ANTIBODY BINDING TO LINKER OF scFv OR LIKE

20240400718 ยท 2024-12-05

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides an antibody that binds to a linker in a new style of binding. More specifically, the present invention provides an antibody that binds to the linking part between a first region and a linker and the linking part between a linker and a second region in an scFv structure.

Claims

1. An antibody that binds to an scFv comprising a first region, a linker, and a second region, wherein the first region, the linker, and the second region in the scFv are arranged in this order in the direction from the N terminal to the C terminal, the first region and second region are a heavy-chain variable region of an antibody and a light-chain variable region of the antibody, respectively, or a light-chain variable region of an antibody and a heavy-chain variable region of the antibody, respectively, and the antibody is an antibody satisfying at least one of the following (i) to (vi): (i) the antibody binds to an isolated peptide having an amino acid sequence of (i-a) a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and (i-b) a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, the isolated peptide having 13 to 20 amino acid length, (ii) the antibody binds to an isolated peptide having an amino acid sequence of (ii-a) a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and (ii-b) a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region, the isolated peptide having 13 to 20 amino acid length, (iii) the antibody binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24, (iv) the antibody binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19 to 24 and 50 to 71, (v) the antibody binds to (v-a) a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and/or (v-b) a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, and (vi) the antibody binds to (vi-a) a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and/or (vi-b) a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region.

2. The antibody according to claim 1, wherein (i) the antibody binds to an isolated peptide having an amino acid sequence of (i-a) a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and (i-b) a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, the isolated peptide having a 13 to 20 amino acid length.

3. The antibody according to claim 1, wherein (ii) the antibody binds to an isolated peptide having an amino acid sequence of (ii-a) a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and (ii-b) a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region, the isolated peptide having a 13 to 20 amino acid length.

4. The antibody according to claim 1, wherein (iii) the antibody binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24.

5. The antibody according to claim 1, wherein (iv) the antibody binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19 to 24 and 50 to 71.

6. The antibody according to claim 1, wherein (v) the antibody binds to (v-a) a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and/or (v-b) a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker.

7. The antibody according to claim 1, wherein (vi) the antibody binds to (vi-a) a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and/or (vi-b) a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region.

8. The antibody according to claim 1, wherein (vii) the antibody exhibits no significant binding affinity for an scFv in which the order of the heavy-chain variable region and the light-chain variable region is interchanged.

9. The antibody according to claim 1, wherein (viii) the antibody exhibits significant binding affinity even for an scFv in which the order of the heavy-chain variable region and the light-chain variable region is interchanged.

10. The antibody according to claim 1, wherein the antibody binds to a chimeric antigen receptor (CAR) comprising the scFv.

11. The antibody according to claim 1, wherein the antibody binds to a cell expressing the chimeric antigen receptor (CAR) comprising the scFv.

12. A method for detecting a cell expressing a chimeric antigen receptor (CAR) comprising an scFv, comprising bringing the cell into contact with the antibody according to claim 11.

13. A kit or test agent for detecting a cell expressing a chimeric antigen receptor (CAR) comprising an scFv, wherein the kit or test agent comprises the antibody according to claim 11.

14. A method for targeting a cell expressing a chimeric antigen receptor (CAR) comprising an scFv in a subject, comprising administering the cell expressing the chimeric antigen receptor (CAR) comprising an scFv to the subject and administering the antibody according to claim 11 to the subject.

15. An antibody formulation for use in targeting a cell expressing a chimeric antigen receptor (CAR) comprising an scFv in a subject administered with the cell expressing a chimeric antigen receptor (CAR) comprising an scFv, wherein the antibody formulation comprises the antibody according to claim 11.

16. A method for obtaining an antibody that binds to an scFv, wherein the scFv comprises a first region, a linker, and a second region, wherein the first region, the linker, and the second region in the scFv are arranged in this order in the direction from the N terminal to the C terminal, and the first region and second region are a heavy-chain variable region of an antibody and a light-chain variable region of an antibody, respectively, or a light-chain variable region of an antibody and a heavy-chain variable region of an antibody, respectively, the method comprising selecting or identifying, from a group of antibodies, an antibody that binds to an scFv and satisfying at least one of (i) to (vi): (i) the antibody binds to an isolated peptide having an amino acid sequence of a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, the isolated peptide having 13 to 20 amino acid length, (ii) the antibody binds to an isolated peptide having an amino acid sequence of a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region, the isolated peptide having 13 to 20 amino acid length, (iii) the antibody binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24, (iv) the antibody binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19 to 24 and 50 to 71, (v) the antibody binds to a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region and a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, and (vi) the antibody binds to a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region.

17. The method according to claim 16, wherein (vii) the antibody exhibits no significant binding affinity for an scFv in which the order of the heavy-chain variable region and the light-chain variable region is interchanged.

18. The method according to claim 16, wherein (viii) the antibody exhibits significant binding affinity even for an scFv in which the order of the heavy-chain variable region and the light-chain variable region is interchanged.

19. The method according to claim 16, further comprising allowing an antibody-producing cell to produce an antibody comprising amino acid sequences of heavy-chain CDR1 to 3 and light-chain CDR1 to 3 of the antibody screened.

20. An antibody that binds to an scFv, wherein: (i) the antibody comprises a heavy-chain variable region comprising heavy-chain CDR1 to 3 of a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 of a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95 as light-chain CDR1 to 3 thereof, respectively; (ii) the antibody comprises a heavy-chain variable region comprising heavy-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 92, heavy-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 93, and heavy-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 94; and a light-chain variable region comprising light-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 96, light-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 97, and light-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 98; (iii) the antibody comprises a heavy-chain variable region comprising heavy-chain CDR1 to 3 in a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 in a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 100 as light-chain CDR1 to 3 thereof, respectively; (iv) the antibody comprises a heavy-chain variable region comprising heavy-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 100, heavy-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 101, and heavy-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 102; and a light-chain variable region comprising light-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 104, light-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 105, and light-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 106; (v) the antibody comprises a heavy-chain variable region comprising heavy-chain CDR1 to 3 in a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 in a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122 as light-chain CDR1 to 3 thereof, respectively; (vi) the antibody comprises a heavy-chain variable region comprising heavy-chain CDR1 to 3 in a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 in a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154 as light-chain CDR1 to 3 thereof, respectively; (vii) the antibody comprises a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95; (viii) the antibody comprises a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 103; (ix) the antibody comprises a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122; (x) the antibody comprises a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154; (xi) the antibody competes with an antibody according to any one of (vii), (viii), (ix), and (x) for binding to an scFv; (xii) the antibody is any one of the antibodies mentioned above, which does not substantially bind to a naturally occurring (in vivo) immunoglobulin, or (xiii) the antibody has an identity of 90% or more with the amino acid sequence of the antibody according to any one of the antibodies mentioned above.

21. A method for obtaining an antibody that binds to an scFv, comprising selecting or identifying, from a group of antibodies, an antibody that binds to an scFv and satisfying any one of (i) the antibody comprising a heavy-chain variable region comprising heavy-chain CDR1 to 3 of a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 of a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95 as light-chain CDR1 to 3 thereof, respectively; (ii) the antibody comprising a heavy-chain variable region comprising heavy-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 92, heavy-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 93, and heavy-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 94, and a light-chain variable region comprising light-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 96, light-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 97, and light-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 98; (iii) the antibody comprising a heavy-chain variable region comprising heavy-chain CDR1 to 3 in a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 in a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 100 as light-chain CDR1 to 3 thereof, respectively; (iv) the antibody comprising a heavy-chain variable region comprising heavy-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 100, heavy-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 101, and heavy-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 102; and a light-chain variable region comprising light-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 104, light-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 105, and light-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 106; (v) the antibody comprising a heavy-chain variable region comprising heavy-chain CDR1 to 3 in a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 in a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122 as light-chain CDR1 to 3 thereof, respectively; (vi) the antibody comprising a heavy-chain variable region comprising heavy-chain CDR1 to 3 in a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 in a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154 as light-chain CDR1 to 3 thereof; (vii) the antibody comprising a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95; (viii) the antibody comprising a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 103; (ix) the antibody comprising a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122; (x) the antibody comprising a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154; (xi) the antibody competing with an antibody according to any one of (vii), (viii), (ix), and (x) for binding to an scFv; (xii) the antibody being any one of the antibodies mentioned above, which does not substantially bind to a naturally occurring (in vivo) immunoglobulin; or (xiii) the antibody having an identity of 90% or more with the amino acid sequence of the antibody according to any one of the antibodies mentioned above.

Description

BRIEF DESCRIPTION OF DRAWINGS

[0115] FIG. 1 shows a structure of a typical scFv and examples of the antibody of the present invention, antibodies 1 and 2. In FIG. 1, antibody 1 binds to a linking part between a first region and a linker and antibody 2 binds to a linking part between the linker and a second region.

[0116] FIG. 2 shows the binding affinity of the exemplary antibodies according to the present invention for T cells expressing chimeric antigen receptors (CAR) containing different scFvs, which are examples of an antigen-binding compound containing an scFv. In FIG. 2, antibodies against a VH-L.sub.1-VL scFv were recovered from the culture supernatants of hybridoma clones and the binding ability of them to CAR-T cells were examined. In FIG. 2, the stronger the binding affinity, the stronger the strength of PE. As the CAR-T cells, S #031, #673, and #530 were used. The details of these CAR-T cells are as shown in Table 5.

[0117] FIG. 3 shows the binding affinity of the exemplary antibodies according to the present invention for T cells expressing chimeric antigen receptors (CAR) containing different scFvs, which are examples of an antigen-binding compound containing an scFv. In FIG. 3, antibodies against a VH-L.sub.1-VL scFv were collected from the culture supernatants of hybridoma clones and the binding ability of them to CAR-T cells were examined. In FIG. 3, the stronger the binding affinity, the stronger the strength of PE. As the CAR-T cells, S #067, S #075, and #231 were used. The details of these CAR-T cells are as shown in Table 5.

[0118] FIG. 4 shows the binding affinity of the exemplary antibodies according to the present invention for T cells expressing chimeric antigen receptors (CAR) containing different scFvs, which are examples of an antigen-binding compound containing an scFv. In FIG. 4, antibodies against a VH-L.sub.1-VL scFv were collected from the culture supernatants of hybridoma clones and the binding ability of them to CAR-T cells were examined. In FIG. 4, the stronger the binding affinity, the stronger the strength of PE. As the CAR-T cells, #673, and S #017 were used. The details of these CAR-T cells are as shown in Table 5.

[0119] FIG. 5 shows the binding affinity of the antibodies exemplified by the present invention for T cells expressing chimeric antigen receptors (CAR) containing different scFvs, which are examples of an antigen-binding compound containing an scFv. In FIG. 4, antibodies against a VL-L.sub.1-VH scFv were collected from the culture supernatants of hybridoma clones and the binding ability of them to CAR-T cells were examined. In FIG. 5, the stronger the binding affinity, the stronger the strength of PE. As the CAR-T cells, S #067, S #075, #231, and S #031 were used. The details of these CAR-T cells are as shown in Table 5.

DETAILED DESCRIPTION OF THE INVENTION

Definition

[0120] In the specification, the term comprise is used in a sense covering the meaning expressed by consist of. The term comprise may include elements other than the elements specified, whereas the term consist of does not essentially include elements other than the elements specified and the term consists only of does not include elements other than the elements specified.

[0121] In the specification, the term subject refers to a mammal. Examples of the mammal may include a rodent (for example, a mouse and a rat), a dog, a cat, a cow, a horse, a pig, a primate (for example, a monkey, a gorilla, an orangutan, a bonobo, a chimpanzee and a human). A human can be a typical example of the subject.

[0122] In the specification, the term treatment is used in a sense containing a therapy (therapeutic treatment) and a prophylaxis (preventive treatment). In the specification, the term therapy refers to remedy, curing or prevention of a disease or a disorder; improvement of a remission; or slow-down of progression of a disease or a disorder. In the specification, the term prophylaxis means decreasing the possibility of developing a disease or a pathological condition or delaying the onset of a disease or a pathological condition.

[0123] In the specification, the term disease refers to a symptom that benefits from a therapy. In the specification, the term cancer refers to a malignant tumor.

[0124] In the specification, the phrase therapeutically effective amount refers to the dose of a medicinal agent effective for treating (preventing or remedying) a disease or a condition. The therapeutically effective amount of a medicinal agent can slow down the progression of the symptom of a disease or a condition, stopping exacerbation of the symptom, improving the symptom, curing a symptom, or suppressing the onset or development of the symptom.

[0125] In the specification, the term antibody refers to an immunoglobulin. Antibodies generally have a structure composed of two heavy-chains (H-chains) and two light-chains (L-chains), which are associated and stabilized by pairs of disulfide bonds. The heavy-chain consists of a heavy-chain variable region VH, heavy-chain constant regions CH1, CH2 and CH3 and a hinge region positioned between CH1 and CH2. The light-chain consists of a light-chain variable region VL and a light-chain constant region CL. Of these, VH and VL form a variable region fragment (Fv), which is directly involved in antigen-binding and responsible for diversifying the antibody. An antigen-binding region consisting of VL, CL, VH and CH1 is called a Fab region. The region consisting of a hinge region, CH2 and CH3 is called an Fc region. In the variable regions, the regions directly in contact with an antigen are particularly variable and are called a complementarity-determining region (CDR). A portion that is a relatively less variable region except CDR is called a framework region (FR). Three CDRs are present in each of the heavy-chain and light-chain variable regions and individually called heavy-chain CDR1 to 3 and light-chain CDR1 to 3 in the order from the N terminal. An antibody may have various isotypes such as IgG. An antibody can be a human chimeric antibody, a humanized antibody, or a human antibody. A human chimeric antibody can be prepared by replacing a constant region of a non-human antibody with a constant region of a human antibody. A humanized antibody can be prepared by replacing the region except 6 CDRs of a non-human antibody with the corresponding regions of a human antibody. A human antibody can be prepared by using an animal (e.g., mouse) which has been prepared by replacing at least a heavy-chain variable region of an immunoglobulin with the corresponding region of a human locus. If the non-human derived constant region is used, the constant region is replaced with the amino acid sequence of a human antibody to obtain a human antibody. Generally, an antibody can selectively or specifically bind to its antigen.

[0126] In the specification, CDR refers to a complementarity-determining region present within a heavy-chain variable region and a light-chain variable region of an antibody. Three CDRs are present in each of a heavy-chain variable region and a light-chain variable region and called CDR1, CDR2, and CDR3 sequentially from the N terminal. The CDRs present in a heavy-chain variable region are called heavy-chain CDR1 to 3 (HCDR1 to 3). The CDRs present in a light-chain variable region are called light-chain CDR1 to 3 (LCDR1 to 3). The CDRs can be determined based on, for example, the Kabat numbering scheme (Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, 5th ed., 1991, Bethesda: US Dept. of Health and Human Services, PHS, NIH.), Chothia, AbM, contact, IMGT, Aho, or Martin (Enhanced Chothia). As mentioned above, heavy-chain CDR1 to 3 and light-chain CDR1 to 3 can be estimated based on the amino acid sequences of a heavy-chain variable region and a light-chain variable region in accordance with a routine method.

