T cell receptors with mage-B2 specificity and uses thereof
12202877 ยท 2025-01-21
Assignee
Inventors
Cpc classification
A61K40/11
HUMAN NECESSITIES
C07K2319/30
CHEMISTRY; METALLURGY
International classification
C07K16/00
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides methods for generating MAGE-B2 specific T cells and compositions comprising engineered MAGE-B2-specific T cell receptors. Further provided are methods of treating cancer comprising administering the MAGE-B2-specific T cells.
Claims
1. An isolated T cell receptor (TCR) capable of binding an antigenic peptide derived from the Melanoma-associated Antigen B2 (MAGE-B2), comprising: (a) a TCR alpha polypeptide having at least 90% identity to the sequence of SEQ ID NO: 3 and a TCR beta polypeptide having at least 90% identity to the sequence of SEQ ID NO: 5, wherein the TCR alpha polypeptide comprises a CDR1 sequence with at least 95% identity to SEQ ID NO: 7, a CDR2 sequence with at least 95% identity to SEQ ID NO: 9, and a CDR3 sequence with at least 95% identity to SEQ ID NO: 11 and the TCR beta polypeptide comprises a CDR1 sequence with at least 95% identity to SEQ ID NO: 13, a CDR2 sequence with at least 95% identity to SEQ ID NO: 15, and CDR3 sequence with at least 95% identity to SEQ ID NO: 17; or (b) a TCR alpha polypeptide having at least 90% identity to the sequence of SEQ ID NO: 19 and a TCR beta polypeptide having at least 90% identity to the sequence of SEQ ID NO: 21, wherein the TCR alpha polypeptide comprises a CDR1 sequence with at least 95% identity to SEQ ID NO: 23, a CDR2 sequence with at least 95% identity to SEQ ID NO: 25, and a CDR3 sequence with at least 95% identity to SEQ ID NO: 27 and the TCR beta polypeptide comprises a CDR1 sequence with at least 95% identity to SEQ ID NO: 29, a CDR2 sequence with at least 95% identity to SEQ ID NO: 31, and CDR3 sequence with at least 95% identity to SEQ ID NO: 33.
2. The TCR of claim 1, wherein the antigenic peptide is HLA-A2 restricted.
3. The TCR of claim 2, wherein the antigenic peptide is HLA-A*0201 restricted.
4. The TCR of claim 1, wherein the TCR alpha polypeptide comprises a CDR1 with the sequence of SEQ ID NO: 7, a CDR2 with the sequence of SEQ ID NO: 9, and a CDR3 with the sequence of SEQ ID NO: 11 and the TCR beta polypeptide comprises a CDR1 with the sequence of SEQ ID NO: 13, a CDR2 with the sequence of SEQ ID NO: 15, and CDR3 with the sequence of SEQ ID NO: 17.
5. The TCR of claim 1, wherein the TCR alpha polypeptide has at least 95% identity to the sequence of SEQ ID NO: 3 and the TCR beta polypeptide has at least 95% identity to the sequence of SEQ ID NO: 5.
6. The TCR of claim 1, wherein the TCR alpha polypeptide comprises the sequence of SEQ ID NO: 3 and the TCR beta polypeptide comprises the sequence of SEQ ID NO: 5.
7. The TCR of claim 1, wherein the TCR alpha polypeptide comprises a CDR1 with the sequence of SEQ ID NO: 23, a CDR2 with the sequence of SEQ ID NO: 25, and a CDR3 with the sequence of SEQ ID NO: 27 and the TCR beta polypeptide comprises a CDR1 with the sequence of SEQ ID NO: 29, a CDR2 with the sequence of SEQ ID NO: 31, and a CDR3 with the sequence of SEQ ID NO: 33.
8. The TCR of claim 1, wherein the TCR alpha polypeptide has at least 95% identity to the sequence of SEQ ID NO: 19 and the TCR beta polypeptide has at least 95% identity to the sequence of SEQ ID NO: 21.
9. The TCR of claim 1, wherein the TCR alpha polypeptide comprises the sequence of SEQ ID NO: 19 and the TCR beta polypeptide comprises the sequence of SEQ ID NO: 21.
10. The TCR of claim 1, wherein the TCR is a soluble TCR lacking a transmembrane domain.
11. The TCR of claim 10, further comprising a detectable label.
12. The TCR of claim 10, further comprising a therapeutic agent.
13. A multivalent TCR complex comprising a plurality of TCRs according to claim 1.
14. A polypeptide comprising a TCR alpha polypeptide comprising a CDR1 with the sequence of SEQ ID NO: 7, a CDR2 with the sequence of SEQ ID NO: 9, and a CDR3 with the sequence of SEQ ID NO: 11 and/or a TCR beta polypeptide comprising a CDR1 with the sequence of SEQ ID NO: 13, a CDR2 with the sequence of SEQ ID NO: 15, and CDR3 with the sequence of SEQ ID NO: 17.
