as T cells and natural killer (NK) cells.
(26) The terms T cell and T lymphocyte are interchangeable and used synonymously herein. As used herein, T cell includes thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes. A T cell can be a T helper (Th) cell, for example a T helper 1 (Th1) or a T helper 2 (Th2) cell. The T cell can be a helper T cell (HTL; CD4+ T cell) CD4+ T cell, a cytotoxic T cell (CTL; CD8+ T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8+ T cell), CD4+CD8+ T cell, or any other subset of T cells. Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells and memory T cells. Also included are NKT cells, which refer to a specialized population of T cells that express a semi-invariant T-cell receptor, but also express a variety of molecular markers that are typically associated with NK cells, such as NK1.1. NKT cells include NK1.1+ and NK1.1, as well as CD4+, CD4, CD8+ and CD8 cells. The TCR on NKT cells is unique in that it recognizes glycolipid antigens presented by the MHC I-like molecule CD Id. NKT cells can have either protective or deleterious effects due to their abilities to produce cytokines that promote either inflammation or immune tolerance. Also included are gamma-delta T cells ( T cells), which refer to a specialized population that to a small subset of T cells possessing a distinct TCR on their surface, and unlike the majority of T cells in which the TCR is composed of two glycoprotein chains designated - and -TCR chains, the TCR in T cells is made up of a -chain and a -chain. T cells can play a role in immunosurveillance and immunoregulation, and were found to be an important source of IL-17 and to induce robust CD8+ cytotoxic T cell response. Also included are regulatory T cells or Tregs, which refer to T cells that suppress an abnormal or excessive immune response and play a role in immune tolerance. Tregs are typically transcription factor Foxp3-positive CD4+ T cells and can also include transcription factor Foxp3-negative regulatory T cells that are IL-10-producing CD4+ T cells.
(27) As used herein, the term antigen refers to any agent (e.g., protein, peptide, polysaccharide, glycoprotein, glycolipid, nucleic acid, portions thereof, or combinations thereof) molecule capable of being bound by a T-cell receptor. An antigen is also able to provoke an immune response. An example of an immune response may involve, without limitation, antibody production, or the activation of specific immunologically competent cells, or both. A skilled artisan will understand that an antigen need not be encoded by a gene at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components, organisms, subunits of proteins/antigens, killed or inactivated whole cells or lysates.
(28) The terms antibody and antibodies refer to monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab) fragments, disulfide-linked Fvs (sdFv), intrabodies, minibodies, diabodies and anti-idiotype (anti-Id) antibodies (including, e.g., anti-Id antibodies to antigen-specific TCR), and epitope-binding portions of any of the above. The terms antibody and antibodies also refer to covalent diabodies such as those disclosed in U.S. Pat. Appl. Pub. 2007/0004909 and Ig-DARTS such as those disclosed in U.S. Pat. Appl. Pub. 2009/0060910. Antibodies useful as a TCR-binding molecule include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgM1, IgM2, IgA1 and IgA2) or subclass.
(29) The term host cell means any cell that contains a heterologous nucleic acid. The heterologous nucleic acid can be a vector (e.g., an expression vector). For example, a host cell can be a cell from any organism that is selected, modified, transformed, grown, used or manipulated in any way, for the production of a substance by the cell, for example the expression by the cell of a gene, a DNA or RNA sequence, a protein or an enzyme. An appropriate host may be determined. For example, the host cell may be selected based on the vector backbone and the desired result. By way of example, a plasmid or cosmid can be introduced into a prokaryote host cell for replication of several types of vectors. Bacterial cells such as, but not limited to DH5a, JM109, and KCB, SURE Competent Cells, and SOLOPACK Gold Cells, can be used as host cells for vector replication and/or expression. Additionally, bacterial cells such as E. coli LE392 could be used as host cells for phage viruses. Eukaryotic cells that can be used as host cells include, but are not limited to yeast (e.g., YPH499, YPH500 and YPH501), insects and mammals. Examples of mammalian eukaryotic host cells for replication and/or expression of a vector include, but are not limited to, HeLa, NIH3T3, Jurkat, 293, COS, CHO, Saos, and PC12.
(30) The terms express and expression mean allowing or causing the information in a gene or DNA sequence to become produced, for example producing a protein by activating the cellular functions involved in transcription and translation of a corresponding gene or DNA sequence. A DNA sequence is expressed in or by a cell to form an expression product such as a protein. The expression product itself, e.g., the resulting protein, may also be said to be expressed by the cell. An expression product can be characterized as intracellular, extracellular or transmembrane.
(31) The term transfection means the introduction of a foreign (i.e., extrinsic or extracellular) nucleic acid into a cell using recombinant DNA technology. The term genetic modification means the introduction of a foreign (i.e., extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence. The introduced gene or sequence may also be called a cloned or foreign gene or sequence, may include regulatory or control sequences operably linked to polynucleotide encoding the chimeric antigen receptor, such as start, stop, promoter, signal, secretion, or other sequences used by a cell's genetic machinery. The gene or sequence may include nonfunctional sequences or sequences with no known function. A host cell that receives and expresses introduced DNA or RNA has been genetically engineered. The DNA or RNA introduced to a host cell can come from any source, including cells of the same genus or species as the host cell, or from a different genus or species.
(32) The term transduction means the introduction of a foreign nucleic acid into a cell using a viral vector.
(33) The term regulatory element refers to any cis-acting genetic element that controls some aspect of the expression of nucleic acid sequences. In some embodiments, the term promoter comprises essentially the minimal sequences required to initiate transcription. In some embodiments, the term promoter includes the sequences to start transcription, and in addition, also include sequences that can upregulate or downregulate transcription, commonly termed enhancer elements and repressor elements, respectively.
(34) As used herein, the term operatively linked, and similar phrases, when used in reference to nucleic acids or amino acids, refer to the operational linkage of nucleic acid sequences or amino acid sequence, respectively, placed in functional relationships with each other. For example, an operatively linked promoter, enhancer elements, open reading frame, 5 and 3 UTR, and terminator sequences result in the accurate production of a nucleic acid molecule (e.g., RNA). In some embodiments, operatively linked nucleic acid elements result in the transcription of an open reading frame and ultimately the production of a polypeptide (i.e., expression of the open reading frame). As another example, an operatively linked peptide is one in which the functional domains are placed with appropriate distance from each other to impart the intended function of each domain.
(35) By enhance or promote, or increase or expand or improve refers generally to the ability of a composition contemplated herein to produce, elicit, or cause a greater physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. A measurable physiological response may include an increase in T cell expansion, activation, effector function, persistence, and/or an increase in cancer cell death killing ability, among others apparent from the understanding in the art and the description herein. In certain embodiments, an increased or enhanced amount can be a statistically significant amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response produced by vehicle or a control composition.
(36) By decrease or lower, or lessen, or reduce, or abate refers generally to the ability of composition contemplated herein to produce, elicit, or cause a lesser physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. In certain embodiments, a decrease or reduced amount can be a statistically significant amount, and may include a decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response (reference response) produced by vehicle, a control composition, or the response in a particular cell lineage.
(37) The term effective applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Note that when a combination of active ingredients is administered, the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular drug or drugs employed, the mode of administration, and the like.
(38) The phrase pharmaceutically acceptable, as used in connection with compositions described herein, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human). Preferably, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
(39) The term protein is used herein encompasses all kinds of naturally occurring and synthetic proteins, including protein fragments of all lengths, fusion proteins and modified proteins, including without limitation, glycoproteins, as well as all other types of modified proteins (e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP-ribosylation, pegylation, biotinylation, etc.).
(40) The terms nucleic acid, nucleotide, and polynucleotide encompass both DNA and RNA unless specified otherwise. By a nucleic acid sequence or nucleotide sequence is meant the nucleic acid sequence encoding an amino acid; these terms may also refer to the nucleic acid sequence including the portion coding for any amino acids added as an artifact of cloning, including any amino acids coded for by linkers.
(41) The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Alternatively, the carrier can be a solid dosage form carrier, including but not limited to one or more of a binder (for compressed pills), a glidant, an encapsulating agent, a flavorant, and a colorant. Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin.
(42) The term about or approximately includes being within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, still more preferably within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the term about or approximately depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art.