[0127] In the specification, scFv is an antigen-binding fragment of an antibody having a heavy-chain variable region or an antigen-binding region thereof and a light-chain variable region or an antigen-binding region thereof. In the scFv, the heavy-chain variable region or an antigen-binding region thereof and the light-chain variable region or an antigen-binding region thereof are linked via a linker. In the specification, the scFv has a first region, a linker, and a second region in this order in the direction from the N terminal to the C terminal, as shown in FIG. 1. The first region can be a heavy-chain variable region or an antigen-binding region thereof, and the second region can be a light-chain variable region or an antigen-binding region thereof. Alternatively, the first region can be a light-chain variable region or an antigen-binding region thereof, and the second region can be a heavy-chain variable region or an antigen-binding region thereof. As the linker, generally, a flexible linker is preferably used. In the scFv, the heavy-chain variable region or an antigen-binding region thereof and the light-chain variable region or an antigen-binding region thereof may contain a sequence derived from an antibody of an animal immunized. In the scFv, the heavy-chain variable region or an antigen-binding region thereof and the light-chain variable region or an antigen-binding region thereof may be humanized. In the scFv, the heavy-chain variable region or an antigen-binding region thereof and light-chain variable region or an antigen-binding region thereof can be a heavy-chain variable region or an antigen-binding region thereof and a light-chain variable region or an antigen-binding region thereof of a human antibody. An scFv is sometimes incorporated in an antigen-binding compound as a part thereof and serves as an antigen-binding site therein.

[0128] In the specification, examples of the antibody that binds to the linking part between a first region and a linker may include an antibody binding only to the first region, an antibody binding only to the linker, and an antibody that binds to both the first region and the linker (for example, an antibody that binds to neither a construct formed only of the linker nor a construct formed only of the first region). In the specification, examples of the antibody that binds to the linking part between a second region and a linker may include an antibody that binds only to the second region, an antibody binding only to the linker, and an antibody that binds to both the second region and the linker (for example, an antibody that binds to neither a construct formed only of the linker nor a construct formed only of the second region). In the specification, the linking part used in the linking part between a first region and a linker, the linking part between a second region and a linker and similar phrases, contains a framework region of an antigen-binding fragment (for example, scFv) of an antibody and a linker. An antibody that binds to a construct formed only of a framework may possibly bind to a naturally occurring immunoglobulin. For example, when an antibody to be administered in vivo is required not to substantially bind to a naturally occurring immunoglobulin, it is preferred that the antibody does not substantially bind to the naturally occurring immunoglobulin, and, for example, the antibody does not substantially bind to a construct formed only of a framework region. The antibody to be administered to an individual is preferably an antibody that binds, particularly, to a linking part between a second region and a linker but not to a construct formed only of a linker, a region formed only of a first region or a construct formed only of a second region. The binding property of an antibody can be confirmed by a test for examining the binding between peptides containing individual regions and the antibody. The antibody to be administered to an individual is preferably formed by replacing the sequence except for CDRs of a fragment of the antibody with the sequence of the individual (to which the antibody is to be administered). In this regard, the antibody to be administered to a human can be preferably a human chimeric antibody, more preferably a humanized antibody, and further preferably a human antibody. The antibodies to be used in vitro are not particularly restricted in such a way, and therefore, an antibody that binds to a linking part (for example, a non-human animal antibody, a non-human mammalian antibody, a human chimeric antibody, a humanized antibody, and a human antibody) can be preferably used in vivo.

[0129] In the specification, the term isolation means that a component is separated from the at least one or more of other components present in the same system.

[0130] In the specification, chimeric antigen receptor (CAR) is a chimeric molecule having an antigen-binding fragment (particularly, scFv) of an antibody and an immune-cell activation domain. The CAR is generally a molecule having an scFv, an extracellular hinge domain, a transmembrane domain (for example, CD8 or CD28), and an activation signaling domain (for example, CD3) linked.

[0131] A CAR can be introduced into a cell and expressed on the cell surface. The cell having a CAR expressed thereon can be targeted to a predetermined antigen. When a CAR is introduced, for example, in an immune cell such as a T cell or an NK cell, the immune cell (such as a T cell or an NK cell) can be targeted to cancer. The first-generation CAR had an scFv, an extracellular hinge domain, a transmembrane domain (for example, CD8 or CD28), and an activation signaling domain (for example, CD3) linked therein, whereas the second-generation CAR further contains a costimulatory molecule signaling domain for activating an immune cell having CAR introduced therein. Examples of the costimulatory molecule signaling domain include costimulatory factors such as CD28, 4-1BB, OX40, CD27, and ICOS. In the third-generation CAR, a plurality of costimulatory factors are integrated therein. As mentioned above, a CAR has been improved in order to continuously proliferate an immune cell having the CAR introduced therein within a living organism. All domains other than an scFv portion are preferably derived from human protein.

<Antibody of the Present Invention Capable of Detecting scFv>

[0132] According to the present invention, there is provided an antibody that binds to an scFv. The antibody of the present invention can be designed so as to bind to a portion near linker (particularly, a linking part between a first region and a linker, or a linking part between a linker and a second region) in order to bind to scFvs to various antigens.

[0133] In all embodiments, an scFv may preferably have framework regions of a human heavy-chain variable region and a human light-chain variable region. In a preferable embodiment, an scFv may have a human-antibody-derived heavy-chain variable region and light-chain variable region.

<1> Antibody that Binds to the Linking Part Between the First Region and Linker

[0134] The present inventors have found that an antibody that can be obtained by using, as an antigen, an isolated short-chain peptide (for example, a 10 to 20 amino acid length, more specifically, 13 to 20 amino acids), which has an amino acid sequence of a region that is in the first region and has 1 to 10 amino acids from the C terminal of the first region, can bind to scFvs to various antigens. When a flexible linker is used as the linker, it is not always easy to obtain an antibody that binds to the linker. However, according to the present invention, even in the case where a flexible linker is used as the linker, it is possible to satisfactorily obtain an antibody that binds to a portion near the linker due to the immunogenicity of the first region or second region.

[0135] In other words, the present invention provides an antibody that binds to an isolated short-chain peptide containing a region present within a first region and having 1 to 10 amino acids from the C terminal of the first region. The short-chain peptide can be preferably a partial peptide of an scFv.

[0136] The amino acid sequence of a heavy-chain variable region near the C terminal from a heavy-chain CDR3 (HCDR3) is selected from the group consisting of, for example, WGQGTLVTVSS (SEQ ID NO: 1), WGQGTLVTVSS (SEQ ID NO: 2), WGQGTLVTVSS (SEQ ID NO: 3), WGQGTTLTVS (SEQ ID NO: 4), WGQGTTVTVSSGILGS (SEQ ID NO: 5), GQGTLVTVSS (SEQ ID NO: 109), GAGTTVTVSS (SEQ ID NO: 110), GQGTLVTVSA (SEQ ID NO: 111), GQGTLVTVSS (SEQ ID NO: 117), GQGTTVTVSSGILGS (SEQ ID NO: 118), and GQGTLVTVSS (SEQ ID NO: 119). Accordingly, the short-chain peptide can be designed so as to contain 1 to 10 amino acids from the C terminal of one of these sequences preferably 1 to 5 amino acids, for example, 3 to 5 amino acids (for example, VSS, TVSS, VTVSS (SEQ ID NO: 6), or VTVSA (SEQ ID NO: 120); TVS, LTVS, or TLTVS (SEQ ID NO: 79); or LGS, ILGS, or GILGS (SEQ ID NO: 80)). The antibody can bind to a region containing 1 to 10 amino acids from the C terminal of the first region, and preferably, 1 to 5 amino acids (for example, a single amino acid, 1 to 2 amino acids, 1 to 3 amino acids, 1 to 4 amino acids, or 1 to 5 amino acids) from the C terminal of the first region.

[0137] The amino acid sequence of a light-chain variable region near the C terminal from a light-chain CDR3 (HCDR3) can be selected from the group consisting of, for example, FGGGTKLEIK (SEQ ID NO: 7), FGAGTKLELKR (SEQ ID NO: 8), FGGGTQLTVLS (SEQ ID NO: 9), FGGGTKVEIK (SEQ ID NO: 81), FGGGTKVEIK (SEQ ID NO: 107), FGGGTKLEIK (SEQ ID NO: 108), FGGGTKVEIK (SEQ ID NO: 112), FGGGTKLEIK (SEQ ID NO: 113), FGGGTKLEIK (SEQ ID NO: 114), FGGGTKLEIK (SEQ ID NO: 115), and FGGGTKVEIK (SEQ ID NO: 116). Accordingly, the short-chain peptide can be designed so as to contain 1 to 10 amino acids from the C terminal of one of these sequences, preferably 1 to 5 amino acids, for example, 3 to 5 amino acids (for example, EIK, LEIK, or KLEIK (SEQ ID NO: 10); LKR, ELKR, or LELKR (SEQ ID NO: 11); VLS, TVLS, or LTVLS (SEQ ID NO: 12); or EIK, VEIK, or KVEIK (SEQ ID NO: 82)). The antibody can bind to a region containing 1 to 10 amino acids from the C terminal of the first region, and preferably, 1 to 5 amino acids (for example, a single amino acid, 1 to 2 amino acids, 1 to 3 amino acids, 1 to 4 amino acids, or 1 to 5 amino acids) from the C terminal of the first region.

[0138] In a preferable embodiment of the present invention, an antibody can be obtained by using, as an immunogen, a peptide having an amino acid sequence present in (a) a region of 1 to 10 amino acids from the C terminal of the first region and (b) a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker. In this manner, an antibody against a linking part between a first region and the linker can be obtained. In the embodiment, the isolated short-chain peptide can be designed so as to contain (a) a region of 1 to 10 amino acids from the C terminal of the first region, preferably 1 to 5 amino acids, for example, 3 to 5 amino acids (for example, VTV, TVS, VSS, VTVS, TVSS, VTVSS (SEQ ID NO: 6), or VTVSA (SEQ ID NO: 120); TVS, LTVS, or TLTVS (SEQ ID NO: 79); or LGS, ILGS, or GILGS (SEQ ID NO: 80)). In the embodiment, the isolated short-chain peptide can be designed so as to contain (b) a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, preferably 1 to 8 amino acids, for example, 3 to 8 amino acids (for example, a single amino acid, 2 amino acids, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, or 8 amino acids). In the embodiment, the isolated short-chain peptide can be designed so as to contain (b) a region of 1 to 10 amino acids from the N terminal of the linker, preferably 1 to 8 amino acids, for example, 3 to 8 amino acids (for example, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, or 8 amino acids such as GGG, GGGG, GGGGS (SEQ ID NO: 13) or GGGGSG (SEQ ID NO: 14); or SSA, SAD, SSAD, SADD, SSADD (SEQ ID NO: 15), SSADDA (SEQ ID NO: 16), SSADDAK (SEQ ID NO: 17), or SSADDAKK (SEQ ID NO: 18)). In an embodiment, the isolated short-chain peptide may contain 1 to 5 amino acids from the C terminal of the first region and 3 to 8 amino acids from the N terminal of the linker. In a preferable embodiment, the isolated short-chain peptide may be a peptide containing at least 3 to 5 amino acids (for example, VTV, TVS, VSS, VTVS, TVSS, or VTVSS (SEQ ID NO: 6)) from the C terminal of the first region a and at least 3 to 8 amino acids from the N terminal side of a linker (for example, GGG, GGGG, GGGGS (SEQ ID NO: 13) or GGGGSG (SEQ ID NO: 14), SSA, SAD, SSAD, SADD, or SSADD (SEQ ID NO: 15), SSADDA (SEQ ID NO: 16), SSADDAK (SEQ ID NO: 17), or SSADDAKK (SEQ ID NO: 18)).

[0139] In a preferable embodiment, the isolated short-chain peptide may contain any one of Nos. 1 to 16 in Table 1 below.

TABLE-US-00001 TABLE 1 Preferable region the short-chain peptide may at least have From C terminal From N terminal No. of 1st region of linker 1 8 amino acids 8 amino acids 2 7 amino acids 8 amino acids 3 6 amino acids 8 amino acids 4 5 amino acids 8 amino acids 5 4 amino acids 8 amino acids 6 3 amino acids 8 amino acids 7 7 amino acids 7 amino acids 8 6 amino acids 7 amino acids 9 5 amino acids 7 amino acids 10 4 amino acids 7 amino acids 11 3 amino acids 7 amino acids 12 6 amino acids 6 amino acids 13 5 amino acids 6 amino acids 14 4 amino acids 6 amino acids 15 3 amino acids 6 amino acids 16 6 amino acids 5 amino acids 17 6 amino acids 4 amino acids 18 6 amino acids 3 amino acids 19 5 amino acids 5 amino acids 20 4 amino acids 5 amino acids 21 3 amino acids 5 amino acids 22 5 amino acids 4 amino acids 23 5 amino acids 3 amino acids 24 4 amino acids 4 amino acids 25 3 amino acids 4 amino acids 26 4 amino acids 3 amino acids 27 3 amino acids 3 amino acids

[0140] In a preferable embodiment, the isolated short-chain peptide may contain the amino acid sequence of SEQ ID NO: 19: VTVSSSSADDAKK. In the embodiment, the short-chain peptide may contain a region having the C terminal of a heavy-chain variable region and the N terminal of a linker linked therein. In a preferable embodiment, each of the N terminal and C terminal of the isolated short-chain peptide disclosed in the specification, 1 to 3 amino acids (for example, two amino acids such as GG and a single amino acid such as C) may be added.

[0141] In a preferable embodiment, the isolated short-chain peptide may contain the amino acid sequence of SEQ ID NO: 20: VTVSSGGGGSG.

In the embodiment, the short-chain peptide may contain a region having the C terminal of a heavy-chain variable region and the N terminal of a linker linked therein.

[0142] In a preferable embodiment, the isolated short-chain peptide can be the amino acid sequence of SEQ ID NO: 21: GGVTVSSSSADDAKKC or the amino acid sequence of SEQ ID NO: 22: GGVTVSSGGGGSGC.

[0143] In a preferable embodiment, the isolated short-chain peptide may contain the amino acid sequence of SEQ ID NO: 23: LEIKSSADDAKK. In the embodiment, the short-chain peptide may contain a region having the C terminal of a light-chain variable region and the N terminal of a linker linked therein.