15. A polypeptide comprising a TCR alpha polypeptide comprising a CDR1 with the sequence of SEQ ID NO: 23, a CDR2 with the sequence of SEQ ID NO: 25, and a CDR3 with the sequence of SEQ ID NO: 27 and/or a TCR beta polypeptide comprising a CDR1 with the sequence of SEQ ID NO: 29, a CDR2 with the sequence of SEQ ID NO: 31, and CDR3 with the sequence of SEQ ID NO: 33.
16. An expression vector comprising a polynucleotide sequence encoding the TCR of claim 1.
17. A method for engineering a MAGE-B2-specific immune cell comprising contacting said immune cell with the expression vector of claim 16.
18. A composition comprising a therapeutically effective amount of MAGE-B2-specific cells produced according to claim 17 for the treatment of cancer in a subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
DETAILED DESCRIPTION
(12) Melanoma-associated antigen B2 (MAGE-B2), also known as cancer/testis antigen 3.2 (UniProt No. O15479)(CT3.2), is encoded by a gene located on the X chromosome. MAGE-B2 is expressed in testes, as measured by protein and RNA levels, but not in other normal tissues. MAGE-B2 is overexpressed in several cancers including lung cancer, liver cancer, head and neck cancer, stomach cancer, glioblastoma, and colorectal cancer. One HLA-A2 (e.g., HLA-A*0201, HLA-A*0202, HLA-A*0203, HLA-A*0204, or HLA-A*0205) restricted peptide (GVYDGEEHSV, SEQ ID NO: 1) has been eluted and identified from ovarian cancer cells (Barnea et al., 2002). The epitope was also identified from peptidome analysis of glioblastoma multiforme cells T98G and U-87 (Shraibman et al., 2016).
(13) Using the MAGE-B2 peptide epitope, antigen-specific CTLs were generated in the present studies from patient peripheral blood mononuclear cells (PBMCs) that recognized the endogenously-presented antigen on HLA-matched allogeneic tumor cell lines. These antigen-specific CTLs stimulated by antigen-presenting cells presenting this HLA-A2-restricted MAGE-B2 peptide were shown to be selectively cytotoxic against lung cancer cells.
(14) Thus, in certain aspects, the present disclosure provides a TCR which recognizes and specifically binds the MAGE-B2 HLA-A2 restricted epitope GVYDGEEHSV (SEQ ID NO: 1). The present disclosure also provides a nucleotide sequence encoding this TCR, an expression vector comprising this nucleotide sequence which can be used to modify nave T cells and generate MAGE-B2-specific T cells. The present disclosure further provides the use of MAGE-B2-specific T cells for therapy, such as adoptive cell therapy for cancer patients, such as HLA-A2-positive cancer patients, whose malignant cells express MAGE-B2 antigen. The antigen-specific T cells, such as CTLs, provided herein may be used to target solid cancers.
I. Definitions
(15) The singular terms a, an, and the as used herein and in the appended claims include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a cell includes a plurality of such cells and reference to the peptide includes reference to one or more peptides and equivalents thereof (e.g., polypeptides) known to those skilled in the art.
(16) The term or as used herein and in the appended claims means and/or unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive.
(17) The term another as used herein and in the appended claims may mean at least a second or more.
(18) The term about as used herein indicates that a particular value or measurement includes the inherent variation associated with the device used to obtain the measurement, to calculate the value, or the natural variation that exists among the study subjects.
(19) The term essentially free as used herein with respect to a component of a solution (e.g., a preparation of one or more proteins, polymers, or small molecules) means that the preparation was not formulated to include that component, or that such component is present only in trace amounts (e.g., as a contaminant). In certain embodiments, a preparation of a molecule of interest is essentially free of a particular component if the preparation comprises less than 0.05% (w/w) of that component. In certain embodiments, a preparation of a molecule of interest is essentially free of a particular component if the preparation comprises less than 0.01% (w/w) of that component. In certain embodiments, a preparation of a molecule of interest is essentially free of a particular component if no amount of the specified component can be detected in the preparation using standard analytical methods (e.g., UV spectrophotometry, mass spectrometry, nuclear magnetic resonance spectroscopy, etc.).
(20) The term enriched as used herein with respect to a component of a solution or suspension (e.g., a preparation of one or more cell types, proteins, polymers, or small molecules) means that the preparation was formulated to include that component at a higher than normal concentration, or in greater than normal numbers (e.g., a suspension of lymphocytes may be enriched for effector T lymphocytes).
(21) As used herein, the terms treat, treatment, treating, and the like refer to the process of ameliorating, lessening, or otherwise mitigating the symptoms of a disease or condition in a subject by, for example, administering a therapeutic agent to the subject, or by performing a surgical, clinical, or other medical procedure on the subject.
(22) As used herein, the terms subject or patient are used interchangeably herein to refer to an individual, e.g., a human or a non-human organism, such as a primate, a mammal, or a vertebrate.
(23) As used herein, the terms therapeutically effective or therapeutically beneficial and the like refer to a therapeutic agent, or a surgical, clinical, or other medical procedure that ameliorates, mitigates or otherwise relieves one or more symptoms of a disease, disorder, or condition, thereby enhancing the well-being of a subject having a disease, disorder, or condition by, for example, reducing the frequency or severity of the signs or symptoms of a disease, disorder, or condition. Thus, a therapeutically effective or therapeutically beneficial cancer treatment may, for example, reduce the size of a tumor, reduce the growth rate of a tumor, reduce the likelihood of tumor dissemination or metastasis.