(43) Kallikrein related peptidase 2, hK2 KLK2, or klk2 refers to a known protein which is also called kallikrein-2, glandular kallikrein 2, or HK2. hK2 is produced as a preproprotein and cleaved during proteolysis to generate active protease. All hK2 isoforms and variants are encompassed in hK2. The amino acid sequences of the various isoforms are retrievable from GenBank accession numbers NP_005542.1, NP_001002231.1 and NP_001243009. The amino acid sequence of a full length hK2 is shown in SEQ ID NO:47. The sequence includes the signal peptide (residues 1-18) and the pro-peptide region (residues 19-24).
(44) The term KL2B413 refers to any antibody, antigen-binding portion thereof, or any other protein that contains variable regions derived from KL2B413 VH (SEQ ID 41) and KL2B413 VL (SEQ ID 42), including a CAR. In certain embodiments, an anti-idiotype antibody of the disclosure specifically binds a protein comprising a VH domain as set forth in SEQ ID NO: 41 and/or a VL domain as set forth in SEQ ID NO: 42. In certain embodiments, an anti-idiotype antibody of the disclosure specifically binds a protein comprising the 3 CDRs of the VH domain set forth in SEQ ID NO: 41 and the 3 CDRs of the VL domain set forth in SEQ ID NO: 42.
(45) The term KL2B513 refers to a KL2B413-derived scFv-Fusion protein with the variable regions in the VL-VH orientation. KL2B513 may be referred to interchangeably as KL2B413-LH-scFv.
(46) The term KL2B610 refers to a KL2B413-derived scFv-Fusion protein with the variable regions in the VH-VL orientation. KL2B610 may be referred to interchangeably as KL2B413-HL-scFv.
(47) The term A002B39 refers to a chimeric mAb with human VH/VL targeting KL2B413 and murine IgG2a/k. A002B39 may be referred to interchangeably as A002M39.
(48) The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. As used herein, the indefinite articles a, an and the should be understood to include plural reference unless the context clearly indicates otherwise.
(49) The disclosure further provides variants, e.g., functional variants, of the antibodies, nucleic acids, polypeptides, and proteins described herein. Variant refers to a polypeptide or a polynucleotide that differs from a reference polypeptide or a reference polynucleotide by one or more modifications for example, substitutions, insertions or deletions. The term functional variant as used herein refers to an antibody polypeptide, or protein having substantial or significant sequence identity or similarity to a parent antibody, polypeptide, or protein, which functional variant retains the biological activity of the antibody, polypeptide, or protein for which it is a variant. Functional variants encompass, e.g., those variants of the antibody, polypeptide, or protein described herein (the parent antibody, polypeptide, or protein) that retain the ability to recognize target cells to a similar extent, the same extent, or to a higher extent, as the parent antibody, polypeptide, or protein. In reference to the parent antibody, polypeptide, or protein, the functional variant can, for example, be at least about 30%, about 40%, about 50%, about 60%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more identical in amino acid sequence to the parent antibody, polypeptide, or protein.
(50) Herein, the structure of polypeptides is in places defined on the basis of % sequence identity with a recited reference sequence (with a given SEQ ID NO). In this context, % sequence identity between two amino acid sequences may be determined by comparing these two sequences aligned in an optimum manner and in which the amino acid sequence to be compared can comprise additions or deletions with respect to the reference sequence for an optimum alignment between these two sequences. The percentage of identity is calculated by determining the number of identical positions for which the amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window and by multiplying the result obtained by 100 in order to obtain the percentage of identity between these two sequences. Typically, the comparison window with correspond to the full length of the sequence being compared. For example, it is possible to use the BLAST program, BLAST 2 sequences (Tatusova et al, Blast 2 sequencesa new tool for comparing protein and nucleotide sequences, FEMS Microbiol Lett. 174:247-250) available on the site http://www.ncbi.nlm.nih.gov/gorf/b12.html, the parameters used being those given by default (in particular for the parameters open gap penalty: 5, and extension gap penalty: 2; the matrix chosen being, for example, the matrix BLOSUM 62 proposed by the program), the percentage of identity between the two sequences to be compared being calculated directly by the program. Determining sequence identity of a query sequence to a reference sequence is within the ability of the skilled person and can be performed using commercially available analysis software such as BLAST.
(51) A functional variant can, for example, comprise the amino acid sequence of the parent antibody, polypeptide, or protein with at least one conservative amino acid substitution. In another embodiment, the functional variants can comprise the amino acid sequence of the parent antibody, polypeptide, or protein with at least one non-conservative amino acid substitution. In this case, the non-conservative amino acid substitution may not interfere with or inhibit the biological activity of the functional variant. The non-conservative amino acid substitution may enhance the biological activity of the functional variant such that the biological activity of the functional variant is increased as compared to the parent antibody, polypeptide, or protein.
(52) Amino acid substitutions of the inventive antibodies may be conservative amino acid substitutions. Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties. For example, the conservative amino acid substitution can be an acidic amino acid substituted for another acidic amino acid (e.g., Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g., Ala, Gly, Val, Ile, Leu, Met, Phe, Pro, Trp, Val, etc.), a basic amino acid substituted for another basic amino acid (Lys, Arg, etc.), an amino acid with a polar side chain substituted for another amino acid with a polar side chain (Asn, Cys, Gln, Ser, Thr, Tyr, etc.), etc.
(53) The antibodies, polypeptides, and proteins of embodiments of the invention (including functional portions and functional variants of the invention) can comprise synthetic amino acids in place of one or more naturally-occurring amino acids. Such synthetic amino acids are known in the art, and include, for example, aminocyclohexane carboxylic acid, norleucine, -amino n-decanoic acid, homoserine, S-acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4-aminophenylalanine, 4-nitrophenylalanine, -(2-amino-2-norbornane)-carboxylic acid, ,-diaminobutyric acid, ,-diaminopropionic acid, homophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, -phenyl serine -hydroxyphenylalanine, phenylglycine, -naphthylalanine, cyclohexylalanine, cyclohexylglycine, N-benzyl-N-methyl-lysine, N,N-dibenzyl-lysine, 6-hydroxylysine, ornithine, -aminocyclopentane carboxylic acid, -aminocyclohexane carboxylic acid, -aminocycloheptane carboxylic acid, indoline-2-carboxylic acid, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, aminomalonic acid, aminomalonic acid monoamide, and -tert-butylglycine.
(54) The antibodies, polypeptides, and proteins of embodiments of the invention (including functional portions and functional variants) can be subject to post-translational modifications. They can be glycosylated, esterified, N-acylated, amidated, carboxylated, phosphorylated, esterified, cyclized via, e.g., a disulfide bridge, or converted into an acid addition salt. In some embodiments, they are dimerized or polymerized, or conjugated.
(55) The antibodies, polypeptides, and/or proteins of embodiments of the invention (including functional portions and functional variants thereof) can be obtained by methods known in the art. Suitable methods of de novo synthesizing polypeptides and proteins are described in references, such as Chan et al., Fmoc Solid Phase Peptide Synthesis, Oxford University Press, Oxford, United Kingdom, 2000; Peptide and Protein Drug Analysis, ed. Reid, R., Marcel Dekker, Inc., 2000; and Epitope Mapping, ed. Westwood et al., Oxford University Press, Oxford, United Kingdom, 2001. Also, polypeptides and proteins can be recombinantly produced using the nucleic acids described herein using standard recombinant methods. See, for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. 2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, N Y, 1994. Further, some of the antibodies, polypeptides, and proteins of the invention (including functional portions and functional variants thereof) can be isolated and/or purified from a source, such as a plant, a bacterium, an insect, a mammal, etc. Methods of isolation and purification are known in the art. Alternatively, the antibodies, polypeptides, and/or proteins described herein (including functional portions and functional variants thereof) can be commercially synthesized. In this respect, the antibodies, polypeptides, and proteins can be synthetic, recombinant, isolated, and/or purified.
(56) Methods and Uses of the Disclosure
(57) The disclosure provides anti-idiotype antibodies and antigen-binding portions thereof that specifically bind a KL2B413 containing protein, e.g., an antibody or antigen-binding portions thereof. For example, the anti-idiotype antibodies may include amino acid sequences complementary to portions of a KL2B413 antibody to facilitate specific binding. The disclosure also provides nucleic acids encoding the anti-idiotype antibodies and antigen-binding portions thereof, methods of producing the anti-idiotype antibodies and antigen-binding portions thereof, methods of detecting KL2B413 using the anti-idiotype antibodies and antigen-binding portions thereof and kits including the anti-idiotype antibodies and antigen-binding portions thereof. For example, the anti-idiotype antibodies may be included in kits containing other reagents and used to determine whether a given biological sample includes KL2B413 antibodies or fragments thereof, for example, expressed on the surface of a T cell in a CAR.