[0144] In a preferable embodiment, the isolated short-chain peptide contain the amino acid sequence of SEQ ID NO: 24: LEIKGGGGSG. In the embodiment, the short-chain peptide may contain a region having the C terminal of a light-chain variable region and the N terminal of a linker linked therein.

[0145] In a preferable embodiment, the isolated short-chain peptide can be the amino acid sequence of SEQ ID NO: 70: GGLEIKSSADDAKKC, or the amino acid sequence of SEQ ID NO: 71: GGLEIKGGGGSGC.

[0146] In a preferable embodiment, the antibody of the present invention can bind to an isolated short-chain peptide as mentioned above and can bind to an scFv. In an embodiment, an scFv can be present in the form of being incorporated into another antigen-binding compound (for example, CAR molecule). As the antigen-binding compound, all protein molecules containing an scFv as an antigen-binding portion may be exemplified. Examples of the antigen-binding compound include, but are not particularly limited to, a CAR, an IgG-scFv (a molecule in which an scFv is linked to the Fc region of an IgG molecule), an scFv-Fc (a molecule in which a variable region of an antibody is replaced with an scFv), an scFv.sub.2-Fc (a molecule in which a variable region of an antibody is replaced with an scFv and an scFv is linked to the Fc region thereof), an scFv-HSA-scFv (a molecule in which an scFv is linked to each of the N terminal and C terminal of human serum albumin), a Fab-scFv-Fc (a molecule in which variable regions of an antibody are replaced with a Fab and an scFv, respectively, and a Fab and an scFv are linked to the Fc region), a Fab-scFv (a molecule in which an scFv is linked to a Fab), and a BiTE (molecules in which two scFvs are linked).

[0147] In an embodiment, a linker may have a 10 to 40 amino acid length, for example, 15 to 25 amino acid length.

[0148] In an embodiment, the linker in an scFv can be a flexible linker. Examples of the flexible linker include a linker containing G and S, such as GGGGSGGGGS (SEQ ID NO: 25), GGGGSGGGGSGGGGS (SEQ ID NO: 26), GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 27) and GGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 28); and SSADDAKKDAAKKDDAKKDDAKKDG (SEQ ID NO: 29).

[0149] In an embodiment, the antibody of the present invention can bind to an isolated short-chain peptide as mentioned above and can bind to an scFv. In addition, the antibody of the present invention can recognize a linking part between a first region and a linker in the isolated short-chain peptide.

[0150] In an embodiment, the antibody of the present invention binds to a peptide containing only a first region, and a peptide containing only a linker with a lower binding affinity than that for an isolated short-chain peptide as mentioned above (for example, 50% or less, 40% or less, 30% or less, 20% or less, 10% or less, or 1% or less, 1/1000 or less, or 1/10000 or less) or does not have a significant binding affinity. Alternatively, the antibody of the present invention binds to an scFv in which the order of the heavy-chain variable region and the light-chain variable region (i.e., the first region and the second region) is interchanged with a lower binding affinity than that for an scFv in which the first region, linker and second region are linked in this order (for example, 50% or less, 40% or less, 30% or less, 20% or less, 10% or less, or 1% or less, 1/1000 or less, or 1/10000 or less) or does not have a significant binding affinity. Alternatively, the lower binding affinity may mean that binding dissociation constant KD is more than 1 (exceeding the KD value of a comparative subject), 1.1 times or more, 1.2 times or more, 1.3 times or more, 1.4 times or more, 1.5 times or more, 2 times or more, 3 times or more, 4 times or more, 5 times or more, 6 times or more, 7 times or more, 8 times or more, 9 times or more, 10 times or more, 100 times or more, or 1000 times or more as large as the KD value of a comparative subject.

<2> Antibody that Binds to Linking Part Between Linker and Second Region

[0151] In the above section, an antibody that binds to the linking part between a first region and a linker was described. However, an antibody that binds to the linking part between a linker and a second region can also be useful like the above.

[0152] In an embodiment of the present invention, there can be provided an antibody that binds to an isolated short-chain peptide that is present in the second region and contains 1 to 10 amino acids from the N terminal of the second region.

[0153] In an embodiment of the present invention, there can be provided an antibody that binds to an isolated short-chain peptide (for example, a 10 to 20 amino acid length, more specifically 13 to 20 amino acids) having amino acid sequences of (c) a partial region of a linker continuous with a second region and having 1 to 10 amino acids from the C terminal of the linker, and (d) a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region.

[0154] Examples of the amino acid sequence of a heavy-chain variable region closer to the N terminal than heavy-chain CDR1 (HCDR1) may include QVTLKESGPA (SEQ ID NO: 30), QVQLVQSGAE (SEQ ID NO: 31), EVQLVQSGAE (SEQ ID NO: 32), SQVQLKESGP (SEQ ID NO: 33), and QVQLQQSGPG (SEQ ID NO: 34). Accordingly, the short-chain peptide can be designed so as to contain 1 to 10 amino acids, preferably 1 to 5 amino acids, for example, 3 to 5 amino acids (for example, VTVSS (SEQ ID NO: 6)) from the C terminal of one of these sequences. The antibody can bind to a region containing 1 to 10 amino acids from the C terminal of the first region, and preferably, 1 to 5 amino acids (for example, 1 amino acid, 1 to 2 amino acids, 1 to 3 amino acids, 1 to 4 amino acids, or 1 to 5 amino acids) from the C terminal of the first region.

[0155] Examples of the amino acid sequence of a heavy-chain variable region closer to the N terminal than light-chain CDR1 include DIVMTQSPLS (SEQ ID NO: 35), DIVMTQSPDS (SEQ ID NO: 36), DIQLTQSPSS (SEQ ID NO: 37), DIQMTQSPKF (SEQ ID NO: 38), and QPVLTQSSSL (SEQ ID NO: 39). Accordingly, the short-chain peptide can be designed so as to contain 1 to 10 amino acids, preferably 1 to 5 amino acids, for example, 3 to 5 amino acids (for example, VTVSS (SEQ ID NO: 6)) from the N terminal of each of these sequences. The antibody can bind to a region containing 1 to 10 amino acids from the N terminal of the second region, and preferably, 1 to 5 amino acids (for example, 1 amino acid, 1 to 2 amino acids, 1 to 3 amino acids, 1 to 4 amino acids, or 1 to 5 amino acids) from the N terminal of the second region.

[0156] In a preferable embodiment of the present invention, there can be provided an antibody using, as an immunogen, a peptide having amino acid sequences of (c) a partial region of a linker continuous with a second region and having 1 to 10 amino acids from the C terminal of the linker, and (d) a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region. In this way, an antibody against a linking part between a second region and a linker can be obtained. In the embodiment, the isolated short-chain peptide can be designed so as to contain (c) a partial region of a linker continuous with a second region and having 1 to 10 amino acids from the C terminal of the linker, preferably 1 to 8 amino acids, more specifically, 3 to 8 amino acids (3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids or 8 amino acids such as GGS, GGGS, GGGGS (SEQ ID NO: 13), or SGGGGS (SEQ ID NO: 40), or KDG, KKDG, AKKDG (SEQ ID NO: 41), DAKKDG (SEQ ID NO: 42), DDAKKDG (SEQ ID NO: 43), or KDDAKKDG (SEQ ID NO: 44)). In the embodiment, the isolated short-chain peptide can be designed so as to contain (d) a region present within the second region and having 1 to 10 amino acids, preferably 1 to 5 amino acids, for example, 3 to 5 amino acids (for example, DX.sub.1X.sub.2X.sub.3T, in which X.sub.1 is I or P, X.sub.2 is V or Q, X.sub.3 is M or L (SEQ ID NO: 45), for example, DIVMT (SEQ ID NO: 46), DIQLT (SEQ ID NO: 47), DIQMT (SEQ ID NO: 48), or QPVLT (SEQ ID NO: 49)) from the N terminal of the second region. In this embodiment, the isolated short-chain peptide may contain 3 to 8 amino acids from the C terminal of the linker and 1 to 5 amino acids from the N terminal of the second region. In a preferable embodiment, examples of the isolated short-chain peptide include a peptide containing 3 to 8 amino acids (for example, GGS, GGGS, GGGGS (SEQ ID NO: 13), or SGGGGS (SEQ ID NO: 40), or KDG, KKDG, AKKDG (SEQ ID NO: 41), DAKKDG (SEQ ID NO: 42), DDAKKDG (SEQ ID NO: 43), or KDDAKKDG (SEQ ID NO: 44)) from the C terminal of the linker and a peptide containing 3 to 5 amino acids from the N terminal of a second region.

[0157] In a preferable embodiment, the isolated short-chain peptide may contain any one of Nos. 1 to 27 in Table 2 below.

TABLE-US-00002 TABLE 2 Preferable region the short-chain peptide may at least have From C terminal From N terminal of No. of linker second region 1 8 amino acids 8 amino acids 2 7 amino acids 8 amino acids 3 6 amino acids 8 amino acids 4 5 amino acids 8 amino acids 5 4 amino acids 8 amino acids 6 3 amino acids 8 amino acids 7 7 amino acids 7 amino acids 8 6 amino acids 7 amino acids 9 5 amino acids 7 amino acids 10 4 amino acids 7 amino acids 11 3 amino acids 7 amino acids 12 6 amino acids 6 amino acids 13 5 amino acids 6 amino acids 14 4 amino acids 6 amino acids 15 3 amino acids 6 amino acids 16 6 amino acids 5 amino acids 17 6 amino acids 4 amino acids 18 6 amino acids 3 amino acids 19 5 amino acids 5 amino acids 20 4 amino acids 5 amino acids 21 3 amino acids 5 amino acids 22 5 amino acids 4 amino acids 23 5 amino acids 3 amino acids 24 4 amino acids 4 amino acids 25 3 amino acids 4 amino acids 26 4 amino acids 3 amino acids 27 3 amino acids 3 amino acids

[0158] In a preferable embodiment, the isolated short-chain peptide may contain

TABLE-US-00003 theaminoacidsequenceofSEQIDNO:50: KDDAKKDGQVTLK, theaminoacidsequenceofSEQIDNO:51: KDDAKKDGQVQLV, theaminoacidsequenceofSEQIDNO:52: KDDAKKDGEVQLV, theaminoacidsequenceofSEQIDNO:53: KDDAKKDGSQVQL, or theaminoacidsequenceofSEQIDNO:54: KDDAKKDGQVQLQ.

[0159] In the embodiment, the short-chain peptide contains a region having the C terminal of the linker and the N terminal of a heavy-chain variable region linked therein.

[0160] In a preferable embodiment, the isolated short-chain peptide may contain,

TABLE-US-00004 theaminoacidsequenceofSEQIDNO:55: SGGGGSQVTLK theaminoacidsequenceofSEQIDNO:56: SGGGGSQVQLV, theaminoacidsequenceofSEQIDNO:57: SGGGGSEVQLV, theaminoacidsequenceofSEQIDNO:58: SGGGGSSQVQL, or theaminoacidsequenceofSEQIDNO:59: SGGGGSQVQLQ.

[0161] In the embodiment, the short-chain peptide contains a region having the C terminal of the linker and the N terminal of a light-chain variable region linked therein.

[0162] In a preferable embodiment, the isolated short-chain peptide may contain,

TABLE-US-00005 theaminoacidsequenceofSEQIDNO:83: KDDAKKDGDIVMT, theaminoacidsequenceofSEQIDNO:84: KDDAKKDGDIQLT, theaminoacidsequenceofSEQIDNO:85: KDDAKKDGDIQMT, or theaminoacidsequenceofSEQIDNO:86: KDDAKKDGQPVLT.

[0163] In the embodiment, the short-chain peptide contains a region having the C terminal of the linker and the N terminal of a light-chain variable region linked therein.

[0164] In a preferable embodiment, the isolated short-chain peptide may contain,

TABLE-US-00006 theaminoacidsequenceofSEQIDNO:87: SGGGGSDIVMT, theaminoacidsequenceofSEQIDNO:88: SGGGGSDIQLT, theaminoacidsequenceofSEQIDNO:89: SGGGGSDIQMT, or theaminoacidsequenceofSEQIDNO:90: SGGGGSQPVLT.

[0165] In the embodiment, the short-chain peptide contains a region having the C terminal of the linker and the N terminal of a light-chain variable region linked therein.

[0166] In a preferable embodiment, the isolated short-chain peptide can be,

TABLE-US-00007 theaminoacidsequenceofSEQIDNO:60: GGKDDAKKDGQVTLKC, theaminoacidsequenceofSEQIDNO:61: GGKDDAKKDGQVQLVC, theaminoacidsequenceofSEQIDNO:62: GGKDDAKKDGEVQLVC, theaminoacidsequenceofSEQIDNO:63: GGKDDAKKDGSQVQLC, or theaminoacidsequenceofSEQIDNO:64: GGKDDAKKDGQVQLQC.

[0167] In a preferable embodiment, the isolated short-chain peptide can be,

TABLE-US-00008 theaminoacidsequenceofSEQIDNO:65: GGSGGGGSQVTLKC, theaminoacidsequenceofSEQIDNO:66: GGSGGGGSQVQLVC, theaminoacidsequenceofSEQIDNO:67: GGSGGGGSEVQLVC, theaminoacidsequenceofSEQIDNO:68: GGSGGGGSSQVQLC, or theaminoacidsequenceofSEQIDNO:69: GGSGGGGSQVQLQC.

[0168] As described above, an antibody that binds to a linking part of a linker and a heavy-chain or light-chain variable region can be obtained by immunizing an animal with a peptide having the amino acid sequence of the linking part, and obtaining the antibody. In this case, even if a linker itself has low immunogenicity, an antibody that binds to a portion near the linker can be obtained.

[0169] In an embodiment, the antibody of the present invention binds to an isolated short-chain peptide as mentioned above but it binds to a peptide having only a second region and a peptide having only the sequence of a linker, only with a lower affinity than the isolated short-chain peptide (for example, 50% or less, 40% or less, 30% or less, 20% or less, 10% or less, or 1% or less, 1/1000 or less, or 1/10000 or less) or does not significantly bind to the peptide. The lower binding affinity may mean that binding dissociation constant KD is more than 1 (exceeding the KD value of a comparative subject), 1.1 times or more, 1.2 times or more, 1.3 times or more, 1.4 times or more, 1.5 times or more, 2 times or more, 3 times or more, 4 times or more, 5 times or more, 6 times or more, 7 times or more, 8 times or more, 9 times or more, 10 times or more, 100 times or more, or 1000 times or more as large as the KD value of a comparative subject.

[0170] In an embodiment, the antibody of the present invention binds to an isolated short-chain peptide as mentioned above but it binds to either one of a peptide only having a second region and a peptide only having the sequence of a linker, with a significant binding affinity.