(24) As used herein, the terms pharmaceutically acceptable or pharmacologically acceptable refer to pharmaceutical formulations of therapeutic agents that do not produce an adverse, allergic, or other undesired reaction when administered to a mammalian or vertebrate subject. Such preparations should be formulated in compliance with good manufacturing practice (GMP) standards for sterility, pyrogenicity, purity, and any other relevant standards as required by FDA Office of Biological Standards.
(25) As used herein, the term pharmaceutically acceptable carrier refers to any and all chemical compounds or solvents used to formulate a therapeutic agent for delivery to a mammalian or vertebrate subject such as, for example, aqueous solvents (e.g., water, alcoholic/aqueous solutions, saline solutions, parenteral vehicles, such as sodium chloride, Ringer's dextrose, etc.), non-aqueous solvents (e.g., propylene glycol, polyethylene glycol, vegetable oil, and injectable organic esters, such as ethyloleate), dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial or antifungal agents, anti-oxidants, chelating agents, and inert gases), isotonic agents, absorption delaying agents, salts, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, fluid and nutrient replenishers, and any combinations thereof, as would be known to one of ordinary skill in the art.
(26) As used herein, the terms unit dose, dose, or dosage refer to formulations of a therapeutic agent suitable for administration to a mammalian or vertebrate subject containing a predetermined quantity of the agent expected to be therapeutically effective in the subject when administered by an appropriate route and according to a desired treatment regimen. The actual dosage of a particular therapeutic agent to be administered to a subject may be determined empirically by a health care provider in light of a variety of physical and physiological parameters, including, for example, the subject's body weight, age, health, and gender, the type of disease being treated, the extent of disease progression, previous or concurrent therapeutic interventions, the route of administration, and the potency, stability, and toxicity of the particular therapeutic substance.
II. Mage-B2 TCR Methods and Compositions
(27) In certain embodiments, the present disclosure provides a MAGE-B2 peptide epitope comprising the sequence GVYDGEEHSV (SEQ ID NO: 1). The MAGE-B2 peptide epitope may be contacted with or used to stimulate a population of T cells to induce proliferation of the T cells that recognize or bind the MAGE-B2 peptide epitope. The MAGE-B2 peptide epitope may be administered to a subject, such as a human patient, to enhance the immune response of the subject against a cancer. A MAGE-B2 peptide epitope may be included in an active immunotherapy (e.g., a cancer vaccine) or a passive immunotherapy (e.g., an adoptive cell therapy). Active immunotherapies include immunizing a subject with a purified tumor antigen or a MAGE-B2 peptide epitope (native or modified). Alternately, antigen presenting cells pulsed with a MAGE-B2 peptide epitope (or transfected with genes encoding the tumor antigen) may be administered to a subject. The MAGE-B2 peptide epitope may be modified or contain one or more mutations such as, e.g., a substitution mutation. Adoptive cell therapies may involve administering cells to a subject, wherein the cells (e.g., cytotoxic T cells) have been sensitized in vitro to the MAGE-B2 peptide epitope.
(28) In particular, T cells can be activated and expanded ex vivo for adoptive cell therapies within a short period of time, such as 6 to 8 weeks. The T cells may be isolated and expanded from T cells (e.g., CD4.sup.+ T cells, CD8.sup.+ T cells, T cells and regulatory T cells (Tregs)) isolated from peripheral blood, such as with the tetramer guided sorting and rapid expansion protocol (REP). Next, the peptide or corresponding polynucleotides (e.g., full length MAGE-B2 or the MAGE-B2 peptide epitope) can be loaded to HLA-A2 positive dendritic cells, lymphoblastoid cell lines (LCLs), PBMCs, or artificial antigen presenting cells (aAPCs), and then co-cultured with the T cells by several rounds of stimulation to generate antigen-specific CTL cell lines or clones. Furthermore, with manipulation of immune modulating parameters, the effector function and long-term persistence in vivo of these expanded antigen specific T cells can be enhanced. These CTLs can be used for adoptive cell therapy for MAGE-B2 and HLA-A2 positive cancer patients. Further, other MAGE-B2-specific cells that can be generated from the present disclosure include NK cells, invariant NK cells, NKT cells, mesenchymal stem cells (MSCs), and induced pluripotent stem (iPS) cells. These cells may be isolated from blood or the umbilical cord. The antigen-specific cells of the present disclosure may be autologous or allogeneic.
(29) In another method, antigen-specific cells can be generated by using the MAGE-B2 TCRs provided herein (e.g., SEQ ID NOs: 2-5 or 18-22). In this method, the TCR sequence is inserted into a vector (e.g., retroviral or lentiviral vector) which is introduced into host cells, such as T cells (e.g., CD4.sup.+ T cells, CD8.sup.+ T cells, T cells, and Tregs), NK cells, invariant NK cells, NKT cells, MSCs, or iPS cells to generate antigen-specific cells which can be used for adoptive cell therapy for cancer patients.