(58) Methods of testing antibodies for the ability to bind to any functional portion of KL2B413 are known in the art and include any antibody-antigen binding assay, such as, for example, radioimmunoassay (RIA), Western blot, enzyme-linked immunosorbent assay (ELISA), immunoprecipitation, and competitive inhibition assays.
(59) Suitable methods of making antibodies are known in the art. For instance, standard hybridoma methods are described in, e.g., Khler and Milstein, Eur. J. Immunol., 5, 511-519 (1976), Harlow and Lane (eds.), Antibodies: A Laboratory Manual, CSH Press (1988), and C. A. Janeway et al. (eds.), Immunobiology, 5th Ed., Garland Publishing, New York, N.Y. (2001)). Alternatively, other methods, such as EBV-hybridoma methods (Haskard and Archer, J. Immunol. Methods, 74(2), 361-67 (1984), and Roder et al., Methods Enzymol., 121, 140-67 (1986)), and bacteriophage vector expression systems (see, e.g., Huse et al., Science, 246, 1275-81 (1989)) are known in the art. Further, methods of producing antibodies in non-human animals are described in, e.g., U.S. Pat. Nos. 5,545,806, 5,569,825, and 5,714,352, and U.S. Patent Application Publication No. 2002/0197266 A1).
(60) Phage display can also be used to generate an antibody. In this regard, phage libraries encoding antigen-binding variable (V) domains of antibodies can be generated using standard molecular biology and recombinant DNA techniques (see, e.g., Sambrook et al., supra, and Ausubel et al., supra). Phage encoding a variable region with the desired specificity are selected for specific binding to the desired antigen, and a complete or partial antibody is reconstituted comprising the selected variable domain. Nucleic acid sequences encoding the reconstituted antibody are introduced into a suitable cell line, such as a myeloma cell used for hybridoma production, such that antibodies having the characteristics of monoclonal antibodies are secreted by the cell (see, e.g., Janeway et al., supra, Huse et al., supra, and U.S. Pat. No. 6,265,150).
(61) In one aspect, the disclosure provides an anti-idiotype antibody or antigen-binding portion thereof that specifically binds a target antibody or CAR that comprises KL2B413. For example, the anti-idiotype antibody or antigen-binding portion may specifically bind one or more of the domains of the fragment antigen-binding region (Fab), including the VH and VL. In some embodiments, the anti-idiotype antibody or antigen-binding portion comprises a VH domain with an amino acid sequence of SEQ ID NOs:45 and a VL domain with an amino acid sequence of SEQ ID NOs:46.
(62) In other embodiments, the anti-idiotype antibody or antigen-binding portion is for use in detecting KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion; and (c) detecting the anti-idiotype antibody or antigen-binding portion. For example, an anti-idiotype antibody may be added to any biologic sample, including: a tissue sample, a tumor sample, a cell or a fluid with other biological components, organisms, subunits of proteins/antigens, killed or inactivated whole cells or lysates. The anti-idiotype antibody may be contained in a solution containing pharmaceutically acceptable reagents, including but not limited to buffers, a stabilizer, and/or polymers. The anti-idiotype antibody may be contacted by pipetting and/or mixing with the biologic sample. Then anti-idiotype antibody may then specifically bind a KL2B413 containing protein, e.g., an antibody or antigen-binding portions thereof, in the biologic sample. As one example, whether an anti-idiotype antibody has bound to KL2B413 may be determined by washing unbound anti-idiotype antibody, leaving only complexed anti-idiotype antibody. Continuing with this example, the anti-idiotype antibody may include a fluorophore, which may be illuminated to give a signal proportional to the amount of KL2B413 in the biologic sample. Detection of a bound complex of anti-idiotype antibody to KL2B413 is described further below.
(63) In another aspect, the disclosure provides an anti-idiotype antibody or antigen-binding portion that specifically binds an anti-KLK2 antibody that comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs:4-7, a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs:11-14 and a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs:19-20, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs:25-26, a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs:29-30 and a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs:33-34. The six CDRs may be selected according to any known methods. The VH and VL CDRs determined according to Kabat, AbM, Chothia and contact methods are shown in Table 3.
(64) In certain embodiments, the disclosure provides an anti-idiotype antibody or antigen-binding portion that specifically binds an anti-KLK2 antibody that comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:4, a VH CDR2 having an amino acid sequence of SEQ ID NO:11 and a VH CDR3 having an amino acid sequence of SEQ ID NO:19, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:25, a VL CDR2 having an amino acid sequence of SEQ ID NO:29 and a VL CDR3 having an amino acid sequence of SEQ ID NO:33.
(65) In certain embodiments, the disclosure provides an anti-idiotype antibody or antigen-binding portion that specifically binds an anti-KLK2 antibody that comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:5, a VH CDR2 having an amino acid sequence of SEQ ID NO:12 and a VH CDR3 having an amino acid sequence of SEQ ID NO:19, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:25, a VL CDR2 having an amino acid sequence of SEQ ID NO:29 and a VL CDR3 having an amino acid sequence of SEQ ID NO:33.
(66) In certain embodiments, the disclosure provides an anti-idiotype antibody or antigen-binding portion that specifically binds an anti-KLK2 antibody that comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:6, a VH CDR2 having an amino acid sequence of SEQ ID NO:13 and a VH CDR3 having an amino acid sequence of SEQ ID NO:19, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:25, a VL CDR2 having an amino acid sequence of SEQ ID NO:29 and a VL CDR3 having an amino acid sequence of SEQ ID NO:33.
(67) In certain embodiments, the disclosure provides an anti-idiotype antibody or antigen-binding portion that specifically binds an anti-KLK2 antibody that comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence of SEQ ID NO:7, a VH CDR2 having an amino acid sequence of SEQ ID NO:14 and a VH CDR3 having an amino acid sequence of SEQ ID NO:20, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence of SEQ ID NO:26, a VL CDR2 having an amino acid sequence of SEQ ID NO:30 and a VL CDR3 having an amino acid sequence of SEQ ID NO:34.
(68) In some embodiments, the anti-idiotype antibody or antigen-binding portion thereof that specifically binds an anti-KLK2 antibody comprises a VH domain that has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:45 and the VL domain has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:46. In some embodiments, the anti-idiotype antibody or antigen-binding portion thereof that specifically binds an anti-KLK2 antibody comprises a heavy chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 37 and further comprises a light chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO:39.
(69) In some embodiments, the anti-idiotype antibody or antigen-binding portion thereof that specifically binds an anti-KLK2 antibody comprises a VH domain that has an amino acid sequence of SEQ ID NO:45 and a VL domain that has an amino acid sequence of SEQ ID NO:46. In some other embodiments, the anti-idiotype antibody or antigen-binding portion thereof that specifically binds an anti-KLK2 antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:37 and further comprises a light chain comprising an amino acid sequence of SEQ ID NO:39.
(70) In some embodiments, the antigen-binding portion is selected from a Fab, F(ab).sub.2, or scFv. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a chimeric antibody. In some embodiments, the chimeric antibody comprises a murine IgG2a framework. In certain embodiments, the murine IgG2a framework may include a murine Ig heavy chain signal peptide from mix FVB/N, C57BL/6J comprising the sequence MAWVWTLLFLMAAAQSIQA (SEQ ID NO: 48).
(71) In some other embodiments, the antibody is a fully human antibody. For example, the fully human antibody may be an IgG, IgM, IgA, IgE, or IgD. In some embodiments, the anti-idiotype antibody or antigen-binding portion thereof is specific to KL2B413, wherein KL2B413 is within the antigen-binding domain of the extracellular portion of a chimeric antigen receptor (CAR). For example, a KL2B413 encoding nucleic acid may be introduced in vitro into a T-cell, of which at least some portion then is expressed on the extracellular portion of a CAR. The anti-idiotype antibody may then specifically bind the extracellular portion of the CAR. In some embodiments, KL2B413 is an scFv and the anti-idiotype antibody or antigen-binding portion specifically binds an epitope in the scFv of the CAR. In some embodiments, KL2B413 specifically binds KLK2. In some embodiments, the antibody or antigen-binding portion does not cross-react to other KLK2 antibodies or other KLK2 binding CARs. For example, to prevent false positives in an assay for determining whether KL2B413 has been expressed on the extracellular portion of a CAR, the anti-idiotype antibody may be specific to KL2B413, and not have appreciable binding to its target KLK2 or other KLK2 targeting ligands that are not KL2B413. In some embodiments, the CAR has an amino acid sequence selected from the group consisting of SEQ ID NOs.:43-44.