<3> Antibody Binding Principally to Linker

[0171] In an embodiment, the antibody of the present invention can bind to an isolated short-chain peptide as mentioned above and can bind to an scFv. In an embodiment, the antibody of the present invention binds principally to either one of a first region and a linker. In an embodiment, the antibody of the present invention may an antibody that binds to an isolated short-chain peptide as mentioned above, and principally binds to the linker of an scFv. The antibody that principally binds to the linker of an scFv refers to an antibody binding even to an scFv in which the first and second regions are interchanged. In actual binding, the antibody needs not to bind only to a linker and may also bind to an amino acid in either one of the first and second regions that are positioned near the linker of the first and second region, respectively. In an embodiment, an antibody binding principally to the linker of an scFv can bind to a peptide consisting of the amino acid sequence of the linker.

[0172] In an embodiment, the antibody of the present invention can bind to any one of the peptides having amino acid sequences of SEQ ID NO: 13 to 18 and 26 to 29 and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to a peptide having the amino acid sequence of SEQ ID NO: 13 or 14 and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to any one of the peptides having the amino acid sequences of SEQ ID NO: 15 to 18, and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to any one of the peptides having the amino acid sequences of SEQ ID NO: 26 to 28, and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to a peptide having the amino acid sequence of SEQ ID NO: 29 and can bind to a scFv.

[0173] As shown in Examples, an animal is immunized with a peptide having the amino acid sequence of a linking part of a linker and a heavy-chain or light-chain variable region to obtain an antibody. As a result, even if a linker itself has low immunogenicity, an antibody binding principally to the linker can be obtained.

[0174] An antibody binding principally to a linker binds even to an scFv in which the first and second regions are interchanged. Since an antibody binding principally to a linker binds even to scFvs having the first and second regions different in sequence, the antibody finds a wide range of use.

<4> Antibodies that Binds to More Specific Peptides

[0175] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 19. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 20. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 21. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 22. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 23. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 24. In a more preferable embodiment, the antibody of the present invention can bind to one or more of the isolated short-chain peptides and to an antibody fragment containing an scFv as a partial structure. Examples of an antibody fragment containing an scFv as a partial structure includes any of protein molecules containing an scFv as mentioned above as an antigen-binding portion. Specifically, examples of the antibody fragment containing an scFv as a partial structure include, but are not particularly limited to, a CAR, an IgG-scFv (a molecule in which an scFv is linked to the Fc region of an IgG molecule), an scFv-Fc (a molecule in which a variable region of an antibody is replaced with an scFv), an scFv.sub.2-Fc (a molecule in which a variable region of an antibody is replaced with an scFv and an scFv is linked to the Fc region thereof), an scFv-HSA-scFv (a molecule in which an scFv is linked to each of the N terminal and C terminal of human serum albumin), a Fab-scFv-Fc (a molecule in which variable regions of an antibody are replaced with a Fab and an scFv, respectively, and a Fab and an scFv are linked to the Fc region), a Fab-scFv (a molecule in which an scFv is linked to a Fab), and a BiTE (molecules in which two scFvs are linked).

[0176] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 50. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 51. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 52. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 53. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 54. In a more preferable embodiment, the antibody of the present invention can bind to one or more of the isolated short-chain peptides and an antibody fragment containing an scFv as a partial structure. Examples of the antibody fragment containing an scFv as a partial structure include any of protein molecules containing an scFv as mentioned above as an antigen-binding portion.

[0177] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 55. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 56. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 57. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 58. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 59. In a more preferable embodiment, the antibody of the present invention can bind to one or more of the isolated short-chain peptides and an antibody fragment containing an scFv as a partial structure. Examples of the antibody fragment containing an scFv as a partial structure include any of protein molecules containing an scFv as mentioned above as an antigen-binding portion.

[0178] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 60. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 61. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 62. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 63. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 64. In a more preferable embodiment, the antibody of the present invention can bind to one or more of the isolated short-chain peptides and an antibody fragment containing an scFv as a partial structure. Examples of the antibody fragment containing an scFv as a partial structure include any of protein molecules containing an scFv as mentioned above as an antigen-binding portion.

[0179] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 65. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 66. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 67. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 68. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 69. In a more preferable embodiment, the antibody of the present invention can bind to one or more of the isolated short-chain peptides and an antibody fragment containing an scFv as a partial structure. Examples of the antibody fragment containing an scFv as a partial structure include any of protein molecules containing an scFv as mentioned above as an antigen-binding portion.

[0180] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 70. In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in SEQ ID NO: 71. In a more preferable embodiment, the antibody of the present invention can bind to one or more of the isolated short-chain peptides and an antibody fragment containing an scFv as a partial structure. Examples of the antibody fragment containing an scFv as a partial structure include any of protein molecules containing an scFv as mentioned above as an antigen-binding portion.

[0181] In a preferable embodiment, the isolated short-chain peptide can be a peptide having the amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24.

[0182] In a preferable embodiment, the antibody of the present invention can bind to an scFv. In a more preferable embodiment, the antibody of the present invention can bind to an antibody fragment containing an scFv as a partial structure. In a further preferable embodiment, the antibody of the present invention can bind to a CAR.

[0183] In a particularly preferable embodiment, the antibody of the present invention binds to a region of 1 to 10 amino acids on the C terminal side of the first region of an scFv. In a particularly preferable embodiment, the antibody of the present invention binds to a region of 1 to 10 amino acids on the N terminal side of the second region of an scFv. Accordingly, in a particularly preferable embodiment, the antibody of the present invention does not bind or binds only with low binding affinity to a peptide containing the sequence of a linker (for example, a whole length thereof) and not containing the amino acid on the C terminal side of the first region of an scFv and a peptide containing the sequence of a linker (for example, a whole length thereof) and not containing the amino acid sequence on the N terminal side of the second region of an scFv. In a particularly preferable embodiment, the antibody of the present invention binds to a linking part of a region of 1 to 10 amino acids on the C terminal side of the first region of an scFv and a linker, and does not bind or binds only with low binding affinity to the linker portion (for example, a whole length thereof). In a particularly preferable embodiment, the antibody of the present invention binds to a linking part of the linker and the second region of scFv and does not bind or bind only with low binding affinity to the linker portion (for example, a whole length thereof). The lower binding affinity may mean that an antibody has a KD value more than 1, 1.1 times or more, 1.2 times or more, 1.3 times or more, 1.4 times or more, 1.5 times or more, 2 times or more, 3 times or more, 4 times or more, 5 times or more, 6 times or more, 7 times or more, 8 times or more, 9 times or more, 10 times or more, 100 times or more, or 1000 times or more as large as the KD value for a peptide containing an amino acid region of 1 to 10 amino acids on the C terminal side of the first region of an scFv continuous to a linker.

[0184] In an embodiment, the antibody of the present invention can bind to any one of the peptides having the amino acid sequences of SEQ ID NOs: 13 to 18 and 26 to 29, and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to a peptide having the amino acid sequence of SEQ ID NO: 13 or 14 and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to any one of the peptides having the amino acid sequences of SEQ ID NOs: 15 to 18 and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to any one of the peptides having the amino acid sequences of SEQ ID NOs: 26 to 28 and can bind to an scFv. In an embodiment, the antibody of the present invention can bind to a peptide having the amino acid sequences of SEQ ID NO: 29 and can bind to an scFv. In an embodiment, the ratio of the binding affinity (KD value) for a peptide consisting of a linker is, for example, less than 1, 1/10 or less, 1/100 or less, 1/1,000 or less, 10.sup.4 times or less, 10.sup.5 times or less, 10.sup.6 times or less, 10.sup.7 times or less, 10.sup.8 times or less, 10.sup.9 times or less, 10.sup.10 times or less, 10.sup.11 times or less, or 10.sup.12 times or less, compared to the binding affinity (KD value) for the region of 1 to 10 amino acids on the C terminal side of the first region of an scFv or the region of 1 to 10 amino acids on the N terminal side peptide of a second region.

[0185] In a preferable embodiment, the antibody of the present invention can bind to an isolated short-chain peptide as mentioned above and an scFv. In a more preferable embodiment, the antibody of the present invention can bind to an isolated short-chain peptide as mentioned above and an antibody fragment (particularly, an scFv portion thereof) containing an scFv as a partial structure. Examples of the antibody fragment containing an scFv as a partial structure include all protein molecules containing an scFv as mentioned above as an antigen-binding portion. In a further preferable embodiment, the antibody of the present invention can bind to an isolated short-chain peptide as mentioned above and a CAR (particularly, an scFv portion thereof).

[0186] In an embodiment, the antibody of the present invention may be an antibody that binds to an scFv, wherein: [0187] (i) the antibody contains a heavy-chain variable region containing heavy-chain CDR1 to 3 of a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91, as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region having light-chain CDR1 to 3 of a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95 as light-chain CDR1 to 3 thereof, respectively; [0188] (ii) the antibody contains a heavy-chain variable region containing heavy-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 92, heavy-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 93, and heavy-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 94; and a light-chain variable region containing light-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 96, light-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 97, and light-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 98; [0189] (iii) the antibody contains a heavy-chain variable region containing heavy-chain CDR1 to 3 of a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99 as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region containing light-chain CDR1 to 3 of a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 100 as light-chain CDR1 to 3 thereof, respectively; [0190] (iv) the antibody contains a heavy-chain variable region containing heavy-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 100, heavy-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 101, and heavy-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 102, and a light-chain variable region containing light-chain CDR1 having an amino acid sequence set forth in SEQ ID NO: 104, light-chain CDR2 having an amino acid sequence set forth in SEQ ID NO: 105, and light-chain CDR3 having an amino acid sequence set forth in SEQ ID NO: 106; [0191] (v) the antibody contains a heavy-chain variable region containing heavy-chain CDR1 to 3 of a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121 as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region containing light-chain CDR1 to 3 of a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122 as light-chain CDR1 to 3 thereof, respectively; [0192] (vi) the antibody contains a heavy-chain variable region containing heavy-chain CDR1 to 3 of a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153 as heavy-chain CDR1 to 3 thereof, respectively, and a light-chain variable region containing light-chain CDR1 to 3 of a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154 as light-chain CDR1 to 3 thereof, respectively; [0193] (vii) the antibody contains a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95; [0194] (viii) the antibody contains a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 103; [0195] (ix) the antibody contains a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122; [0196] (x) the antibody contains a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154; [0197] (xi) the antibody competes with the above (vii), (viii), (ix), or (x) for binding to an scFv; or [0198] (xii) the antibody is any one of the antibodies mentioned above, which does not substantially bind to a naturally occurring (in vivo) immunoglobulin.

[0199] These antibodies may be non-human antibodies and can be preferably humanized antibodies or human antibodies. For example, the antibody to be administered to a human is an antibody set forth in (xii) and preferably a humanized antibody or a human antibody thereof. The antibody to be used in-vitro test may be a non-human antibody and may not have the properties set forth in (xii). An antibody that competes with the antibody set forth in (ix) for binding to an scFv can be an antibody that does not substantially bind to a naturally occurring (in vivo) immunoglobulin. An antibody that competes with the antibody set forth in (x) for binding to an scFv can be an antibody that does not substantially bind to a naturally occurring (in vivo) immunoglobulin. An antibody that competes with the antibody set forth in (ix) for binding to an scFv can be an antibody that does not substantially bind to a VH-L1-VL scFv. An antibody that competes with the antibody set forth in (ix) for binding to an scFv can be an antibody that does not substantially bind to a VH-L1-VL scFv. An antibody that competes with the antibody set forth in (ix) for binding to an scFv can be an antibody that does not substantially bind to a naturally occurring (in vivo) immunoglobulin and an antibody that does not substantially bind to a VH-L1-VL scFv. An antibody that competes with the antibody set forth in (x) for binding to an scFv can be an antibody that does not substantially bind to a VH-L1-VL scFv. An antibody that competes with the antibody set forth in (ix) for binding to an scFv can be an antibody that does not substantially bind to a naturally occurring (in vivo) immunoglobulin and an antibody that does not substantially bind to a VH-L1-VL scFv.

[0200] In an embodiment, the present invention provides an antibody that binds to a VL-L.sub.1-VH scFv, and more specifically, [0201] (xv) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 123 to 125, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NO: 126 to 128, respectively; [0202] (xv-2) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 129 to 131, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 132 to 134, respectively; [0203] (xv-3) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 135 to 137, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 138 to 140, respectively; [0204] (xv-4) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 141 to 143, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 144 to 146, respectively; [0205] (xv-5) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 147 to 149, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 150 to 152, respectively; [0206] (xvi) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 155 to 157, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 158 to 160, respectively; [0207] (xvi-2) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 161 to 163, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 164 to 166, respectively; [0208] (xvi-3) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 167 to 169, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 170 to 172, respectively; [0209] (xvi-4) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 173 to 175, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 176 to 178, respectively; [0210] (xvi-5) an antibody having a heavy-chain variable region containing heavy-chain CDR1 to 3 set forth in SEQ ID NOs: 179 to 181, respectively, and a light-chain variable region having light-chain CDR1 to 3 set forth in SEQ ID NOs: 182 to 184, respectively; or [0211] (xvii) any one of the above antibodies that does not substantially bind to a naturally occurring (in vivo) immunoglobulin.

[0212] These antibodies may be non-human antibodies and can be preferably humanized antibodies or human antibodies. For example, the antibody to be administered to a human is an antibody set forth in (xvii) and preferably a humanized antibody or a human antibody. The antibody to be used in in-vitro tests may be a non-human antibody or may not have properties set forth in (xvii). These antibodies are preferably antibodies that do not substantially bind to a naturally occurring (in vivo) immunoglobulin. Also, these antibodies are preferably antibodies that do not substantially bind to a VH-L1-VL scFv. These antibodies can be more preferably antibodies that do not substantially bind to a naturally occurring (in vivo) immunoglobulin or substantially bind to a VH-L1-VL scFv.

[0213] In an embodiment, the present invention provides an antibody that binds to a VL-L.sub.1-VH scFv, and containing [0214] a heavy-chain variable region containing [0215] heavy-chain CDR1, which is a partial sequence of a 6 to 10 amino acid length of the amino acid sequence set forth in SEQ ID NO: 121 and has a sequence containing the amino acid sequence (TSY) set forth in SEQ ID NO: 185, [0216] heavy-chain CDR2, which is a partial sequence of a 5 to 16 amino acid length of the amino acid sequence set forth in SEQ ID NO: 121 and has a sequence containing the amino acid sequence (WNDGD) set forth in SEQ ID NO: 186, and [0217] heavy-chain CDR3, which is a partial sequence of an 8 or 9 amino acid length of the amino acid sequence set forth in SEQ ID NO: 121 and has a sequence containing the amino acid sequence (MNGYKD) set forth in SEQ ID NO: 187; and: [0218] a light-chain variable region containing [0219] light-chain CDR1 which is a partial sequence of a 6 to 11 amino acid length of the amino acid sequence set forth in SEQ ID NO: 122 and has a sequence containing the amino acid sequence (KRY) set forth in SEQ ID NO: 188, [0220] light-chain CDR2 which is a partial sequence of a 3 to 10 amino acid length of the amino acid sequence set forth in SEQ ID NO: 122 and has a sequence containing the amino acid sequence (EDS) set forth in SEQ ID NO: 189, and [0221] light-chain CDR3 which is a partial sequence of a 10 or 11 amino acid length of the amino acid sequence set forth in SEQ ID NO: 122 and has a sequence containing the amino acid sequence (HSTYSDDKLR) set forth in SEQ ID NO: 190.