(30) MAGE-B2 peptide epitope and TCR sequences are provided below.
(31) TABLE-US-00001 Peptideepitope: (SEQIDNO:1) GVYDGEEHSV AlphaChain(TRAV9-2*01F): (SEQIDNO:2) ATGAACTATTCTCCAGGCTTAGTATCTCTGATACTCTTACTGCTTGGAAG AACCCGTGGAAATTCAGTGACCCAGATGGAAGGGCCAGTGACTCTCTCAG AAGAGGCCTTCCTGACTATAAACTGCACGTACACAGCCACAGGATACCCT TCCCTTTTCTGGTATGTCCAATATCCTGGAGAAGGTCTACAGCTCCTCCT GAAAGCCACGAAGGCTGATGACAAGGGAAGCAACAAAGGTTTTGAAGCCA CATACCGTAAAGAAACCACTTCTTTCCACTTGGAGAAAGGCTCAGTTCAA GTGTCAGACTCAGCGGTGTACTTCTGTGCTCTGACCAACGACTACAAGCT CAGCTTTGGAGCCGGAACCACAGTAACTGTAAGAGCAAATATCCAGAACC CTGACCCTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGACAAGTCT GTCTGCCTATTCACCGATTTTGATTCTCAAACAAATGTGTCACAAAGTAA GGATTCTGATGTGTATATCACAGACAAAACTGTGCTAGACATGAGGTCTA TGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGCAACAAATCTGACTTT GCATGTGCAAACGCCTTCAACAACAGCATTATTCCAGAAGACACCTTCTT CCCCAGCCCAGAAAGTTCCTGTGATGTCAAGCTGGTCGAGAAAAGCTTTG AAACAGATACGAACCTAAACTTTCAAAACCTGTCAGTGATTGGGTTCCGA ATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCT GTGGTCCAGCTGA AlphaChain (SEQIDNO:3) MNYSPGLVSLILLLLGRTRGNSVTQMEGPVTLSEEAFLTI NCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKG FEATYRKETTSFHLEKGSVQVSDSAVYFCALTNDYKLSFG AGTTVTVRANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQ TNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDF ACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLN FQNLSVIGFRILLLKVAGFNLLMTLRLWSS BetaChain(TRBV15*02F) (SEQIDNO:4) ATGGGTCCTGGGCTTCTCCACTGGATGGCCCTTTGTCTCCTTGGAACAGG TCATGGGGATGCCATGGTCATCCAGAACCCAAGATACCAGGTTACCCAGT TTGGAAAGCCAGTGACCCTGAGTTGTTCTCAGACTTTGAACCATAACGTC ATGTACTGGTACCAGCAGAAGTCAAGTCAGGCCCCAAAGCTGCTGTTCCA CTACTATGACAAAGATTTTAACAATGAAGCAGACACCCCTGATAACTTCC AATCCAGGAGGCCGAACACTTCTTTCTGCTTTCTTGACATCCGCTCACCA GGCCTGGGGGACGCAGCCATGTACCTGTGTGCCACCAGCAGGGGCGGGAG GTACAATGAGCAGTTCTTCGGGCCAGGGACACGGCTCACCGTGCTAGAGG ACCTGAAAAACGTGTTCCCACCCGAGGTCGCTGTGTTTGAGCCATCAGAA GCAGAGATCTCCCACACCCAAAAGGCCACACTGGTGTGCCTGGCCACAGG CTTCTTCCCTGACCACGTGGAGCTGAGCTGGTGGGTGAATGGGAAGGAGG TGCACAGTGGGGTCAGCACGGACCCGCAGCCCCTCAAGGAGCAGCCCGCC CTCAATGACTCCAGATACTGCCTGAGCAGCCGCCTGAGGGTCTCGGCCAC CTTCTGGCAGAACCCCCGCAACCACTTCCGCTGTCAAGTCCAGTTCTACG GGCTCTCGGAGAATGACGAGTGGACCCAGGATAGGGCCAAACCCGTCACC CAGATCGTCAGCGCCGAGGCCTGGGGTAGAGCAGACTGTGGCTTTACCTC GGTGTCCTACCAGCAAGGGGTCCTGTCTGCCACCATCCTCTATGAGATCC TGCTAGGGAAGGCCACCCTGTATGCTGTGCTGGTCAGCGCCCTTGTGTTG ATGGCCATGGTCAAGAGAAAGGATTTCTGA BetaChain (SEQIDNO:5) MGPGLLHWMALCLLGTGHGDAMVIQNPRYQVTQFGKPVTL SCSQTLNHNVMYWYQQKSSQAPKLLFHYYDKDFNNEADTP DNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSRGGRYNE QFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKAT LVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPA LNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDE WTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATIL YEILLGKATLYAVLVSALVLMAMVKRKDF AlphachainCDR1 (SEQIDNO:6) GCCACAGGATACCCTTCC (SEQIDNO:7) ATGYPS AlphachainCDR2 (SEQIDNO:8) GCCACGAAGGCTGATGACAAG (SEQIDNO:9) ATKADDK AlphachainCDR3 (SEQIDNO:10) GCTCTGACCAACGACTACAAGCTCAGC (SEQIDNO:11) ALTNDYKLS BetachainCDR1 (SEQIDNO:12) TTGAACCATAACGTC (SEQIDNO:13) LNHNV BetachainCDR2 (SEQIDNO:14) TACTATGACAAAGATTTT (SEQIDNO:15) YYDKDF BetachainCDR3 SEQIDNO:16) GCCACCAGCAGGGGCGGGAGGTACAATGAGCAGTTC (SEQIDNO:17) ATSRGGRYNEQF
(32) MAGE-B2-231 C5 TCR sequences are provided below. The signal peptide is underlined and the variable region is italicized
(33) TABLE-US-00002 AlphaChain(TRAV10*01): (SEQIDNO:18) ATGAAAAAGCATCTGACGACCTTCTTGGTGATTTTGTGGCTTTATTTTTA TAGGGGGAATGGCAAAAACCAAGTGGAGCAGAGTCCTCAGTCCCTGATCA TCCTGGAGGGAAAGAACTGCACTCTTCAATGCAATTATACA
TTAAGGTGGTATAAGCAAGATACTGGGAGAGG TCCTGTTTCCCTGACAATC