(72) In some embodiments, the disclosure provides a nucleic acid encoding the heavy chain, the light chain, or both, of the anti-idiotype antibody or antigen-binding portion. For example, the nucleic acid may be DNA, RNA, and any chemical modifications thereto (e.g., nucleoside modifications).
(73) In another aspect, the disclosure provides a nucleic acid encoding the heavy chain, the light chain, or both, of an anti-idiotype antibody or an antigen-binding portion thereof that specifically binds KL2B413, wherein said nucleic acid comprises: the nucleotide sequence of SEQ ID NO: 38; the nucleotide sequence of SEQ ID NO: 40; or both. In another aspect, the disclosure provides a vector comprising the nucleic acid sequence. For example, the vector may be a self-replicating nucleic acid structure, or incorporated into the genome of a host cell into which it has been introduced. In some embodiments, the vector is an expression vector. In another aspect, the disclosure provides a host cell comprising the vector. In some embodiments, the host cell is a mammalian cell.
(74) In another aspect, the disclosure provides a method of producing an anti-idiotype antibody or antigen-binding portion thereof that specifically binds KL2B413, said method comprising culturing a host cell under conditions that allow said antibody or antigen-binding portion to be expressed, wherein the host cell comprises nucleotide sequences coding the heavy chain and light chain of the antibody or antigen-binding portion, and isolating said antibody or antigen-binding portion from the culture. For example, the anti-idiotype antibody may be produced by homogenous suspension culture in deep-tank stirred fermenters, perfusion-tank systems, airlift reactors, and continuous-culture systems. Anti-idiotype antibodies may be isolated from reaction and/or growth mixtures by physical or chemical separation procedures, including affinity separation using Protein A or G, size exclusion chromatography, and charge separations. In some embodiments, the host cell encodes a vector comprising a nucleic acid encoding the anti-idiotype antibody or antigen-binding portion thereof.
(75) In another aspect, the disclosure provides a method for detecting KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion; and (c) detecting the anti-idiotype antibody or antigen-binding portion. For example, the anti-idiotype antibody may bind KL2B413 expressed in the biological sample. The bound complex may be detected by any detection method, including both chemical and physical detection methods. For example, the detecting method may be used to identify the mere presence of the antibody of interest in a biological sample, or may be used to test whether the antibody of interest in a sample is present at a detectable level, or may be used to quantify the amount of the antibody of interest in a sample and further to compare the antibody levels from different samples. For example, the detecting method may be one or more of: immunoprecipitation, immunocytochemistry, immunoblotting, and immunosorbent assays. As a specific example, the immunsorbent assay may be an ELISA or ELISA-type assay that includes a bound anti-idiotype antibody or fragment thereof over which the biologic sample is washed.
(76) In another aspect, the disclosure provides a method for detecting expression of a chimeric antigen receptor (CAR) comprising KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion; and (c) detecting the anti-idiotype antibody or antigen-binding portion, and thereby detecting the expression of the CAR.
(77) In some embodiments, the antibody comprises a detectable label. In some embodiments, the method further comprises further comprises contacting the anti-idiotype antibody or antigen-binding portion with a detectable label before detecting the anti-idiotype antibody or antigen-binding portion. For example, the detectable label may be any chemical tag or component that is either integral to, binds to, or otherwise complexes to the anti-idiotype antibody and emits or otherwise provides a unique identifiable signal. For example, the detectable label may be an isotope marker, colorimetric biosensor, photochromic compound, fluorescent label, fluorogenic label, or electrochemical sensor. As a specific example, the fluorescent label may be green fluorescent protein, yellow fluorescent protein, blue fluorescent protein, fluorescein, rhodamine, coumarin, cyanine, phycoerythrin, and derivatives thereof.
(78) In some embodiments, the biological sample is blood, serum or urine. For example, the biological sample may be whole blood, serum, plasma, urine, feces, cerebrospinal fluid, ascites, and the like. In some embodiments, the biological sample is fresh biological material, such as biological material taken at a given time for the purpose of this analysis. The biological sample may also be biological material taken at another point during patient care for this or for other purposes, or using archived patient material. The biological sample may be freshly obtained or previously obtained, and where previously obtained may have been stored prior to use (e.g., at room temperature, refrigerated, or frozen).
(79) In some aspects, the disclosure provides a kit for detecting KL2B413 in a biologic sample comprising: (a) an anti-idiotype antibody or antigen-binding portion; and (b) instructions for detecting the anti-idiotype antibody or antigen-binding portion. For example, the kit may include the anti-idiotype antibody or antigen-binding portion as a solid powder, lyophilized powder, liquid solution or liquid components to mix to form a solution, or bound to a solid support. The kit may include additional reagents, including stabilizers, buffers, and other pharmaceutically acceptable excipients needed to facilitate using the kit in an assay of a biological sample. The kit may also include written instructions directing a user on how to perform the assay.
(80) In other aspects, the disclosure provides a method of purifying KL2B413 from a sample comprising: (a) providing a biological sample comprising KL2B413; (b) contacting the biological sample with an anti-idiotype antibody or antigen-binding portion of the disclosure; and (c) capturing the anti-idiotype antibody or antigen-binding portion, including a CAR or other protein that contains KL2B413, and thereby purifying KL2B413. For example, any separation method, including physical and chemical methods, may be used to capture the anti-idiotype antibody. Specifically, the KL2B413 can be captured and isolated from cell culture medium, host cells, or both using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffinity purification with antibodies specific for particular epitopes of the anti-idiotype antibody. In some embodiments, the anti-idiotype antibody is a fusion protein containing a domain which facilitates its purification. In certain embodiments, a purified KL2B413 composition is substantially isolated from proteins that do not contain KL2B413. In some embodiments, a purified KL2B413 composition is 100% pure, 99% pure, 98% pure, 97% pure, 96% pure, 95% pure, or 90% pure or greater.
(81) In other aspects, the disclosure provides a method of selecting CAR-T cells from a cell population comprising: (a) providing a biological sample comprising CAR-T cells; (b) contacting the biological sample with an anti-idiotype antibody or antigen-binding portion; and (c) capturing the anti-idiotype antibody or antigen-binding portion, and thereby selecting CAR-T cells. In some embodiments, the anti-idiotype antibody or antigen-binding portion thereof is specific to KL2B413.
EMBODIMENTS
(82) Particular non-limiting embodiments of the invention are set forth in the following numbered paragraphs.
(83) 1. An anti-idiotype antibody or antigen-binding portion thereof that specifically binds a target antibody that comprises KL2B413.
(84) 2. The anti-idiotype antibody or antigen-binding portion of paragraph 1, wherein the target antibody or antigen-binding portion thereof comprises a VH domain with an amino acid sequence of SEQ ID NO:41 and a VL domain with an amino acid sequence of SEQ ID NO: 42.
(85) 3. An anti-idiotype antibody or an antigen-binding portion thereof that specifically binds KL2B413, wherein the anti-idiotype antibody or antigen-binding portion comprises a heavy chain variable (VH) domain comprising a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs:4-7, a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs:11-14 and a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs:19-20, and further comprises a light chain variable (VL) domain comprising a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs:25-26, a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs:29-30 and a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NO:33-34.
(86) 4. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the VH domain has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:45 and the VL domain has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:46.
(87) 5. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the anti-idiotype antibody or antigen-binding portion comprises a heavy chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO:37 and further comprises a light chain comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO:39.
(88) 6. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the VH domain has an amino acid sequence of SEQ ID NO:45 and the VL domain has an amino acid sequence of SEQ ID NO:46.
(89) 7. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the anti-idiotype antibody or antigen-binding portion comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:37 and further comprises a light chain comprising an amino acid sequence of SEQ ID NO:39.
(90) 8. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the antigen-binding portion is selected from a Fab, F(ab).sub.2, or scFv.
(91) 9. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the antibody is a monoclonal antibody.
(92) 10. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the antibody is a chimeric antibody.