[0222] These antibodies may be non-human antibodies and can be preferably humanized antibodies or human antibodies. For example, the antibody to be administered to a human is an antibody set forth in (xvii) and preferably a humanized antibody or a human antibody. The antibody to be used in in-vitro tests may be a non-human antibody or may not have properties set forth in (xvii). These antibodies are preferably antibodies that do not substantially bind to a naturally occurring (in vivo) immunoglobulin. Also, these antibodies are preferably antibodies that do not substantially bind to a VH-L1-VL scFv. Also, these antibodies can be more preferably antibodies that do not substantially bind to a naturally occurring (in vivo) immunoglobulin and do not substantially bind to a VH-L1-VL scFv.

[0223] In an embodiment, the present invention provides an antibody that binds to a VL-L.sub.1-VH scFv, and containing [0224] a heavy-chain variable region containing [0225] heavy-chain CDR1, which is a partial sequence of a 6 to 8 amino acid length of the amino acid sequence set forth in SEQ ID NO: 153 and has a sequence containing the amino acid sequence (TSY) set forth in SEQ ID NO: 191, [0226] heavy-chain CDR2, which is a partial sequence of a 5 to 16 amino acid length of the amino acid sequence set forth in SEQ ID NO: 153 and has a sequence containing the amino acid sequence (YYDGD) set forth in SEQ ID NO: 192, [0227] heavy-chain CDR3, which is a partial sequence of a 7 to 9 amino acid length of the amino acid sequence set forth in SEQ ID NO: 153 and has a sequence containing the amino acid sequence (SIGAED) set forth in SEQ ID NO: 193; and [0228] a light-chain variable region containing [0229] light-chain CDR1, which is a partial sequence of a 6 to 11 amino acid length of the amino acid sequence set forth in SEQ ID NO: 154 and has a sequence containing the amino acid sequence (KRY) set forth in SEQ ID NO: 194, [0230] light-chain CDR2, which is a partial sequence of a 3 to 10 amino acid length of the amino acid sequence set forth in SEQ ID NO: 154 and has a sequence containing the amino acid sequence (EDS) set forth in SEQ ID NO: 195, and [0231] light-chain CDR3, which is a partial sequence of a 10 or 11 amino acid length of the amino acid sequence set forth in SEQ ID NO: 154 and has a sequence containing the amino acid sequence (HSTYSDDKLR) set forth in SEQ ID NO: 196.

[0232] These antibodies may be non-human antibodies and can be preferably humanized antibodies or human antibodies. For example, the antibody to be administered to a human is an antibody set forth in (xvii) and preferably a humanized antibody or a human antibody. The antibody to be used in in vitro tests may be a non-human antibody or may not have properties set forth in (xvii). These antibodies are preferably antibodies that do not substantially bind to a naturally occurring (in vivo) immunoglobulin. Also, these antibodies are preferably antibodies that do not substantially bind to a VH-L1-VL scFv. Also, these antibodies can be more preferably antibodies that do not substantially bind to a naturally occurring (in vivo) immunoglobulin or do not substantially bind to a VH-L1-VL scFv.

[0233] A VL-L.sub.1-VH scFv is an scFv containing a VL, a linker, and a VH in this order and the linker has the amino acid sequence of SEQ ID NO: 29. VH-L1-VL scFv is an scFv containing a VH, a linker, and a VL in this order and the linker has the amino acid sequence of SEQ ID NO: 29.

[0234] In the above (i), (iii), (v), and (vi), the amino acid sequences of CDRs can be those determined in accordance with, e.g., the Kabat numbering scheme, Chothia, AbM, contact, IMGT, Aho, or Martin (Enhanced Chothia), as mentioned above. In the above (ii), (iv), (xv-2), and (xvi-2), the amino acid sequences of CDRs can be those determined in accordance with, e.g., the Kabat numbering scheme. CDRs determined by the Kabat numbering scheme can be preferably used.

[0235] As the antibody of the present invention or an antigen-binding fragment thereof, an antibody or an antigen-binding fragment thereof having a mutation selected from an insertion, deletion, addition and substitution of one to several amino acids in the antibody of the present invention, can be included. In an embodiment, the present invention provides an antibody or an antigen-binding fragment thereof containing at least one, at least 2, at least 3 or more CDRs, which are substantially the same as at least 2, at least 3 or more CDRs of the antibody of the present invention or an antigen-binding fragment thereof. Another embodiment includes an antibody having at least 2, 3, 4, 5 or 6 CDRs, which are substantially the same as in at least 2, 3, 4, 5 or 6 CDRs in the antibody of the present invention or an antigen-binding fragment thereof, or derived from the antibody of the present invention or an antigen-binding fragment thereof. In an embodiment, at least 1, 2, 3, 4, 5, or 6 CDRs, which is at least about 85%, 86%, 87%, 88%, 89%, 90%, 95%, 96%, 97%, 98%, or 99% identical with at least 1, 2, or 3 CDRs in the antibody of the present invention or an antigen-binding fragment thereof, are included. In an embodiment, at least 1, 2, 3, 4, 5, or 6 CDRs contain at least one insertion, deletion, addition or substitution in at least 1, 2, 3, 4, 5, or 6 CDRs of the antibody of the present invention or an antigen-binding fragment thereof or derived from the antibody of the present invention or an antigen-binding fragment thereof. In the antibody of the present invention or an antigen-binding fragment thereof, an antibody or an antigen-binding fragment thereof having an amino acid sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more and an antigen specificity of the antibody, can be included. The antibody of the present invention or an antigen-binding fragment thereof may include an antibody or an antigen-binding fragment thereof having an amino acid sequence identity of 80% or more, 85% or more, 90% or more, or 95% or more in the region except for 6 CDRs and an antigen specificity of the antibody.

<Short-Chain Peptide of the Present Invention>

[0236] The present invention may provide an isolated short-chain peptide as mentioned above. The isolated short-chain peptide may have a 10 to 20 amino acid length, more specifically, a 13 to 20 amino acid length. The isolated short-chain peptide may have an amino acid sequence set forth in any one of, for example, SEQ ID NOs: 19 to 24 and 50 to 71. The term isolated herein refers to being separated from other regions of an scFv. The term short chain means that a chain has a length of, for example, at most 50 amino acids, preferably 30 amino acids or less, and more preferably 20 amino acids or less. In a preferable embodiment, in order to use immunogenicity of an scFv portion in the isolated short-chain peptide, the length of amino acid sequence of the scFv is 1 time or more, 1.1 times or more, 1.2 times or more, 1.3 times or more, 1.4 times or more, 1.5 times or more, 1.6 times or more, 1.7 times or more, 1.8 times or more, 1.9 times or more, 2.0 times or more, 2.1 times or more, 2.2 times or more, 2.3 times or more, 2.4 times or more, 2.5 times or more, 2.6 times or more, 2.7 times or more, 2.8 times or more, 2.9 times or more, or 3 times or more as long as than that of the linker portion.

<Method for Obtaining Antibody>

[0237] An antibody can be prepared by a method commonly known in the technical field. An antibody can be obtained, for example, by immunizing an animal (for example, a mouse, a rat, or a rabbit) with an isolated peptide as mentioned above. The immunogenicity of an isolated peptide can be enhanced by linking keyhole limpet hemocyanin (KHL) serving as a carrier protein to the peptide. If necessary, booster immunization can be carried out a plurality of times. A cell producing a monoclonal antibody can be obtained by taking an antibody-producing cell from a lymph tissue such as the spleen and lymph node. The cell producing a monoclonal antibody can be obtained by fusing the antibody-producing cell obtained and a myeloma cell to obtain a hybridoma and subjecting the hybridoma to single-cell cloning. A monoclonal antibody can be obtained as a culture supernatant of a hybridoma. The monoclonal antibody obtained can be subjected to a test (for example, ELISA) for examining reactivity to an antigen. The monoclonal antibody can be also subjected to a test (for example, ELISA) for examining reactivity to an scFv or an antigen-binding compound containing an scFv as an antigen binding site. The monoclonal antibody obtained can be also subjected to a test (for example, flow cytometry) for examining reactivity to a CAR-T cell. In this manner, an antibody satisfying at least one of the following (i) to (vi) can be selected or identified from the group of antibodies: [0238] (i) an antibody that binds to an isolated peptide having an amino acid sequence of a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, the isolated peptide having 13 to 20 amino acid length; [0239] (ii) an antibody that binds to an isolated peptide having an amino acid sequence of a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region, and the isolated peptide having 13 to 20 amino acid length; [0240] (iii) an antibody that binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24; [0241] (iv) an antibody that binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19 to 24 and 50 to 71; [0242] (v) an antibody that binds to a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region and a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker; and [0243] (vi) an antibody that binds to a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region.

[0244] In this manner, an antibody that binds to an scFv can be selected. In an embodiment, the group of antibodies can be a group of antibodies that bind to an scFv. In a preferable embodiment, the group of antibodies can be a group of antibodies that bind to any one of the isolated short-chain peptides mentioned above. In more preferable embodiment, the group of antibodies can be a group of antibodies that bind to any one of the isolated short-chain peptides mentioned above, not binding or binding only with low binding affinity to a linker portion (for example, whole length thereof).

[0245] In an embodiment, there is provided a method for selecting or identifying, from the group of antibodies, an antibody that competes, for binding to an scFv, with any one of [0246] (b-iii) an antibody containing a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 91 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 95; [0247] (b-iv) an antibody containing a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 99 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 103; [0248] (b-xi) an antibody containing a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 121 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 122; and [0249] (b-xii) an antibody containing a heavy-chain variable region having an amino acid sequence set forth in SEQ ID NO: 153 and a light-chain variable region having an amino acid sequence set forth in SEQ ID NO: 154, and that binds to an scFv.

[0250] In an embodiment, the group of antibodies can be, for example, a group of antibodies that bind to an scFv. In an embodiment, the group of antibodies can be a group of antibodies satisfying one or more selected from [0251] (i) an antibody that binds to an isolated peptide having an amino acid sequence of a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region, and a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker, the isolated peptide having 13 to 20 amino acid length; [0252] (ii) an antibody that binds to an isolated peptide having an amino acid sequence of a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region, the isolated peptide having 13 to 20 amino acid length; [0253] (iii) an antibody that binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24; [0254] (iv) an antibody that binds to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19 to 24 and 50 to 71; [0255] (v) an antibody that binds to a region present within the first region and having 1 to 10 amino acids from the C terminal of the first region and a partial region of a linker continuous with the region and having 1 to 10 amino acids from the N terminal of the linker; and [0256] (vi) an antibody that binds to a partial region of a linker continuous with the second region and having 1 to 10 amino acids from the C terminal of the linker, and a region present within the second region and having 1 to 10 amino acids from the N terminal of the second region, and
may further satisfy a condition of binding to an scFv.

[0257] In an embodiment, the group of antibodies can be a group of antibodies that (iii) bind to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19, 20, 23 and 24; or (iv) bind to an isolated peptide having an amino acid sequence set forth in any one of SEQ ID NOs: 19 to 24 and 50 to 71.

[0258] In an embodiment, the above antibody [0259] (vii) does not exhibit significant binding affinity for an scFv in which the order of a heavy-chain variable region and a light-chain variable region is interchanged.

[0260] In an embodiment, the above antibody [0261] (viii) exhibits significant binding affinity even for an scFv in which the order of the heavy-chain variable region and the light-chain variable region is interchanged.

[0262] The binding affinity of an antibody to a peptide or an scFv can be determined, for example, by a known method in the technical field such as ELISA. The fact that an antibody (vii) does not exhibit significant binding affinity for an scFv in which the order of a heavy-chain variable region and a light-chain variable region is interchanged, can be determined by applying ELISA to the scFv and its original scFv in which the order of a heavy-chain variable region and a light-chain variable region was not interchanged. The fact that an antibody does not bind or binds only with low binding affinity to a linker portion (for example, whole length thereof) can be determined by subjecting the peptide of the linker portion to ELISA and compared to the results of ELISA of any one of the above isolated peptides. As mentioned above, in this disclosure, an appropriate assay system employed based on the binding property, and an antibody can be selected by the appropriate assay system.

[0263] The nucleic acid sequences encoding a heavy-chain and a light-chain of the antibody selected or identified and the amino acid sequences thereof can be estimated. The nucleic acid sequences encoding a heavy-chain and a light-chain of the antibody can be estimated, for example, by obtaining mRNAs encoding the heavy-chain and the light-chain of the antibody from a cell producing the antibody, synthesizing cDNAs and determining the sequences of cDNA. Based on the nucleic acid sequences thus estimated, the amino acid sequences of the heavy-chain and the light-chain of the antibody can be estimated. Based on the amino acid sequences of a heavy-chain and a light-chain estimated, the amino acid sequences of a heavy-chain variable region and a light-chain variable region can be estimated. Based on the amino acid sequences of a heavy-chain variable region and a light-chain variable region thus estimated, amino acid sequences of heavy-chain CDR1 to 3 and light-chain CDR1 to 3 can be estimated. The antibody can be produced from an antibody-producing cell (for example, Chinese hamster ovary cell (CHO)) by a genetic recombination technology routinely used in the technical field. Accordingly, the method of the present invention may further include obtaining an antibody containing heavy-chain variable region containing heavy-chain CDR1 to 3 and light-chain variable region having light-chain CDR1 to 3 from an antibody-producing cell containing a gene encoding the identified antibody containing a heavy-chain variable region containing heavy-chain CDR1 to 3 and a light-chain variable region having light-chain CDR1 to 3 of the antibody identified.

<Method for Targeting or Detecting Cell>

[0264] The present invention provides a method for detecting a cell. The cell to be detected can be a cell expressing a chimeric antigen receptor (CAR) containing an scFv. In an embodiment, detection can be made using the antibody of the present invention. Specifically, the method of the present invention may include bringing the antibody of the present invention into contact with a cell that expresses or conceivably expresses a chimeric antigen receptor (CAR) containing an scFv to form a complex of the antibody and the cell. The complex can be detected using, e.g. a label attached to an antibody and detection can be made by flow cytometry.