AAGTCGAACG GAAGATATACAGCAACTCTGGATGCAGACACAAAGCAAAGCTCTCTGCAC ATCACAGCCTCCCAGCTCAGCGATTCAGCCTCCTACATCTGT
TTTGGAACTGGCACCCGACT TCTGGTCAGTCCAAATATCCAGAACCCTGACCCTGCCGTGTACCAGCTGA GAGACTCTAAATCCAGTGACAAGTCTGTCTGCCTATTCACCGATTTTGAT TCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATGTGTATATCACAGA CAAAACTGTGCTAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGCTG TGGCCTGGAGCAACAAATCTGACTTTGCATGTGCAAACGCCTTCAACAAC AGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCAGAAAGTTCCTGTGA TGTCAAGCTGGTCGAGAAAAGCTTTGAAACAGATACGAACCTAAACTTTC AAAACCTGTCAGTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGG TTTAATCTGCTCATGACGCTGCGGCTGTGGTCCAGCTAA AlphaChain (SEQIDNO:19) MKKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYT
LRWYKQDTGRGPVSLT
KSNGRYTATLDADTKQSSLH ITASQLSDSASYIC
FGTGTRLLVSPNIQNPDPAVYQLRDS KSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAW SNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNL SVIGFRILLLKVAGFNLLMTLRLWSS BetaChain(TRBV11-3*04) (SEQIDNO:20) ATGGGTACCAGGCTCCTCTGCTGGGTGGCCTTCTGTCTCCTGGTGGAAGA ACTCATAGAAGCTGGAGTGGTTCAGTCTCCCAGATATAAGATTATAGAGA AAAAACAGCCTGTGGCTTTTTGGTGCAATCCTATT
CTTTACTGGTACCGGCAGAACTTGGGACAGGGCCCGGAGCTTCTGATTCG A
GTAGACGATTCACAGTTGCCTAAGGATCGAT TTTCTGCAGAGAGGCTCAAAGGAGTAGACTCCACTCTCAAGATCCAGCCT GCAGAGCTTGGGGACTCGGCCGTGTATCTCTGT
TTCGGGCC AGGGACACGGCTCACCGTGCTAGAGGACCTGAAAAACGTGTTCCCACCCG AGGTCGCTGTGTTTGAGCCATCAGAAGCAGAGATCTCCCACACCCAAAAG GCCACACTGGTGTGCCTGGCCACAGGCTTCTTCCCTGACCACGTGGAGCT GAGCTGGTGGGTGAATGGGAAGGAGGTGCACAGTGGGGTCAGCACGGACC CGCAGCCCCTCAAGGAGCAGCCCGCCCTCAATGACTCCAGATACTGCCTG AGCAGCCGCCTGAGGGTCTCGGCCACCTTCTGGCAGAACCCCCGCAACCA CTTCCGCTGTCAAGTCCAGTTCTACGGGCTCTCGGAGAATGACGAGTGGA CCCAGGATAGGGCCAAACCCGTCACCCAGATCGTCAGCGCCGAGGCCTGG GGTAGAGCAGACTGTGGCTTTACCTCGGTGTCCTACCAGCAAGGGGTCCT GTCTGCCACCATCCTCTATGAGATCCTGCTAGGGAAGGCCACCCTGTATG CTGTGCTGGTCAGCGCCCTTGTGTTGATGGCCATGGTCAAGAGAAAGGAT TTCTAA BetaChain (SEQIDNO:21) MGTRLLCWVAFCLLVEELIEAGVVQSPRYKIIEKKQPVAFWCNPI
LYWYRQNLGQGPELLIR
VDDSQLPKDRFSAERLKGVDSTLKIQP AELGDSAVYLC
FGPGTRLTVLEDLKNVFPPEVAVFE PSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKE QPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAK PVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSA LVLMAMVKRKDF AlphachainCDR1 (SEQIDNO:22) GTGAGCCCCTTCAGCAAC (SEQIDNO:23) VSPFSN AlphachainCDR2 (SEQIDNO:24) ATGACTTTCAGTGAGAACACA (SEQIDNO:25) MTFSENT AlphachainCDR3 (SEQIDNO:26) GTGGTGATTTCAGGCTTTCAGAAACTTGTA (SEQIDNO:27) VVISGFQKLV BetachainCDR1 (SEQIDNO:28) TCTGGCCACAATACC (SEQIDNO:29) SGHNT BetachainCDR2 (SEQIDNO:30) TATGAGAATGAGGAAGCA (SEQIDNO:31) YENEEA BetachainCDR3 (SEQIDNO:32) GCCAGCAGCTTCCCTAAACAGGGATCCTACAATGAGCAGTTC (SEQIDNO:33) ASSFPKQGSYNEQF
A. MAGE-B2 Peptides
(34) In some aspects, the present disclosure comprises a MAGE-B2 peptide epitope. The MAGE-B2 peptide epitopes may have the amino acid sequence of the HLA-A2 restricted MAGE-B2 peptide GVYDGEEHSV; SEQ ID NO: 1. The MAGE-B2 peptide epitope may have an amino acid sequence with at least 80, 85, 90, 95, 96, 97, 98, 99, or 100 percent sequence identity with the peptide sequence of SEQ ID NO: 1.
(35) The MAGE-B2 peptide epitope may comprise or consist of 7-35 amino acids, preferably 8-35 amino acid residues, and even more preferably 8-25 amino acids, or 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 amino acids in length, or any range derivable therein. For example, a MAGE-B2 peptide epitope of the present disclosure may, in some embodiments, comprise or consist of the MAGE-B2 peptide epitope of SEQ ID NO: 1. An antigenic peptide may comprise an immunoreactive MAGE-B2 peptide epitope, and may comprise additional sequences. The additional sequences may be derived from a native antigen and may be heterologous, and such sequences may, but need not, be immunogenic. In some embodiments, a MAGE-B2 peptide epitope can selectively bind with HLA-A2, particularly HLA-A*0201, HLA-A*0202, HLA-A*0203, HLA-A*0204, or HLA-A*0205.