(93) 11. The anti-idiotype antibody or antigen-binding portion of paragraph 10, wherein the antibody comprises a murine IgG2a framework.
(94) 12. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein the antibody is a fully human antibody.
(95) 13. A nucleic acid encoding the heavy chain, the light chain, or both, of the anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3.
(96) 14. A nucleic acid encoding the heavy chain, the light chain, or both, of an anti-idiotype antibody or an antigen-binding portion thereof that specifically binds KL2B413, wherein said nucleic acid comprises: a) the nucleotide sequence of SEQ ID NO: 38; b) the nucleotide sequence of SEQ ID NO: 40; c) both a) and b).
(97) 15. A vector comprising the nucleic acid of paragraph 14.
(98) 16. The vector of paragraph 15, wherein the vector is an expression vector.
(99) 17. A host cell comprising the vector of paragraph 16.
(100) 18. The host cell of paragraph 17, wherein the cell is a mammalian cell.
(101) 19. A method of producing an anti-idiotype antibody or antigen-binding portion thereof that specifically binds KL2B413, said method comprising culturing the host cell of paragraph 17 under conditions that allow said antibody or antigen-binding portion to be expressed, wherein the host cell comprises nucleotide sequences coding the heavy chain and light chain of the antibody or antigen-binding portion, and isolating said antibody or antigen-binding portion from the culture.
(102) 20. A method for detecting KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3; and (c) detecting the anti-idiotype antibody or antigen-binding portion.
(103) 21. A method for detecting expression of a chimeric antigen receptor (CAR) comprising KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3; and (c) detecting the anti-idiotype antibody or antigen-binding portion, and thereby detecting the expression of the CAR.
(104) 22. The method according to paragraph 20, wherein the antibody comprises a detectable label.
(105) 23. The method according to paragraph 20, wherein the method further comprises contacting the anti-idiotype antibody or antigen-binding portion with a detectable label before detecting the anti-idiotype antibody or antigen-binding portion.
(106) 24. The method according to paragraph 20, wherein the biological sample is blood, serum or urine.
(107) 25. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, wherein KL2B413 is within the antigen-binding domain of the extracellular portion of a chimeric antigen receptor (CAR).
(108) 26. The anti-idiotype antibody or antigen-binding portion of paragraph 25 wherein KL2B413 is an scFv and the anti-idiotype antibody or antigen-binding portion specifically binds an epitope in the scFv of the CAR.
(109) 27. The anti-idiotype antibody or antigen-binding portion of paragraph 25, wherein KL2B413 binds KLK2.
(110) 28. The anti-idiotype antibody or antigen-binding portion of paragraph 25, wherein the antibody or antigen-binding portion does not cross-react to other KLK2 antibodies or other KLK2 binding CARs.
(111) 29. The anti-idiotype antibody or antigen-binding portion of paragraph 25, wherein the CAR has an amino acid sequence selected from the group consisting of SEQ ID NOs: 43-44.
(112) 30. A kit for detecting KL2B413 in a biologic sample comprising: (a) the anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3; and (b) instructions for detecting the anti-idiotype antibody or antigen-binding portion.
(113) 31. The anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3, for use in detecting KL2B413 in a biologic sample comprising: (a) providing a biological sample; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion; and (c) detecting the anti-idiotype antibody or antigen-binding portion.
(114) 32. A method of purifying KL2B413 from a sample comprising: (a) providing a biological sample comprising KL2B413; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3; and (c) capturing the anti-idiotype antibody or antigen-binding portion, and thereby purifying KL2B413.
(115) 33. A method of selecting CAR-T cells from a cell population comprising: (a) providing a biological sample comprising CAR-T cells; (b) contacting the biological sample with the anti-idiotype antibody or antigen-binding portion of any one of paragraphs 1-3; and (c) capturing the anti-idiotype antibody or antigen-binding portion, and thereby selecting CAR-T cells.
EXAMPLES
Example 1: Determination of KL2B513 or KL2B610 Binding Fabs
(116) KL2B413-derived scFv-Fusion protein binding Fabs were selected from two sets of de novo Fab-pIX phage display libraries as described in Shi et al., J Mol Biol 397:385-96, 2010; Int. Pat. Publ. No. WO2009/085462; U.S. Pat. Publ. No. US2010/0021477). There are two KL2B413-derived scFv-Fusion proteins: KL2B513 (VL-VH) and KL2B610 (VH-VL), with difference in the orientation of VH and VL within scFv.
(117) In the phage selections using purified recombinant antigens, biotinylated KL2B513 or KL2B610 were used as bait to capture and immobilize the phage binders. After several selection rounds, a polyclonal phage ELISA using purified antigens was performed to detect the specific enrichment of individual panning experiments. The phage collected from those panning experiments which demonstrated enrichment for binders to KL2B513 or KL2B610 were expressed in E. coli for primary screening. Monoclonal Fab lysates were prepared from the enriched Fab libraries were screened in ELISA for binding to KL2B513 or KL2B610 but not to a similar negative control scFv fusion protein GC5B734 or GCDB332. The selected Fabs were sequenced to identify the unique Fab clones and isolate their V region genes. The unique Fab V regions were cloned into mammalian expression vectors to express chimeric mAbs with murine IgG2a/murine Kappa constant regions. The chimeric mAbs were evaluated for specific binding to the KL2B413-derived scFv expressed on SupT1 cells which corresponds to the scFv in the KL2B513 or KL2B610 scFv fusion protein, and binding kinetics were measured using SPR.
(118) Phage Panning
(119) Six individual panning experiments using individual V3.0 and V5.0 de novo Fab phage libraries were panned against biotinylated KL2B513 or KL2B610 according to standard protocol (Cheadle, E. J. et al. Antibody Engineering. 907, 645-666 (2012). Briefly, the phage libraries and paramagnetic streptavidin (SA) beads were blocked in 50% Chemiblocker (Millipore cat #2170)/50% 1TBST (Teknova cat #T0310) for one hour. Libraries were added to the SA beads to adsorb clones that bind non-specifically to the beads. SA-beads were discarded, and the pre-adsorbed library was added to biotinylated KL2B513 or KL2B610 with the presence of 100 nM of GP5B305. Binders were retrieved by addition of SA-beads to form a bead/antigen/phage complex, which was washed in 1TBST. After the final wash, phage was rescued by infection of log phase TG1 E. coli cells (OD600 nm=0.4-0.6). The phage-infected TG1 cells was spread on three 150-mm LB/Agar plates containing 75 g/ml carbenicillin and 1% glucose then grown overnight at 37 C. Phage was produced and subjected for additional panning. To increase selection pressure, the antigen concentration was reduced at room temperature for each subsequent rounds: R1 100 nM, 1 hour; R2 50 nM 1 hour; R3 10 nM 1 hour, R4 5 nM 1 hour.
(120) Polyclonal Phage ELISA
(121) Enrichment of binders was determined from each panning experiment by polyclonal phage ELISA. Briefly, 100 l of 20 nM nonbiotinylated KL2B513 or KL2B610 diluted in 1TBS (Teknova cat #T9530) was captured on NA-coated plate (Thermo cat #15217). After an hour incubation at 37 C., the plate was washed 3 times in 3001_11 1TBST. 300 l of blocking buffer 50% Chemiblocker/50% 1TBST was added to each well of the plate and incubated at room temperature for 1 hour. After blocking, the plate was washed 3 times with 3001_11 of 1TBST. 1004, of polyclonal phage output from each panning rounds diluted 1/100 diluted in assay buffer, 10% Chemiblocker/90% TBST, were added to the ELISA plate and incubated at room temperature for 1 hour to allow the binding of Fab displayed on the phage particles to the immobilized KL2B513 or KL2B610. Following the incubation, the plate was washed 3 times with 1TBST. 100 l of HRP-conjugated anti-M13 (pVIII) antibody (GE Healthcare cat #27942101) diluted 1:2500 in assay buffer was added to the plate and incubated at room temperature. After 1 hour incubation, the plate was washed 6 times with 3001_11 of 1TBST. 100 L of prepared BM chemiluminescence ELISA Substrate (Roche cat #11582950001) was added to the plate. The chemiluminescence or relative light unit (RLU) was measured by Envision plate reader.