[0265] According to the present invention, a cell expressing a chimeric antigen receptor (CAR) can be an immune cell. The immune cell can be preferably, a T cell or an NK cell. In a preferable embodiment, the T cell expressing a chimeric antigen receptor (CAR) can be a CAR-T cell.

[0266] The present invention provides a kit or test agent for detecting an scFv. According to an embodiment, the present invention can provide a kit or test agent containing the antibody of the present invention for detecting a cell expressing a chimeric antigen receptor (CAR) containing an scFv. The kit or test agent may contain a solution containing an antibody. The kit or test agent may contain a solution containing an antibody and reagents for detecting an scFv (for example, a labeled secondary antibody, a reaction buffer, a blocking liquid, and a washing liquid). The kit or test agent may contain a solution containing an antibody and an instruction for detecting an scFv.

[0267] In the present invention, an antigen of an scFv can be an antigen expressed on a cancer cell (for example, cancer antigen). The antigen of an scFv can be one or more selected from the group consisting of CD16, CD19, CD20, CD22, CD123, CD171, epidermal growth factor receptor (EGFR, particularly EGFRvIII, type-3 EGFR, de2-7EGFR and HER2), carcinoembryonic antigen (CEA), prostate stem cell antigen (PSCA), B cell maturation antigen (BCMA), CS1, NKG2D, NKp30, B7H6, MUC-16 (CA125), or phan receptors for receptor tyrosine kinases 1 (ROR-1), GD3, GM2, glypican-3 (GPC3), mesothelin, IL13R, c-KIT, c-MET, NY-ESO-1, WT1, MAGE-A3, MAGE-A4, MAGE-A10, E6 of HPV, E7 of HPV, CMV, AFP, PRAME, SSX2, KRAS, HER2, and PD-L1. The antigen of an scFv may be, for example, a protein tag. The antigen of an scFv can be, for example, a fluorescent protein such as fluorescein isothiocyanate (FITC).

[0268] In the present invention, a CAR-expressing cell can express a cytokine in addition to a CAR. The CAR-expressing cell may express, for example, interleukin-7 (IL-7) and CCL19. In a preferable embodiment, the CAR-expressing cell can be a CAR-expressing T cell. In the present invention, the CAR-expressing cell may contain a gene encoding thymidine kinase (for example, thymidine kinase of herpes simplex virus) for use in, e.g., removing cells. A cell expressing thymidine kinase takes up ganciclovir and phosphorylates it to induce strong toxicity, and then, it can kill the cell expressing thymidine kinase. A CAR-expressing cell can be removed or regulated by this mechanism.

[0269] The present invention provides a method for targeting a cell or an antibody in vitro or in vivo. The cell to be targeted can be a cell expressing a chimeric antigen receptor (CAR) containing an scFv. In an embodiment, targeting a cell is performed by using the antibody of the present invention. Specifically, the method of the present invention can be carried out in a subject administered with a cell expressing a chimeric antigen receptor (CAR) containing an scFv. The subject may have a cell expressing a chimeric antigen receptor (CAR) containing an scFv, within the body. Accordingly, the cell in the body of the subject can be targeted by administering the antibody of the present invention to the subject. The antibody of the present invention can regulate the function of the cell to be targeted. For example, the antibody of the present invention inhibits the binding between a CAR-T cell and a target antigen to impair the function of the CAR-T cell.

[0270] The antibody to be targeted may be an antibody containing one or more of the isolated single-chain peptides mentioned above and an scFv as a partial structure, or a fragment of the antibody. In an embodiment, an antibody can be targeted by use of the antibody of the present invention. Specifically, the method of the present invention can be carried out in a subject to which an antibody to be targeted is administered. It is possible to target an antibody or a fragment thereof containing one or more of the isolated single-chain peptides mentioned above and an scFv as a partial structure can be targeted by administering the antibody of the present invention to the subject. The antibody of the present invention can regulate the function of the antibody to be targeted. For example, the antibody of the present invention inhibits binding to the antibody to be targeted and an antigen thereof, thereby impairing the function of the antibody to be targeted.

[0271] When the antibody of the present invention is used for targeting a cell or an antibody, if a medicine or a reagent is linked to the antibody of the present invention, the medicine or reagent can be delivered to a target cell or a target antibody or a therapeutic target. Examples of the medicine and reagent to be linked to the antibody of the present invention include, but are not particularly limited to, a compound increasing or decreasing the function of the target cell or target antibody, itself (for example, cell activator), a compound therapeutically acting on a target cell or antibody, a compound detectably labeling a target cell or antibody or a therapeutic target of them.

[0272] The present invention provides an antibody formulation containing the antibody of the present invention for use in targeting a cell expressing a chimeric antigen receptor (CAR) containing an scFv in a subject to which the cell expressing the chimeric antigen receptor (CAR) containing an scFv is administered.

EXAMPLES

Example 1: Preparation of Antibody that Binds to Linker Region of scFv

[0273] In this Example, antibodies that bind to the linker region of an scFv was tried to be prepared. Specifically, in an scFv containing a first region, a linker region and a second region in the order shown in FIG. 1, an antibody against an isolated peptide positioned in the region covering the first region and the linker region was obtained. As the first region and the second region, a heavy-chain variable region (VH) and a light-chain variable region (VL) of an antibody were used, respectively, or a light-chain variable region (VL) and a heavy-chain variable region (VH) were used, respectively.

[0274] In the scFv, the first region and the second region, or the second region and the first region were designed based on the heavy-chain variable region (VH) and light-chain variable region (VL) of an isotype control IgG. As the linker, a linker having the amino acid sequence set forth in SEQ ID NO: 27 (GGGGSGGGGSGGGGS) or SEQ ID NO: 29 (SSADDAKKDAAKKDDAKKDDAKKDG) was used.

[0275] In the following experiment, VH-L.sub.1-VL indicates an scFv containing a VH, a linker, and a VL in this order and the linker has the scFv of SEQ ID NO: 29. VL-L.sub.1-VH indicates an scFv containing, a VL, a linker, and a VH in this order and the linker has the scFv of SEQ ID NO: 29. VH-L.sub.2-VL indicates an scFv containing, a VH, a linker, and VL in this order and the linker has the scFv of SEQ ID NO: 27. VL-L.sub.2-VH indicates an scFv containing a VL, a linker, and a VH in this order and the linker has the scFv of SEQ ID NO: 27.

[0276] It is not easy to obtain an antibody against a linker. According to US2019/0092818A, the amino acid sequence of a linker is modified in order to easily obtain an antibody, and then, an antibody that binds to the linker having the modified amino acid sequence is obtained. In this Example, it is intended to obtain a more versatile antibody by using an existing linker sequence as it is. For this purpose, an antibody was tried to be obtained by immunization with a polypeptide having the amino acid sequence of a part spanning the first region and the linker. Specifically, the sequence of a linker is linked to a sequence consisting of 4 or 5 amino acids on the C terminal side of the first region to obtain 4 types of peptides and individually synthesized. The sequences of the isolated peptides used as an immunogen are shown below.

TABLE-US-00009 [Formula1] Sequenceofpeptideusedasimmunogen Peptide1(SEQIDNO22): GGVTVSSGGGGSGC Peptide2(SEQIDNO71): GGLEIKGGGGSGC Peptide3(SEQIDNO21): GGVTVSSSSADDAKKC Peptide4(SEQIDNO70): GGLEIKSSADDAKKC

[0277] In peptides 1 and 3 in the above, the sequences of the regions consisting of 5 amino acids from the C terminal of a heavy-chain variable region are underlined. In peptides 2 and 4, the regions consisting of 4 amino acids from the C terminal of a light-chain variable region are underlined. In peptides 1 and 2, 6 amino acids on the N terminal side of a linker of SEQ ID NO: 27 are shown in italics. In the above peptides 3 and 4, 8 amino acids on the N terminal side of a linker of SEQ ID NO: 29 are shown in italics. In peptides 1 to 4, GG was added to the N terminal, and C was added to the C terminal. The N terminals of these amino acids were acetylated.

[0278] Peptides 1 to 4 were chemically synthesized, and thereafter, keyhole limpet hemocyanin (KHL) serving as a carrier protein was conjugated to each of the peptides via C added to the C terminal, in accordance with a common procedure. Rats were immunized with the obtained conjugates through the footpad and underwent booster immunization through the root of the tail. Lymphocytes were isolated from the iliac lymph nodes and subjected to cell fusion with myeloma cells. The resultant hybridoma cells were subjected to cloning. The cloning was carried out in accordance with the methylcellulose method by picking up a single colony. The obtained hybridoma cells were seeded in the wells of a 96 well plate and cultured while exchanging the medium in the middle. The culture supernatants of the individual clones were examined for binding to an scFv. The supernatants of the clones obtained by immunization with Peptide 1, Peptide 2, Peptide 3, and Peptide 4 were contacted with HEK293T cells temporarily expressing scFv (VH-L.sub.2-VL) plasmid (#530), scFv (VL-L.sub.2-VL) plasmid (#350), scFv (VH-L.sub.1-VL) plasmid (#602), and scFv (VL-L.sub.1-VH) plasmid (#231), respectively, to examine the presence or absence of binding. As a negative control, 293T cells not transfected with the above plasmids were used. As a positive control of an antibody for clones immunized with Peptides 1 to 3, biotinylated protein L was used, whereas FITC-DEX was used as the positive control for a clone immunized with Peptide 4.

[0279] From the antibodies produced by the hybridoma obtained by immunizing with Peptide 4, 2D12, 4B12, and 3A4 having particularly high binding affinity to an scFv were selected. The measurement results of the binding affinity were as shown in Table 3. In Table 3, higher numerical values mean stronger binding affinity.

TABLE-US-00010 TABLE 3 Results of screening using culture supernatant Positive (%) VH25VL Transfection Name of clone (#602) () 2D12 78.8 3.9 3A4 86.1 46.9 4B12 76.6 4.4 Biotin-Protein L 49.8 3.1 Primary antibody () 1.6 0.7 PE-anti-rat antibody (+) * VH-L.sub.1-VL is scFv having VH, linker and VL linked in this order

[0280] As mentioned above, antibodies that bind to an scFv were able to be obtained using an isolated peptide designed in the border region between the first region and a linker, as an immunogen. The antibodies bind to an isolated peptide (Peptide 3) used as an immunogen and, needless to say, bind to an scFv.

[0281] Clones 2D12, 4B12, and 3A4 selected were subjected to single-cell cloning and the reactivity to an scFv was confirmed once again.

TABLE-US-00011 TABLE 4 Results of screening after single-cell cloning Derived from 2012 Positive (%) Clone name VH25VL(#602) Transfection() 2D12-A1 55.7 0.3 2D12-A2 45.2 0.5 2D12-A3 45.0 0.4 2D12-A4 42.6 0.2 2D12-A5 43.text missing or illegible when filed 0.2 2D12-A6 44.0 0.1 2D12-A7 34.5 0.3 2D12-A8 42.5 0.2 2D12-A9 34.1 0.2 2D12-A10 text missing or illegible when filed .4 0.1 2D12-A11 43.text missing or illegible when filed 0.2 2D12-A12 27.text missing or illegible when filed 0.text missing or illegible when filed 2D12-B1 52.4 0.1 2D12-B2 39.2 0.1 2D12-B3 57.2 0.3 2D12-B4 42.2 0.3 2D12-B5 4text missing or illegible when filed .5 0.1 2D12-B6 text missing or illegible when filed .0 0.2 2D12-B7 text missing or illegible when filed 0.2 2D12-B8 39.1 0.2 2D12-B9 35.6 0.2 2D12-B10 51.6 0.2 2D12-B11 text missing or illegible when filed 2.1 0.3 2D12-B12 text missing or illegible when filed 0.3 2D12-C1 47.5 0.3 2D12-C2 33.8 0.2 2D12-C3 44.4 0.3 2D12-C4 53.4 0.2 2D12-C5 50.2 0.text missing or illegible when filed 2D12-C6 41.7 0.4 2D12-C7 40.6 0.3 2D12-C8 40.2 0.4 2D12-C9 27.1 0.2 2D12-C10 45.9 0.3 2D12-C11 46.7 0.1 2D12-C12 47.0 0.0 2D12-D1 55.9 0.4 2D12-D2 43.4 0.5 2D12-D3 44.text missing or illegible when filed 0.4 2D12-D5 48.0 0.text missing or illegible when filed 2D12-D6 text missing or illegible when filed 0.text missing or illegible when filed 2D12-D7 38.6 0.2 2D12-D8 43.4 0.2 2D12-D9 31.text missing or illegible when filed 0.1 2D12-D10 text missing or illegible when filed 7.7 0.text missing or illegible when filed 2D12-D11 31.2 0.2 2D12-D12 44.7 0.text missing or illegible when filed Derived from 304 Positive (%) Clone name VH25VL(#602) Transfection() 3A4-A19 53.1 0.4 3A4-B11 31.4 0.2 3A4-D11 20.1 0.1 3A4-H11 text missing or illegible when filed 4.3 0.1 Derived from 4612 Positive (%) Clone name VH25VL(#602) Transfection() 4B12-C1 31.3 0.2 4B12-C2 38.4 0.1 4B12-D4 24.4 0.2 text missing or illegible when filed indicates data missing or illegible when filed

[0282] D10, B3, B12, A10, and D6 were obtained from 2D12 by single-cell cloning. A10, H11, B11, and D11 were obtained from 3A4 by single-cell cloning. C5, C4, and D4 were obtained from 4B12. These clones all produced antibodies that bind to an scFv, as shown in Table 4. The reactivities of the antibodies produced from these clones with CAR-T cells containing scFvs (VH-L.sub.1-VL and VH-L.sub.2-VL) were examined. The CARs used herein bind mutually different antigens.

[0283] The CARs used herein were as listed in Table 5.

TABLE-US-00012 TABLE 5 CAR-T cells used for examining reactivity with linker-antibody No. Form Structure of CAR-T S#067 VL-L.sub.1-VH Human 2nd-generation (4-1BB) _hIL7_hCCL19_HSVtk S#075 VL-L.sub.1-VH Human 2nd-generation (4-1BB) _hIL7_hCCL19_HSVtk #231 VL-L.sub.1-VH Human 3rd-generation S#031 VH-L.sub.1-VL Human 3rd-generation_hIL7_hCCL19_HSVtk #673 VH-L.sub.1-VL Human 3rd-generation S#017 VH-L.sub.2-VL Human 3rd-generation_hIL7_hCCL19_HSVtk #530 VH-L.sub.2-VL Human 3rd-generation

[0284] The human second generation (4-1BB) herein refers to a molecule in which an scFv region, a CD8 transmembrane domain, 4-1BB domain and CD3 domain, all derived from human, are linked in this order. The human third generation herein refers to a molecule in which an scFv region, a CD8 transmembrane domain, CD28 domain, 4-1BB domain and CD3 domain, all derived from human, are linked in this order. hIL7_hCCL19_HSVtk indicates a cell expressing human IL-17 and human CCL19 and having thymidine kinase gene of a herpes simplex virus as a suicide gene. The suicide gene is activated by ganciclovir to kill or damage CAR expressing cells.