(36) As would be appreciated by one of skill in the art, MHC molecules can bind peptides of varying sizes, but typically not full-length proteins. While MHC class I molecules have been traditionally described to bind to peptides of 8-11 amino acids long, it has been shown that peptides 15 amino acids in length can bind to MHC class I molecules by bulging in the middle of the binding site or extending out of the MHC class I binding groove. As would be immediately appreciated by one of skill, a naturally occurring full-length tumor antigen, such as MAGE-B2, would not be useful to selectively bind a class II MHC such that it would be endocytosed and generate proliferation of T cells. Generally, the naturally occurring full-length tumor antigen proteins do not display these properties and would thus not be useful for these immunotherapy purposes.
(37) In certain embodiments, a MAGE-B2 peptide epitope is immunogenic or antigenic. As shown in the below examples, a MAGE-B2 peptide epitope of the present disclosure can promote the proliferation of T cells.
(38) A MAGE-B2 peptide epitope may be a recombinant peptide, synthetic peptide, purified peptide, immobilized peptide, detectably labeled peptide, encapsulated peptide, or a vector-expressed peptide (e.g., a peptide encoded by a nucleic acid in a vector comprising a heterologous promoter operably linked to the nucleic acid). In some embodiments, a synthetic MAGE-B2 peptide epitope may be administered to a subject, such as a human patient, to induce an immune response in the subject. Synthetic peptides may display certain advantages, such as a decreased risk of bacterial contamination, as compared to recombinantly expressed peptides. A MAGE-B2 peptide may also be comprised in a pharmaceutical composition such as, e.g., a vaccine composition, which is formulated for administration to a mammalian or human subject.
(39) 1. Cell Penetrating Peptides
(40) In some embodiments, an immunotherapy may utilize a MAGE-B2 peptide epitope of the present disclosure that is associated with a cell penetrator, such as a liposome or a cell penetrating peptide (CPP). Antigen presenting cells (such as dendritic cells) pulsed with peptides may be used to enhance antitumor immunity. In some embodiments, an immunotherapy may utilize a nucleic acid encoding a MAGE-B2 peptide epitope of the present disclosure, wherein the nucleic acid is delivered, e.g., in a viral vector or non-viral vector.
(41) Cell penetrating peptides that may be covalently bound to a tumor antigen-specific peptide (e.g., a MAGE-B2 peptide) include, e.g., HIV Tat, herpes virus VP22, the Drosophila Antennapedia homeobox gene product, signal sequences, fusion sequences, or protegrin I. Covalently binding a peptide to a CPP can prolong the presentation of a peptide by dendritic cells, thus enhancing antitumor immunity. In some embodiments, a MAGE-B2 peptide of the present disclosure (e.g., comprised within a peptide or polyepitope string) may be covalently bound (e.g., via a peptide bond) to a CPP to generate a fusion protein. In other embodiments, a MAGE-B2 peptide epitope or nucleic acid encoding the peptide epitope may be encapsulated within or associated with a liposome, such as a multilamellar, vesicular, or multivesicular liposome, an exocytic vesicle or exosome.