(122)
(123) Fab Production
(124) Plasmid DNA were isolated and purified from glycerol stocks of specific rounds of phage panning experiments that were identified to demonstrate enrichment of binders to KL2B513 or KL2B610, and transformed into TG-1 E. coli cells and grown on LB/Agar plates overnight. The overnight cultures were used for (i) colony PCR and sequencing of the V regions, and (ii) starting culture for Fab production. For Fab production, the overnight culture was diluted 10-100 fold in new media and grown for 5-6 hours at 37 C. Fab production was induced by the addition of fresh media containing IPTG and the cultures were grown overnight at 30 C. The cultures were spun down and the bacterial pellet was lysed using BugBuster (Millipore) to release the soluble Fab proteins. The cell lysate was spun down and the supernatant were used for Fab ELISA.
(125) Primary Screening
(126) The phage collected from the panning experiments which demonstrated enrichment for binders to KL2B513 or KL2B610 were expressed in E. coli for primary screening. MSD 384-well streptavidin plates (Meso Scale #L21SA-5) were blocked with 50 ul/well SuperBlock T20 (TBS) Blocking Buffer (Thermo #37536) for 30 min at room temperature and then aspirated. 2.5 nM biotinylated ScFv-Fc fusion antigens, target antigen KL2B513 or KL2B610, or counter screening reagent GCDB734, were added to the blocked 384-well MSD plates and incubated on a shaker for 30 min at room temperature. The plates were washed twice with 80 ul/well with 1 phosphate-buffered saline with Tween detergent (1PBST) and crude Fab lysates from E. coli expressions in 96-well plates were stamped into the 384-well assay plates in duplicate and incubated on a shaker for 1 h at room temperature. The assay plates were washed once with 80 ul/well of 1PBST then 6 nM of SULFO-TAG Anti-human/NHP Kappa Antibody (Meso Scale #D20TF-6) were added at 20 ul/well and the plates incubated on a shaker for 1 h at RT. The plates were washed once with 80 ul/well 1PBST then 35 ul/well of 1MSD Read Buffer T (Meso Scale #R92TC-1) was added to each well and the plates analyzed on an MSD Sector 5600 plate reader. All liquid handling was performed on an Agilent Bravo system and washing of 384-well plates were handled on a BioTek 405 Select plate washer.
(127)
Example 2: Generation of Monoclonal Antibodies Against KL2B413-LH/HL-scFv (A002B39)
(128) Fab Selection
(129) The selected Fabs from the primary screening were sequenced to determine V region sequences and identify unique clones. The unique Fab V regions were cloned into mammalian expression vectors to express as chimeric mAbs with murine IgG2a/murine Kappa constant regions.
(130) The variable regions of A002B39 were identified through phage display using human Fab-pIX de novo libraries to soluble scFv-Fc fusion protein KL2B513 or KL2B610. These V regions did not undergo any affinity maturation. The DNA sequences were obtained from the de novo Fab library without any codon optimization.
(131) Cloning of V.sub.H and V.sub.L
(132) Two pcDNA3.1 derived mammalian expression vectors (vDR000368 and vDR000961) were used to generate the single gene constructs encoding the heavy chain (HC) or light chain (LC) of the chimeric mAb. Each vector contains a human cytomegalovirus (hCMV) promoter to drive the expression of the HC and LC and both contain the ampicillin resistance gene (Amp(R)) to facilitate cloning. vDR000368 has unique HindIII and DraIII restriction enzyme sites for cloning and also a mouse IgG2a constant region; vDR000961 has unique HindIII and Tth111I restriction enzyme sites for cloning and also a mouse Kappa constant region.
(133) A DNA fragment comprising the variable region of HC (V.sub.H) or LC (V.sub.L) was synthesized and ligated into HC vector vDR000368 and LC vector vDR000961. The HC synthetic fragment included a HindIII restriction enzyme site, Kozak sequence, DNA sequences encoding a signal peptide, the VH and part of the C.sub.H1, and a DraIII cloning site. The LC synthetic fragment included a HindIII restriction enzyme site, Kozak sequence, DNA sequences encoding a signal peptide, the VL, and part of the Kappa constant region, and a Tth111I restriction cloning site. The final HC construct is PBD000105920 and the LC construct is PBD000105921. The two constructs were co-transfected in mammalian expression cell lines HEK293 Expi or CHO to make A002B39.
(134) Protein Expression
(135) The HC construct PBD000105920 and the LC construct PBD000105921 were sequence verified before transfection. HEK Expi293 cells (Thermo cat #A14527) grown in Expi293 Expression media (Thermo cat #A1435101). The cells are grown at 37 C. shaking at 125 RPM with 8% CO.sub.2. The cells were transfected at 2.510.sup.6 cells per ml using Expi293 Expression Kit (Thermo cat #A14524). For each liter of cells transfected 1 mg of total DNA was diluted in 25 ml of Opti-MEM (Thermo cat #319850620) and 2.6 ml of Expi293 reagent was diluted in 25 ml of Opti-MEM and incubated for 5 minutes at room temperature. The diluted DNA and diluted Expi293 reagent were combined and incubated for 20 minutes at room temperature. The DNA complex was then added to the cell. The cells were placed in the shaking incubator overnight. The next day after transfection, 5 ml of Enhancer 1 was diluted into 50 ml of Enhancer 2 and the total volume of the two Enhancers were added to the cells. The transfected cells were placed back into the incubator for 4 days until harvested. The cells were removed by centrifugation at 4,500 g for 35 minutes then filtered with a 0.2 m filter prior to checking expression levels.
(136) Expression was quantitated using an Octet instrument. Murine IgG2 (Sigma Cat #M9144) was used as the standard. Protein A biosensors were used. The samples and the standard were diluted with spent Expi293 media. The standard curve started at 100 ug/ml in a twofold dilution. The samples were diluted 1:10. The standard curve was a linear point curve. The calculations were performed by Forte Biosystems software.
Example 3: Binding Assays for Anti-Idotypic Antibody A002B39
(137) Binding Assay Using Soluble Proteins with Biacore
(138) Anti-Mouse Fc antibody directly immobilized on M5 sensor chip. Library Antibodies (Mouse IgG2a) diluted to 1 ug/ml to reach approximately 20-50 RU. Antigens (scFV Fc Fusions) are associated at 500 nM to 0.8 nM, 1:5 dilutions for 3 minutes. Dissociation for 30 mins. The result of the assay (Table 2 below) shows similar binding affinity to KLB513 as what was seen using the ProteOn
(139) Binding Assay Using Soluble Proteins with Proteon and Biacore
(140) ProteOn XPR36 system (BioRad) was used to perform binding assays. ProteOn GLC chips (BioRad, Cat #176-5011) were coated with Anti-Mouse Fc antibody. Library Antibodies (Mouse IgG2a) were diluted to 0.25 ug/ml to 1 ug/ml to reach approximately 100-200RL. Antigens (scFv-Fc Fusions) were associated at 1000 nM to 0.4 nM, 1:4 dilutions for 3 minutes, followed by dissociation for 30 mins. The results of the assay (Table 1 below) show similar binding affinity of A002B39 with both KLB513 and KLB610.
(141) TABLE-US-00001 TABLE 1 Proteon binding results for A002B39 to KLB513 and KLB610. Proteon Binding to KL2B513.002 Proteon Binding to KL2B610.002 Protein AA ka kd KD ka kd KD Name 1/Ms 1/s M 1/Ms 1/s M A002B39 3.39E+05 3.33E04 9.90E10 2.85E+05 3.15E04 1.11E09
(142) Anti-Mouse Fc antibody directly immobilized on M5 sensor chip. Library Antibodies (Mouse IgG2a) diluted to 1 ug/ml to reach approximately 40-80 RU. Antigens (scFV Fc Fusions) are associated at 500 nM to 0.8 nM, 1:5 dilutions for 3 minutes. Dissociation for 30 mins. The results of the assay (Table 2 below) show the binding affinity of A002B39 with KLB513.
(143) TABLE-US-00002 TABLE 2 Biacore binding results for A002B39 to KLB513. Biacore Binding to KL2B513.002 Protein AA ka kd KD Name 1/Ms 1/s M A002B39 5.79E+04 2.02E04 3.49E09
(144) Cell Binding Assay
(145) ScFv transfected SupT1-KL2B413 HL, SupT1-KL2B413 LH or SupT1-CD9B337-HL cells were cultured in RMPI 1640, 10% FBS, 1% Non-Essential Amino Acids, 1 mM Sodium Pyruvate, 2 mM L-glutamine, 10 mM HEPES, 0.1% bicarbonate. Cell culture supplements were ThermoFisher Scientific Gibco products. The mAbs were diluted to 6 micrograms/mL in Stain Buffer (BSA) (BD Pharmingen cat #554657). ScFv expressing SupT1 cells were labeled with fixable Live/Dead stain (Molecular Probes #L34974) and added to a 384-well V-bottom microplate (Greiner Bio-One #781281) at 50,000 cells/well.