[0285] The C terminal sequences of the first-region of an scFv region that CAR-T shown in Table 5 has (the region closer to the C terminal than CDR3) are listed in Table 6.

TABLE-US-00013 TABLE6 C-terminalaminoacidsequenceofthefirst regionofscFvregionthatCAR-Thas No. Aminoacidsequence SEQIDNO: S#067 FGGGTKLEIK 72 S#075 FGGGTKVEIK 73 #231 FGGGTKLEIK 74 S#031 GQGTTVTVSS 75 #673 GQGTLVTVSA 76 S#017 WGQGTTLTVS 77 #530 GQGTLVTVSS 78

[0286] The results were as shown in FIG. 2. As shown in FIG. 2, clones B3, B12 and A10 derived from 2D12 and clone A10 derived from 3A4 exhibited reactivity to CAR-T cell (S #031) containing a VH-L.sub.1-VL scFv to antigen D. These clones exhibited reactivity even to CAR-T cell (#673) containing a VH-L.sub.1-VL scFv to antigen E. Note that, none of the antibodies exhibited significant binding affinity for VH-L.sub.2-VL scFvs (negative control, #530) having a linker having a different amino acid sequence. From the results, it was considered that each of the obtained antibodies may bind to a linker or a boundary region between a VH and the linker.

[0287] Furthermore, the reactivity between the antibodies produced by the clones mentioned above and CAR-T cells (S #067, S #075, and #231) containing different VL-L.sub.1-VH scFvs, was examined. The results were as shown in FIG. 3. As shown in FIG. 3, all clones exhibited reactivity to a VL-L.sub.1-VH scFv and CAR-T cells containing this. Further, 3A4-A10 was further subjected to single cloning to obtain three clones. The binding abilities of them to CAR-T cells expressing an scFv were evaluated. The results are shown in FIG. 4. All of the clones sufficiently bound to a VH-L.sub.1-VL scFv but did not show a significant reactivity to the CAR-T cells containing the VH-L.sub.2-VL scFv. From these results, it was considered that the obtained antibodies principally bind to a linker.

[0288] The binding ability of the antibody obtained by immunization with Peptide 4 to a VL-L.sub.1-VH scFv was examined. From the obtained antibodies produced by hybridomas, 1H5, 2C7, 3E7, and 4B9 exhibiting particularly high binding affinity to an scFv, were selected. The measurement results of binding affinity were shown in Table 7. In Table 7, higher numerical values mean stronger binding affinity.

TABLE-US-00014 TABLE 7 Results of screening using culture supernatant Positive (%) VL25VH Transfection Name of clone (#231) () 1H5 52.30 0.21 2C7 47.60 0.24 3E7 53.90 0.24 4B9 53.80 0.24 FITC-DEX 48.90 0.74 Primary antibody () 0.23 0.22 PE-anti-rat antibody (+)

[0289] Using isolated peptides designed in the boundary region between a first region and a linker as immunogens, antibodies that bind to an scFv were obtained. These antibodies bind to an isolated peptide (Peptide 4) used as an immunogen and, needless to say, bind even to an scFv.

[0290] Table 8 shows the reactivities to an scFv of 3E7 and 4B9 after single-cell cloning.

TABLE-US-00015 TABLE 8 Results of screening after single-cell cloning Derived from 3E7text missing or illegible when filed Positive (%) Name of clone VL25VH(#231 Transfection() 3E7-C1 24.5 0.3 Derived from 4B9text missing or illegible when filed Positive (%) Name of clone VL25VH(#231 Transfection() 4B9-A6 59.0 0.2 4B9-B11 60.0 0.5 4B9-C6 59.2 0.3 4B9-C7 59.7 0.3 4B9-F3 59.4 0.8 4B9-F5 59.1 0.3 4B9-E12 59.0 0.4 4B9-G6 59.0 0.3 text missing or illegible when filed indicates data missing or illegible when filed

[0291] The representative results are shown in FIG. 5. As shown in FIG. 5, the clones examined above exhibited binding ability to a CAR having a VL-L.sub.1-VH scFv, whereas the binding ability of them to a CAR having a VH-L.sub.1-VL scFv was only low. From this, it was considered that these clones bind to a region spanning from a first region to a linker.

[0292] Table 9 shows the reactivities (%) of individual clones to the CAR of individual CAR-T cells. The reactivity was confirmed by detecting the antibody bound to a CAR by a PE-labeled secondary antibody. The reactivity was calculated as the ratio of the number of PE-positive cells to the total number of cells.

TABLE-US-00016 TABLE 9 Reactivity (%) of antibody Anti-VL-L.sub.1-VH Anti-VH-L.sub.1-VL scFv antibody scFv antibody 3E7-C1 4B9-B11 2D12-B12 3A4-A10-7 VL-L.sub.1-VH CAR-T S#067 41.0 41.5 34.9 22.3 S#075 25.9 35.7 15.0 12.3 S#104 21.5 29.1 13.4 5.2 #231 69.6 74.6 67.4 23.9 S#085 41.4 49.6 0.8 2.2 VH-L.sub.1-VL CAR-T S#050 0.1 1.1 14.5 18.5 S#027 0.0 1.0 28.4 45.7 S#031 2.2 9.7 64.6 45.3 #264 0.0 0.0 11.1 36.7 VL-L.sub.2-VH CAR-T #371 0.0 0.1 0.2 0.2 S#066 0.1 0.1 0.9 0.2 S#084 0.0 0.1 0.3 0.1 S#074 0.1 1.4 0.8 0.2 S#097 0.0 0.1 0.3 0.1 VH-L.sub.2-VL CAR-T S#076 0.1 0.2 0.2 0.2 #628 0.0 0.2 0.2 0.1 S#017 0.0 0.0 0.0 0.0 #651 0.1 0.2 0.4 0.2

[0293] With respect to CAR-Ts shown in Table 9 but not shown in Table 6, the sequences of the C terminal (the region closer to the C terminal than CDR3) of the first regions of scFv regions that the CAR-Ts have, are shown in Table 10.

TABLE-US-00017 TABLE10 No. Aminoacidsequence SEQIDNO: S#104 FGGGTKVEIK 107 S#085 FGGGTKLEIK 108 S#050 GQGTLVTVSS 109 $#027 GAGTTVTVSS 110 #264 GQGTLVTVSA 111 #371 FGGGTKVEIK 112 $#066 FGGGTKLEIK 113 S#084 FGGGTKLEIK 114 S#074 FGGGTKLEIK 115 S#097 FGGGTKVEIK 116 S#076 GQGTLVTVSS 117 #628 GQGTTVTVSSGILGS 118 #651 GQGTLVTVSS 119

[0294] As shown in Table 9, (i) a monoclonal antibody prepared against an invariable region of an scFv variable region and a linker was able to bind to the scFv, regardless of the amino acid sequences of the CDR regions of the scFv. Accordingly, the monoclonal antibody prepared can be an antibody that can detect a wide variety of scFvs having the same sequence regardless of the amino acid sequences of the CDR regions of the scFv. Furthermore, as shown in Table 9, (ii) 3E7-C1 and 4B9-B11 clones bound to VL-L.sub.1-VH but not to an scFv in which the arrangement of VH and VL is interchanged. This result means that these antibodies bind to the region spanning from VH/VL to the linker. Such an antibody can be an antibody detecting a wide variety of scFvs having the same sequence regardless of the amino acid sequences of the CDR regions of the scFv. Antibodies that compete with these antibodies for binding to the same site can be an antibody for detecting a wide variety of scFvs having the same sequence regardless of the amino acid sequences of the CDR regions of the scFv. Furthermore, these antibodies that bind to the region spanning VH/VL and a linker can be useful since they specifically detect the expression of a desired CAR without non-specifically detecting immunoglobulins in a system.

[0295] In contrast, 2D12-B12 and 3A4-A10.sup.7 clones bound to an scFv in which the arrangement of VH and VL is interchanged, but not to an scFv in which the linker is replaced with another linker. This result shows that these clones are antibodies that bind to principally to a linker. It is not easy to obtain an antibody that binds to a linker. However, in the present invention, it was suggested that an antibody binding principally to the linker was successfully and efficiently obtained by using a fusion peptide with a partial peptide VH/VL to improve immunogenicity of a linker portion. Such an antibody can detect a wide variety of scFvs regardless of the amino acid sequences of CDR regions of the scFv and the order of VH and VL.

[0296] Accordingly, it was demonstrated that the antibody of the present invention is useful in that the antibody can detect an scFv and a CAR-expressing cell containing an scFv, regardless of the amino acid sequences of CDR regions of the scFv (regardless of the antigen).

[0297] Moreover, according to Table 9, antibodies against VH-L.sub.1-VL and VL-L.sub.1-VH scFvs showed little reactivity to VH-L.sub.2-VL and VL-L.sub.2-VH scFvs having a different linker. In contrast, the antibody prepared against a VL-L.sub.1-VH scFv showed strong reactivity to CAR-T cells expressing CAR having the VL-L.sub.1-VH scFv. Also, the antibody prepared against a VH-L.sub.1-VL scFv showed strong reactivity to CAR-T cells expressing CAR having the VH-L.sub.1-VL scFv.

[0298] Based on the fact that the antibody against a VL-L.sub.1-VH scFv showed little reactivity to a VH-L.sub.1-VL scFv, it is considered that the antibody is not an antibody binding only to a linker or a VL, but to a linking part of the VL and the linker (particularly, to the region spanning from the VL and the linker). As mentioned above, if a linking part of a linker and a VH or a VL is used as an immunogen, it is possible to obtain an antibody against the linking part (or an antibody that binds to a region spanning from a VL and the linker). The antibody against such a linking part showed significant reactivity to a wide variety of scFvs. Furthermore, an antibody that binds to a VH part or a VL part and an antibody that binds to a linker can be useful.

[0299] cDNA was synthesized from mRNA encoding a heavy-chain variable region and a light-chain variable region of 2D12-B12 antibody and the amino acid sequences of a heavy-chain variable region and a light-chain variable region were estimated. As a result, it was estimated that the heavy-chain variable region has the amino acid sequence of SEQ ID NO: 91 and the light-chain variable region has the amino acid sequence of SEQ ID NO: 95. The amino acid sequences of heavy-chain CDR1 to 3 (HCDR1 to 3) and light-chain CDR1 to 3 (LCDR1 to 3) were estimated by the Kabat numbering scheme (Kabat, E. A. et al., Sequences of Proteins of Immunological Interest, 5th ed., 1991, Bethesda: US Dept. of Health and Human Services, PHS, NIH.). As a result, HCDR1 to 3 were estimated to have the amino acid sequence of SEQ ID NOs: 92 to 94 and LCDR1 to 3 have the amino acid sequence of SEQ ID NO: 96 to 98.

[0300] cDNA was synthesized from mRNA encoding a heavy-chain variable region and a light-chain variable region of 3A4-A10-7 and the amino acid sequences of the heavy-chain variable region and the light-chain variable region were estimated. As a result, it was estimated that the heavy-chain variable region has the amino acid sequence of SEQ ID NO: 99 and the light-chain variable region has the amino acid sequence of SEQ ID NO: 103. The amino acid sequences of heavy-chain CDR1 to 3 (HCDR1 to 3) and light-chain CDR1 to 3 (LCDR1 to 3) were estimated by the Kabat numbering scheme. As a result, HCDR1 to 3 were estimated to have the amino acid sequence of SEQ ID NOs: 100 to 102 and LCDR1 to 3 have the amino acid sequence of SEQ ID NO: 104 to 106.

[0301] cDNA was synthesized from mRNA encoding a heavy-chain variable region and a light-chain variable region of 3E7-C1 and the amino acid sequences of the heavy-chain variable region and the light-chain variable region were estimated. As a result, it was estimated that the heavy-chain variable region has the amino acid sequence of SEQ ID NO: 121 and the light-chain variable region has the amino acid sequence of SEQ ID NO: 122. When the amino acid sequences of heavy-chain CDR1 to 3 (HCDR1 to 3) and light-chain CDR1 to 3 (LCDR1 to 3) were estimated, HCDR1 to 3 and LCDR1 to 3 were estimated to have the amino acid sequences of SEQ ID NOs: 123 to 125 and SEQ ID NOs: 126 to 128, respectively according to IMGT; SEQ ID NOs: 129 to 131 and SEQ ID NOs: 132 to 134, respectively according to Kabat; SEQ ID NOs: 135 to 137 and SEQ ID NOs: 138 to 140, respectively according to Chothia; SEQ ID NOs: 141 to 143 and SEQ ID NOs: 144 to 146, respectively according to Contact; and SEQ ID NOs: 147 to 149 and SEQ ID NOs: 150 to 152 respectively according to AbM. Any one of the sets of HCDR1 to 3 and LCDR1 to 3 can be estimated as the CDRs of 3E7-C1. Those skilled in the art can appropriately select CDRs to prepare an antibody having a similar binding property as in 3E7-C1. For example, an antibody having a similar binding property as in 3E7-C1 can be prepared based on the Kabat numbering scheme.

[0302] cDNA was synthesized from mRNA encoding a heavy-chain variable region and a light-chain variable region of 4B9-B11 and the amino acid sequences of a heavy-chain variable region and a light-chain variable region were estimated. As a result, it was estimated that the heavy-chain variable region has the amino acid sequence of SEQ ID NO: 153 and the light-chain variable region has the amino acid sequence of SEQ ID NO: 154.

When the amino acid sequences of heavy-chain CDR1 to 3 (HCDR1 to 3) and light-chain CDR1 to 3 (LCDR1 to 3) were estimated, HCDR1 to 3 and LCDR1 to 3 are estimated to have the amino acid sequences of SEQ ID NOs: 155 to 157 and SEQ ID NOs: 158 to 160, respectively according to IMGT; SEQ ID NOs: 161 to 163 and SEQ ID NOs: 164 to 166, respectively according to Kabat; SEQ ID NOs: 167 to 169 and SEQ ID NOs: 170 to 172, respectively according to Chothia; SEQ ID NOs: 173 to 175 and SEQ ID NOs: 176 to 178, respectively according to Contact; and SEQ ID NOs: 179 to 181 and SEQ ID NOs: 182 to 184, respectively according to AbM. Any one of the sets of HCDR1 to 3 and LCDR1 to 3 can be estimated as CDRs of 4B9-B11. Those skilled in the art can appropriately select CDRs to prepare an antibody having a similar binding property as in 4B9-B11. For example, an antibody having a similar binding property as in 4B9-B11 can be prepared based on the Kabat numbering scheme.