(42) In some embodiments, cellular uptake is facilitated by the attachment of a lipid, such as stearate or myristate, to the polypeptide. Lipidation has been shown to enhance the passage of peptides into cells. The attachment of a lipid moiety is another way that the present disclosure increases polypeptide uptake by the cell. Cellular uptake is further discussed below.
(43) A MAGE-B2 peptide epitope of the present disclosure may be included in a liposomal vaccine composition. For example, the liposomal composition may be or comprise a proteoliposomal composition.
(44) In some embodiments, a MAGE-B2 peptide epitope may be associated with a nanoparticle to form nanoparticle-polypeptide complex. In some embodiments, the nanoparticle is a liposome or other lipid-based nanoparticle such as a lipid-based vesicle (e.g., a DOTAP:cholesterol vesicle). In other embodiments, the nanoparticle is an iron-oxide based superparamagnetic nanoparticle. In some embodiments, the nanoparticle is a semiconductor nanocrystal or a semiconductor quantum dot, both of which can be used in optical imaging. In further embodiments, the nanoparticle can be a nanoshell, which comprises a gold layer over a core of silica.
(45) 2. Biological Functional Equivalents
(46) A MAGE-B2 peptide epitope of the present disclosure may be modified to contain amino acid substitutions, insertions and/or deletions that do not alter their respective interactions with an HLA class protein, such as HLA-A2, binding regions. As a nonlimiting example, certain amino acids may be substituted for other amino acids in a MAGE-B2 peptide disclosed herein without appreciable loss of HLA-binding, as demonstrated by detectably unchanged peptide binding to HLA-A2. It is thus contemplated that a MAGE-B2 peptide disclosed herein (or a nucleic acid encoding such a peptide) which is modified in sequence and/or structure, but which is unchanged in biological utility or activity remains within the scope of the compositions and methods disclosed herein.
(47) It is also well understood by the skilled artisan that, inherent in the definition of a biologically functional equivalent peptide, is the concept that there is a limit to the number of changes that may be made within a defined portion of the molecule while still maintaining an acceptable level of equivalent biological activity. Biologically functional equivalent peptides are thus defined herein as those peptides in which certain, not most or all, of the amino acids may be substituted. Of course, a plurality of distinct peptides with different substitutions may easily be made and used in accordance with the present disclosure.
(48) The skilled artisan is also aware that where certain residues are shown to be particularly important to the biological or structural properties of a peptide, e.g., residues in specific epitopes, such residues may not generally be exchanged. This may be the case in the present disclosure, as a mutation in a MAGE-B2 peptide disclosed herein could result in a loss of species-specificity and in turn, reduce the utility of the resulting peptide for use in methods of the present disclosure. Thus, peptides which are antigenic (e.g., bind HLA-A*0201, HLA-A*0202, HLA-A*0203, HLA-A*0204, or HLA-A*0205 specifically) and comprise conservative amino acid substitutions are understood to be included in the present disclosure. Conservative substitutions are least likely to drastically alter the activity of a protein. A conservative amino acid substitution refers to replacement of amino acid with a chemically similar amino acid, i.e., replacing nonpolar amino acids with other nonpolar amino acids; substitution of polar amino acids with other polar amino acids, acidic residues with other acidic amino acids, etc.
(49) Amino acid substitutions, such as those which might be employed in modifying a MAGE-B2 peptide disclosed herein are generally based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. An analysis of the size, shape and type of the amino acid side-chain substituents reveals that arginine, lysine and histidine are all positively charged residues; that alanine, glycine and serine are all a similar size; and that phenylalanine, tryptophan and tyrosine all have a generally similar shape. Therefore, based upon these considerations, arginine, lysine and histidine; alanine, glycine and serine; and phenylalanine, tryptophan and tyrosine; are defined herein as biologically functional equivalents. In some embodiments, the mutation may enhance TCR-pMHC interaction and/or peptide-MHC binding.
(50) The present disclosure also contemplates isoforms of the MAGE-B2 peptide disclosed herein. An isoform contains the same number and kinds of amino acids as a peptide of the present disclosure, but the isoform has a different molecular structure. The isoforms contemplated by the present disclosure are those having the same properties as a peptide of the present disclosure as described herein.
(51) Nonstandard amino acids may be incorporated into proteins by chemical modification of existing amino acids or by de novo synthesis of a peptide disclosed herein. A nonstandard amino acid refers to an amino acid that differs in chemical structure from the twenty standard amino acids encoded by the genetic code.