(146) The normalized mAb samples were added in 20 ul/well volume to the cell suspensions with gentle mixing and the cells incubated on ice for 30 min. The cell suspension was diluted with 70 ul/well ice cold Stain Buffer (BSA), cells pelleted at 400g for 5 min at 4 C. and the supernatant aspirated. The cell pellets were washed once more with 70 ul/well ice cold Stain Buffer (BSA). 3 ug/ml of AF488 anti-mouse IgG (H+L) specific goat F(ab).sub.2 (Jackson ImmunoResearch #115-546-062) was added to the cell pellets at 40 ul/well with gentle mixing and the cells incubated on ice, in the dark, for 30 min. The cells were washed as already described and fixed with 40 ul/well BD Cytofix (BD Pharmingen #554655) for 20 min on ice. The fixed cells were washed as described above and the cell pellets resuspended in 20 ul Stain Buffer and analyzed on an iQue PLUS VBR flow cytometer. Cells were gated on live and singlet populations and analyzed for antibody binding in the BL1-H (AF488) channel. All liquid handling was performed on an Agilent Bravo system and aspiration of 384-well plates were handled on a BioTek 405 Select plate washer.
(147) As shown in
Example 4: Characterization of Detection Antibodies for KLK2 CAR KL2B413-LH (Protein ID #A002B39) on CAR+ SupT1 Cells
(148) Antibodies to detect KLK2 CAR (KL2B413-LH) expressed on NK and T cells were identified from panels of proteins derived from Phage Display screening. As discussed in the preceding examples, the proteins were tested initially for binding to recombinant CAR protein and potential binders were scaled up. The proteins were purified and tested for dose dependent binding to SupT1 cells expressing KL2B413-LH respectively by flow cytometry. The binding was determined to be specific to CAR through competition binding experiments with Fc-KL2B413-LH fusion proteins and through lack of binding to parental SupT1 cells. After selection of the best binder, the antibodies were directly conjugated to recombinant phycoerythrin (PE) for use as CAR detection reagents. The antibodies were purified to a 1:1 PE:antibody ratio to enable receptor enumeration studies (number of CAR expressed on the cell surface).
(149) Purification
(150) Cell culture supernatant was loaded to a MabSelect column and eluted with low pH buffer such as 100 mM sodium acetate pH 3.0, subsequently buffer exchanged to 1SSC, 8.5% sucrose pH 7.0 using a Sephadex G-25 column. Fractions containing protein were collected. Following purification, proteins underwent QC using SDS-PAGE, SEC-HPLC and LC-MS methods.
(151) Phycoerythrin Labeling
(152) 1 L of Modifier reagent was added to each 10 L of antibody to be labeled and mixed gently. The antibody sample (with added Modifier reagent) was pipetted directly onto the lyophilized PE (Expedeon, Cat #703-0015), then resuspended gently and incubated for 1 hour in the dark at room temperature (20-25 C.). 1 L of Quencher reagent was added for every 10 L of antibody used and incubated for 30 minutes.
(153) After labeling, PE-antibody conjugates were purified on a size-exclusion chromatogram column. Fractions were collected and analyzed on SEC-HPLC. Fractions that only contained one antibody with one PE were pooled together and concentrated if necessary. Final products were analyzed on SEC-HPLC.
(154) Characterization of KLK2 CAR (KL2B413-LH) Anti-Idotypic Antibody A002B39
(155) SupT1 cells expressing KL2B413LH were compared to parental CAR SupT1 cells. Cells (100,000 cells/well) were stained with LIVE/DEAD Fixable Near-IR viability dye (Life Technologies L10119) and then incubated with increasing concentrations of A002B39 for 30 minutes on ice. Following incubation, the samples were washed with BSA stain buffer (BD Biosciences #554657) and stained with PE-goat anti-mouse IgG polyclonal antibody (Biolegend #405307) to detect bound antibody on live CAR+ SupT1 cells. After incubation, washing, and fixation (Cytofix, BD Biosciences), the samples were acquired on a 10 color FACSCanto II (BD Biosciences) flow cytometer. Analysis was done using FlowJo and the PE median fluorescent intensity of live SupT1 cells is plotted in
(156) A002B39 was conjugated to R-PE as described above and tested for binding to KL2B413-LH SupT1 in the presence or absence of 10 pg/mL KL2B413-LH scFv Fc fusion protein to assess the specificity of A002B39 binding to KL2B413 CAR. KL2B413-LH SupT1 cells (100,000 cells/well) were stained with LIVE/DEAD Fixable Near-IR viability dye (Life Technologies L10119) and then incubated with increasing concentrations of PE-A002B39 and 10 pg/mL KL2B413-LH scFv Fc for 30 minutes on ice. After incubation, washing, and fixation, the samples were acquired on a 10 color FACSCanto II flow cytometer. Analysis was performed using FlowJo analysis software and the PE median fluorescent intensity of live SupT1 cells is plotted in
(157) KL2B413LH SupT1 cells were spiked into whole blood in order to mirror detection of CAR cells in clinical samples. As shown below in
(158) Multiple lots of PE-A002B39 were compared to assess differences in binding to KL2B413LH-SupT1 cells across batches. KL2B413-LH SupT1 cells (200,000 cells/well) were stained with LIVE/DEAD Fixable Near-IR viability dye and incubated with increasing concentrations of PE-A002B39 for 30 minutes on ice. After incubation, washing, and fixation, the samples were acquired on a 10 color FACSCanto II flow cytometer. Analysis was done using FlowJo analysis software and the PE median fluorescent intensity of live SupT1 cells is plotted in
(159) Sequences
(160) TABLE-US-00003 TABLE3 CDRandFrameworkSequences SEQ ID NO. Region Definition SequenceFragment Residues Length VHCDRandframework 1 HFR1 Chothia EVQLVQSGAEVKKPGSSVKVSCKAS----- 1-25 25 1 AbM EVQLVQSGAEVKKPGSSVKVSCKAS----- 1-25 25 2 Kabat EVQLVQSGAEVKKPGSSVKVSCKASGGTFS 1-30 30 3 Contact EVQLVQSGAEVKKPGSSVKVSCKASGGTF- 1-29 29 4 CDR-H1 Chothia GGTFSSY--- 26-32 7 5 AbM GGTFSSYAIS 26-35 10 6 Kabat -----SYAIS 31-35 5 7 Contact ----SSYAIS 30-35 6 8 HFR2 Chothia AISWVRQAPGQGLEWMGGI 33-51 19 9 AbM ---WVRQAPGQGLEWMG-- 36-49 14 9 Kabat ---WVRQAPGQGLEWMG-- 36-49 14 10 Contact ---WVRQAPGQGLE----- 36-46 11 11 CDR-H2 Chothia -----IPIFGT--------- 52-57 6 12 AbM ---GIIPIFGTAN------- 50-59 10 13 Kabat ---GIIPIFGTANYAQKFQG 50-66 17 14 Contact WMGGIIPIFGTAN------- 47-59 13 15 HFR3 Chothia ANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR 58-98 41 16 AbM --YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR 60-98 39 17 Kabat ---------RVTITADESTSTAYMELSSLRSEDTAVYYCAR 67-98 32 18 Contact --YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYC-- 60-96 37 19 CDR-H3 Chothia --VQWGLDY 99-105 7 19 AbM --VQWGLDY 99-105 7 19 Kabat --VQWGLDY 99-105 7 20 Contact ARVQWGLD- 97-104 8 21 HFR4 Chothia -WGQGTLVTVSS 106-116 11 21 AbM -WGQGTLVTVSS 106-116 11 21 Kabat -WGQGTLVTVSS 106-116 11 22 Contact YWGQGTLVTVSS 105-116 12 VLCDRandframework 