TABLE-US-00018 TABLE11 Sequencelisting SEQ ID NO: Sequence Content 1 WGQGTLVTVSS C-terminalfromHCDR3 2 WGQGTLVTVSS C-terminalfromHCDR3 3 WGQGTLVTVSS C-terminalfromHCDR3 4 WGQGTTLTVS C-terminalfromHCDR3 5 WGQGTTVTVSSGILGS C-terminalfromHCDR3 6 VTVSS ApartofC-terminalfrom HCDR3 7 FGGGTKLEIK C-terminalfromLCDR3 8 FGAGTKLELKR C-terminalfromLCDR3 9 FGGGTQLTVLS C-terminalfromLCDR3 10 KLEIK ApartofC-terminalfrom LCDR3 11 LELKR ApartofC-terminalfrom LCDR3 12 LTVLS ApartofC-terminalfrom LCDR3 13 GGGGS Apartoflinker 14 GGGGSG Apartoflinker 15 SSADD Apartoflinker 16 SSADDA Apartoflinker 17 SSADDAK Apartoflinker 18 SSADDAKK Apartoflinker 19 VTVSSSSADDAKK Anantigenpeptide 20 VTVSSGGGGSG Anantigenpeptide 21 GGVTVSSSSADDAKKC Anantigenpeptide 22 GGVTVSSGGGGSGC Anantigenpeptide 23 LEIKSSADDAKK Anantigenpeptide 24 LEIKGGGGSG Anantigenpeptide 25 GGGGSGGGGS Anexampleoflinkers 26 GGGGSGGGGSGGGGS Anexampleoflinkers 27 GGGGSGGGGSGGGGSGGGGS Anexampleoflinkers 28 GGGGSGGGGSGGGGSGGGGSGGGGS Anexampleoflinkers 29 SSADDAKKDAAKKDDAKKDDAKKDG Anexampleoflinkers 30 QVTLKESGPA ApartofN-terminalfrom HCDR1 31 QVQLVQSGAE ApartofN-terminalfrom HCDR1 32 EVQLVQSGAE ApartofN-terminalfrom HCDR1 33 SQVQLKESGP ApartofN-terminalfrom HCDR1 34 QVQLQQSGPG ApartofN-terminalfrom HCDR1 35 DIVMTQSPLS ApartofN-terminalfrom LCDR1 36 DIVMTQSPDS ApartofN-terminalfrom LCDR1 37 DIQLTQSPSS ApartofN-terminalfrom LCDR1 38 DIQMTQSPKF ApartofN-terminalfrom LCDR1 39 QPVLTQSSSL ApartofN-terminalfrom LCDR1 40 SGGGGS Ac-terminalpartofalinker 41 AKKDG Ac-terminalpartofalinker 42 DAKKDG Ac-terminalpartofalinker 43 DDAKKDG Ac-terminalpartofalinker 44 KDDAKKDG Ac-terminalpartofalinker 45 DXXXT ApartofN-terminalfrom LCDR1 46 DIVMT ApartofN-terminalfrom LCDR1 47 DIQLT ApartofN-terminalfrom LCDR1 48 DIQMT ApartofN-terminalfrom LCDR1 49 QPVLT ApartofN-terminalfrom LCDR1 50 KDDAKKDGQVTLK Anantigenpeptide 51 KDDAKKDGQVQLV Anantigenpeptide 52 KDDAKKDGEVQLV Anantigenpeptide 53 KDDAKKDGSQVQL Anantigenpeptide 54 KDDAKKDGQVQLQ Anantigenpeptide 55 SGGGGSQVTLK Anantigenpeptide 56 SGGGGSQVQLV Anantigenpeptide 57 SGGGGSEVQLV Anantigenpeptide 58 SGGGGSSQVQL Anantigenpeptide 59 SGGGGSQVQLQ Anantigenpeptide 60 GGKDDAKKDGQVTLKC Anantigenpeptide 61 GGKDDAKKDGQVQLVC Anantigenpeptide 62 GGKDDAKKDGEVQLVC Anantigenpeptide 63 GGKDDAKKDGSQVQLC Anantigenpeptide 64 GGKDDAKKDGQVQLQC Anantigenpeptide 65 GGSGGGGSQVTLKC Anantigenpeptide 66 GGSGGGGSQVQLVC Anantigenpeptide 67 GGSGGGGSEVQLVC Anantigenpeptide 68 GGSGGGGSSQVQLC Anantigenpeptide 69 GGSGGGGSQVQLQC Anantigenpeptide 70 GGLEIKSSADDAKKC Anantigenpeptide 71 GGLEIKGGGGSGC Anantigenpeptide 72 FGGGTKLEIK C-terminaltenaminoacidsin 73 FGGGTKVEIK thefirstregionintheCARin 74 FGGGTKLEIK theExamples 75 GQGTTVTVSS 76 GQGTLVTVSA 77 WGQGTTLTVS 78 GQGTLVTVSS 79 TLTVS ApartofC-terminalfrom HCDR3 80 GILGS ApartofC-terminalfrom HCDR3 81 FGGGTKVEIK C-terminalfromLCDR3 82 KVEIK ApartofC-terminalfrom LCDR3 83 KDDAKKDGDIVMT Anantigenpeptide 84 KDDAKKDGDIQLT Anantigenpeptide 85 KDDAKKDGDIQMT Anantigenpeptide 86 KDDAKKDGQPVLT Anantigenpeptide 87 SGGGGSDIVMT Anantigenpeptide 88 SGGGGSDIQLT Anantigenpeptide 89 SGGGGSDIQMT Anantigenpeptide 90 SGGGGSQPVLT Anantigenpeptide 91 EVKLVESGGGLVQPGRSLKLSCAASGFN 2D12-B12,VH FNDYWMGWVRQAPGKGLEWIGEIKKD SSIINYIPSLKDKFTISRDNAQNTLYLQMS KLGSEDTAIYYCARGVEYYGYHYWGQG TLVTVSS 92 GFNFNDYWMG 2D12-B12,HCDR1 93 EIKKDSSIINYIPSLKD 2D12-B12,HCDR2 94 GVEYYGYHY 2D12-B12,HCDR3 95 DIVMTQSPSSLAVSAGETVTINCKSSQSL 2D12-B12,VL LYSGNQKNYLAWYQQKPGQSPKLLIYW ASTRHSGVPARFIGSGSGSDFTLTISSVQ AEDLAIYCCQQYYDIPYTFGAGTKLELK 96 KSSQSLLYSGNQKNYLA 2D12-B12,LCDR1 97 WASTRHS 2D12-B12,LCDR2 98 QQYYDIPYT 2D12-B12,LCDR3 99 QVQLQQSGAALVKPGASVKMSCKASGY 3A4-A10-7,VH TFTDCWVSWVKQSHGKSLEWIGEIHPN SGTTNFNEKFKGKATLTVDKSTSTAYM ELSRLTSEDSAIYYCTRAYGGYPFDYWG QGVMVTVSS 100 GYTFTDCWVS 3A4-A10-7,HCDR1 101 EIHPNSGTTNFNEKFKG 3A4-A10-7,HCDR2 102 AYGGYPFDY 3A4-A10-7,HCDR3 103 GAPFAFLHHLTGSCADLVLTQPKSVSTS 3A4-A10-7,VL LESTVKLSCKLNSGNIGRYYMHWYQQHE GRSPTNMIYRDDKRPDGVPDRFSGSIDS SSNSAFLTINNVQTEDEAIYFCHSYDSSI NIFGGGTKLTVLGQPK 104 KLNSGNIGRYYMH 3A4-A10-7,LCDR1 105 RDDKRPD 3A4-A10-7,LCDR2 106 HSYDSSINI 3A4-A10-7,LCDR3 107 FGGGTKVEIK C-terminalfromCDR3inthe 108 FGGGTKLEIK FirstRegion 109 GQGTLVTVSS 110 GAGTTVTVSS 111 GQGTLVTVSA 112 FGGGTKVEIK 113 FGGGTKLEIK 114 FGGGTKLEIK 115 FGGGTKLEIK 116 FGGGTKVEIK 117 GQGTLVTVSS 118 GQGTTVTVSSGILGS 119 GQGTLVTVSS 120 VTVSA ApartofC-terminalfrom HCDR3 121 QVQMKESGPGLVQPSETLSLTCTVSGFSL 3E7-C1VHaminoacidsequence TSYGVSWVRQPSGKGPEWMGRLWNDGD TAYNSALKSRLSISRDTSKNQVFLKMNSLQ TDDTGTYYCTTMNGYKDYWGQGVMVT VSS 122 AWTSLLLPLLSLYAGSVTSYELIQPPSASVT 3E7-C1VLaminoacidsequence LGNTVSLTCVGDELPKRYAYWYQQKPDQ SIVRVIYEDSKRPSGISDRFSGSSSGTTATLT IRDAQAEDEADYYCHSTYSDDKLRIFGGG TKLTVLG 123 GFSLTSYG HCDR1of3E7-C1predictedbyIMGT 124 LWNDGDT HCDR2of3E7-C1predictedbyIMGT 125 TTMNGYKDY HCDR3of3E7-C1predictedbyIMGT 126 ELPKRY LCDR1of3E7-C1predictedbyIMGT 127 EDS LCDR2of3E7-C1predictedbyIMGT 128 HSTYSDDKLRI LCDR3of3E7-C1predictedbyIMGT 129 TSYGVS HCDR1of3E7-C1predictedbyKabat 130 RLWNDGDTAYNSALKS HCDR2of3E7-C1predictedbyKabat 131 MNGYKDY HCDR3of3E7-C1predictedbyKabat 132 VGDELPKRYAY LCDR1of3E7-C1predictedbyKabat 133 EDSKRPS LCDR2of3E7-C1predictedbyKabat 134 HSTYSDDKLRI LCDR3of3E7-C1predictedbyKabat 135 GFSLISY HCDR1of3E7-C1predictedby Chothia 136 WNDGD HCDR2of3E7-C1predictedby Chothia 137 MNGYKDY HCDR3of3E7-C1predictedby Chothia 138 VGDELPKRYAY LCDR1of3E7-C1predictedbyChothia 139 EDSKRPS LCDR2of3E7-C1predictedbyChothia 140 HSTYSDDKLRI LCDR3of3E7-C1predictedbyChothia 141 TSYGVS HCDR1of3E7-C1predictedby Contact 142 WMGRLWNDGDTA HCDR2of3E7-C1predictedby Contact 143 TTMNGYKD HCDR3of3E7-C1predictedby Contact 144 KRYAYWY LCDR1of3E7-C1predictedbyContact 145 RVIYEDSKRP LCDR2of3E7-C1predictedbyContact 146 HSTYSDDKLR LCDR3of3E7-C1predictedbyContact 147 GFSLTSYGVS HCDR1of3E7-C1predictedbyAbM 148 RLWNDGDTA HCDR2of3E7-C1predictedbyAbM 149 MNGYKDY HCDR3of3E7-C1predictedbyAbM 150 VGDELPKRYAY LCDR1of3E7-C1predictedbyAbM 151 EDSKRPS LCDR2of3E7-C1predictedbyAbM 152 HSTYSDDKLRI LCDR3of3E7-C1predictedbyAbM 153 QMQLKESGPGLVQPSETLSLTCTVSGF 4B9-B11VHaminoacidsequence SLTSYSVSWVRQPSGKGPEWMGRMYY DGDTAYNSALKSRLSISRDTSKNQVFL KMNSLQTDDTGTYYCTRSIGAEDYW GQGVMVTVSS 154 AWTSLLLPLLSLYAGSVTSYELIQPPSA 4B9-B11VLaminoacidsequence SVTLGNTVSLTCVGDELPKRYAYWYQ QKPDQSIVRVIYEDSKRPSGISDRFSGS SSGTTATLTIRDAQNEDEADYYCHSTY SDDKLRIFGGGTKLTVLG 155 GFSLTSYS HCDR1of4B9-B11predictedby IMGT 156 MYYDGDT HCDR2of4B9-B11predictedby IMGT 157 TRSIGAEDY HCDR3of4B9-B11predictedby IMGT 158 ELPKRY LCDR1of4B9-B11predictedbyIMGT 159 EDS LCDR2of4B9-B11predictedbyIMGT 160 HSTYSDDKLRI LCDR3of4B9-B11predictedbyIMGT 161 TSYSVS HCDR1of4B9-B11predictedbyKabat 162 RMYYDGDTAYNSALKS HCDR2of4B9-B11predictedbyKabat 163 SIGAEDY HCDR3of4B9-B11predictedbyKabat 164 VGDELPKRYAY LCDR1of4B9-B11predictedbyKabat 165 EDSKRPS LCDR2of4B9-B11predictedbyKabat 166 HSTYSDDKLRI LCDR3of4B9-B11predictedbyKabat 167 GFSLTSY HCDR1of4B9-B11predictedby Chothia 168 YYDGD HCDR2of4B9-B11predictedby Chothia 169 SIGAEDY HCDR3of4B9-B11predictedby Chothia 170 VGDELPKRYAY LCDR1of4B9-B11predictedby Chothia 171 EDSKRPS LCDR2of4B9-B11predictedby Chothia 172 HSTYSDDKLRI LCDR3of4B9-B11predictedby Chothia 173 TSYSVS HCDR1of4B9-B11predictedby Contact 174 WMGRMYYDGDTA HCDR2of4B9-B11predictedby Contact 175 TRSIGAED HCDR3of4B9-B11predictedby Contact 176 KRYAYWY LCDR1of4B9-B11predictedby Contact 177 RVIYEDSKRP LCDR2of4B9-B11predictedby Contact 178 HSTYSDDKLR LCDR3of4B9-B11predictedby Contact 179 GFSLTSYS HCDR1of4B9-B11predictedbyAbM 180 RMYYDGDTA HCDR2of4B9-B11predictedbyAbM 181 SIGAEDY HCDR3of4B9-B11predictedbyAbM 182 VGDELPKRYAY LCDR1of4B9-B11predictedbyAbM 183 EDSKRPS LCDR2of4B9-B11predictedbyAbM 184 HSTYSDDKLRI LCDR3of4B9-B11predictedbyAbM 185 TSY HCDR1of3E7-C1consensus 186 WNDGD HCDR2of3E7-C1consensus 187 MNGYKD HCDR3of3E7-C1consensus 188 KRY LCDR1of3E7-C1consensus 189 EDS LCDR2of3E7-C1consensus 190 HSTYSDDKLR LCDR3of3E7-C1consensus 191 TSY HCDR1of4B9-B11consensus 192 YYDGD HCDR2of4B9-B11consensus 193 SIGAED HCDR3of4B9-B11consensus 194 KRY LCDR1of4B9-B11consensus 195 EDS LCDR2of4B9-B11consensus 196 HSTYSDDKLR LCDR3of4B9-B11consensus