23 LFR1 Chothia EIVLTQSPATLSLSPGERATLSC------ 1-23 23 23 AbM EIVLTQSPATLSLSPGERATLSC------ 1-23 23 23 Kabat EIVLTQSPATLSLSPGERATLSC------ 1-23 23 24 Contact EIVLTQSPATLSLSPGERATLSCRASQSV 1-29 29 25 CDR-L1 Chothia RASQSVDSALA-- 24-34 11 25 AbM RASQSVDSALA-- 24-34 11 25 Kabat RASQSVDSALA-- 24-34 11 26 Contact ------DSALAWY 30-36 7 27 LFR2 Chothia WYQQKPGQAPRLLIY 35-49 15 27 AbM WYQQKPGQAPRLLIY 35-49 15 27 Kabat WYQQKPGQAPRLLIY 35-49 15 28 Contact --QQKPGQAPR---- 37-45 9 29 CDR-L2 Chothia ----GASNRAT 50-56 7 29 AbM ----GASNRAT 50-56 7 29 Kabat ----GASNRAT 50-56 7 30 Contact LLIYGASNRA- 46-55 10 31 LFR3 Chothia -GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC 57-88 32 31 AbM -GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC 57-88 32 31 Kabat -GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC 57-88 32 32 Contact TGIPARFSGSGSGTDFTLTISSLEPEDFAVYYC 56-88 33 33 CDR-L3 Chothia QQRFNWPIT 89-97 9 33 AbM QQRFNWPIT 89-97 9 33 Kabat QQRFNWPIT 89-97 9 34 Contact QQRFNWPI- 89-96 8 35 LFR4 Chothia -FGQGTKVEIK 98-107 10 35 AbM -FGQGTKVEIK 98-107 10 35 Kabat -FGQGTKVEIK 98-107 10 36 Contact TFGQGTKVEIK 97-107 11
(161) TABLE-US-00004 SEQIDNo.37:HeavyChainofA002B39withmuIgG2a (aminoacid) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG IIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARVQ WGLDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFP EPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNV AHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVL MISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLR VVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVL PPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSD GSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK SEQIDNo.38:HeavyChainofA002B39withmuIgG2a (DNA) GAAGTGCAGCTGGTGCAGAGCGGCGCGGAAGTGAAAAAACCGGGCAGCAG CGTGAAAGTGAGCTGCAAAGCGAGCGGCGGCACCTTTAGCAGCTATGCGAT TAGCTGGGTGCGCCAGGCGCCGGGCCAGGGCCTGGAATGGATGGGCGGCAT TATTCCGATTTTTGGCACCGCGAACTATGCGCAGAAATTTCAGGGCCGCGT GACCATTACCGCGGATGAAAGCACCAGCACCGCGTATATGGAACTGAGCAG CCTGCGCAGCGAAGATACCGCGGTGTATTATTGCGCGCGCGTGCAGTGGGG CTTGGACTATTGGGGCCAGGGCACCCTGGTGACCGTGAGCAGCGCCAAAAC AACAGCACCAAGTGTCTATCCACTGGCCCCTGTGTGTGGAGATACAACTGG CTCCTCGGTGACTCTAGGATGCCTGGTCAAGGGTTATTTCCCTGAGCCAGT GACCTTGACCTGGAACTCTGGATCCCTGTCCAGTGGTGTGCACACCTTCCC AGCTGTCCTGCAGTCTGACCTCTACACCCTCAGCAGCTCAGTGACTGTAAC CTCGAGCACCTGGCCCAGCCAGTCCATCACCTGCAATGTGGCCCACCCGGC AAGCAGCACCAAGGTGGACAAGAAAATTGAGCCCAGAGGGCCCACAATCAA GCCCTGTCCTCCATGCAAATGCCCAGCACCTAACCTCTTGGGTGGACCATC CGTCTTCATCTTCCCTCCAAAGATCAAGGATGTACTCATGATCTCCCTGAG CCCCATAGTCACATGTGTGGTGGTGGATGTGAGCGAGGATGACCCAGATGT CCAGATCAGCTGGTTTGTGAACAACGTGGAAGTACACACAGCTCAGACACA AACCCATAGAGAGGATTACAACAGTACTCTCCGGGTGGTCAGTGCCCTCCC CATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCAAATGCAAGGTCAA CAACAAAGACCTCCCAGCGCCCATCGAGAGAACCATCTCAAAACCCAAAGG GTCAGTAAGAGCTCCACAGGTATATGTCTTGCCTCCACCAGAAGAAGAGAT GACTAAGAAACAGGTCACTCTGACCTGCATGGTCACAGACTTCATGCCTGA AGACATTTACGTGGAGTGGACCAACAACGGGAAAACAGAGCTAAACTACAA GAACACTGAACCAGTCCTGGACTCTGATGGTTCTTACTTCATGTACAGCAA GCTGAGAGTGGAAAAGAAGAACTGGGTGGAAAGAAATAGCTACTCCTGTTC AGTGGTCCACGAGGGTCTGCACAATCACCACACGACTAAGAGCTTCTCCCG GACTCCGGGTAAA SEQIDNo.39:LightChainofA002B39withmuKappa (aminoacid) EIVLTQSPATLSLSPGERATLSCRASQSVDSALAWYQQKPGQAPRLLIYGA SNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRFNWPITFGQGT KVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGS ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC SEQIDNo.40:LightChainofA002B39withmuKappa (DNA) GAAATTGTGCTGACCCAGAGCCCGGCGACCCTGAGCCTGAGCCCGGGCGAA CGCGCGACCCTTAGCTGCCGTGCAAGTCAGAGTGTGGACAGCGCGCTGGCG TGGTATCAGCAGAAACCGGGCCAGGCGCCGCGCCTGCTGATTTATGGTGCG AGCAACCGCGCGACCGGCATTCCGGCGCGCTTTAGCGGCAGCGGCAGCGGC ACCGATTTTACCCTGACCATTAGCAGCCTGGAACCGGAAGATTTTGCGGTG TATTATTGCCAGCAGCGTTTCAACTGGCCGATCACCTTTGGCCAGGGCACC AAAGTGGAAATTAAACGGGCTGATGCTGCACCGACTGTGTCCATCTTCCCA CCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTG AACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGT GAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGAC AGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGAA CGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCC ATTGTCAAGAGCTTCAACAGGAATGAGTGT SEQIDNo.41:KL2B413VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMTWVRQAPGKGLEWVANI KQDGSERYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDQNY DILTGHYGMDVWGQGTTVTVSS SEQIDNo.42:KL2B413VL EIVLTQSPSFLSASVGDRVTITCRASQGISSYLSWYQQKPGKAPKLLIYAT STLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPRTFGQGT KVEIK SEQIDNO:43-CAR1(KL2B413_HL;pBD000091628) EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMTWVRQAPGKGLEWVANI KQDGSERYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDQNY DILTGHYGMDVWGQGTTVTVSSGGSEGKSSGSGSESKSTGGSEIVLTQSPS FLSASVGDRVTITCRASQGISSYLSWYQQKPGKAPKLLIYATSTLQSGVPS RFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPRTFGQGTKVEIKTSTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGT CGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEE GGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMG GKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR SEQIDNO:44-CAR2(KL2B413LH;pBD000091623) EIVLTQSPSFLSASVGDRVTITCRASQGISSYLSWYQQKPGKAPKLLIYAT STLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPRTFGQGT KVEIKGGSEGKSSGSGSESKSTGGSEVQLVESGGGLVQPGGSLRLSCAASG FTFSSYWMTWVRQAPGKGLEWVANIKQDGSERYYVDSVKGRFTISRDNAKN SLYLQMNSLRAEDTAVYYCARDQNYDILTGHYGMDVWGQGTTVTVSSTSTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGT CGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEE GGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMG GKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR SEQIDNo.45:HeavyChainVariableDomainof A002B39(aminoacid) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGI IPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARVQWG LDYWGQGTLVTVSS SEQIDNo.46:LightChainVariableDomainof A002B39(aminoacid) EIVLTQSPATLSLSPGERATLSCRASQSVDSALAWYQQKPGQAPRLLIYGA SNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRFNWPITFGQGT KVEIK SEQIDNO:47-humanKallikrein-2sequence (signalsequence:aminoacids1-18) MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCG GVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYN MSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCY ASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTG GKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKD TIAANP
INCORPORATION BY REFERENCE
(162) All publications and patents mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference.
(163) While specific embodiments of the subject disclosure have been discussed, the above specification is illustrative and not restrictive. Many variations of the disclosure will become apparent to those skilled in the art upon review of this specification and the claims below. The full scope of the disclosure should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.