(52) In some embodiments, the present disclosure contemplates a chemical derivative of a MAGE-B2 peptide disclosed herein. Chemical derivative refers to a peptide having one or more residues chemically derivatized by reaction of a functional side group, and retaining biological activity and utility. Such derivatized peptides include, for example, those in which free amino groups have been derivatized to form specific salts or derivatized by alkylation and/or acylation, p-toluene sulfonyl groups, carbobenzoxy groups, t-butylocycarbonyl groups, chloroacetyl groups, formyl or acetyl groups among others. Free carboxyl groups may be derivatized to form organic or inorganic salts, methyl and ethyl esters or other types of esters or hydrazides and preferably amides (primary or secondary). Chemical derivatives may include those peptides which comprise one or more naturally occurring amino acids derivatives of the twenty standard amino acids. For example, 4-hydroxyproline may be substituted for serine; and ornithine may be substituted for lysine.
(53) It should be noted that all amino-acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino-terminus to carboxy-terminus. Furthermore, it should be noted that a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino-acid residues. The amino acids described herein are preferred to be in the L isomeric form. However, residues in the D isomeric form can be substituted for any L-amino acid residue, as long as the desired functional properties set forth herein are retained by the protein.
(54) Preferred MAGE-B2 peptides or analogs thereof preferably specifically or preferentially bind a HLA-A2. Determining whether or to what degree a particular tumor antigen-specific peptide or labeled peptide, or an analog thereof, can bind an HLA-A2 and can be assessed using an in vitro assay such as, for example, an enzyme-linked immunosorbent assay (ELISA), immunoblotting, immunoprecipitation, radioimmunoassay (RIA), immunostaining, latex agglutination, indirect hemagglutination assay (IHA), complement fixation, indirect immnunofluorescent assay (FA), nephelometry, flow cytometry assay, chemiluminescence assay, lateral flow immunoassay, u-capture assay, mass spectrometry assay, particle-based assay, inhibition assay and/or an avidity assay.
(55) B. Engineered MAGE-B2-Specific Cells
(56) In some embodiments, the present disclosure provides a MAGE-B2-specific TCR. The TCR may comprise alpha chain CDRs of SEQ ID NOs: 6-12 and/or beta chain CDRs of SEQ ID NOs: 13-17. The TCR may comprise an alpha chain with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identity or similarity to SEQ ID NOs: 2-3 and or a beta chain with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identity or similarity to SEQ ID NOs: 4-5. Also provided herein are polypeptides and polynucleotides encoding the alpha chain and/or beta chain of the MAGE-B2 TCRs provided herein. Further provided herein are cells, such as T cells, NK cells, invariant NK cells, NKT cells, MSCs, or iPS cells, engineered to express the MAGE-B2-specific TCR provided herein. These non-T cell effector immune cells may express a TCR together with CD3 molecules or other signaling domains linked to the TCR, which would initiate the signal transduction in these cells.
(57) The engineered immune cells may be constructed using any of the many well-established gene transfer methods known to those skilled in the art. In certain embodiments, the engineered cells are constructed using viral vector-based gene transfer methods to introduce nucleic acids encoding a MAGE-B2-specific TCR. The viral vector-based gene transfer method may comprise a lentiviral vector, a retroviral vector, an adenoviral or an adeno-associated viral vector. In certain embodiments, the engineered cells are constructed using non-viral vector-based gene transfer methods to introduce nucleic acids encoding a MAGE-B2-specific TCR. The vector for the TCR may comprises the alpha chain polypeptide and the beta chain polypeptide, which may be linked by a linker domain or IRES sequence. The linker domain may comprise one or more cleavage sites, such as a Furin cleavage site and/or a P2A cleavage site, which may be separated by a spacer, such as SGSG or GSG. In certain embodiments, the non-viral vector-based gene transfer method comprises a gene-editing method selected from the group consisting of a zinc-finger nuclease (ZFN), a transcription activator-like effector nuclease (TALENs), and a clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated protein 9 (Cas9) nuclease. In certain embodiments, the non-viral vector-based gene editing method comprises a transfection or transformation method selected from the group consisting of lipofection, nucleofection, virosomes, liposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
(58) C. Soluble TCRs and BiTEs
(59) In addition, the present disclosure provides soluble TCRs which can be used to treat HLA-A2 positive cancer patients directly. Soluble bispecific T cell-engaging molecules (BiTEs) can be generated by linking the MAGE-B2 TCR to CD3-specific Fab fragments. These bispecific molecules can bind the tumor cell surface via their MAGE-B2 TCR binding to the peptide/HLA complex, and the CD3-specific Fab fragments would crosslink the TCR, such as on the target T cell. This would result in cellular activation and elimination of the target cell. Thus, these soluble bispecific TCR constructs can be used for treating the cancer patients directly.
(60) Finally, the soluble TCR can be used as a probe for diagnostic evaluation of peptide/MHC in tumor cells or to direct therapeutic molecules to the tumor site. This soluble TCR molecule also could be labeled with tracers such as a fluorescent probe or radioactive probe, and then used for diagnostic evaluation of the presentation of peptide/MHC in tumor cells. Furthermore, this soluble TCR molecule could be linked with therapeutic molecules such as toxin, and then direct these therapeutic molecules to the tumor sites for the treatment of cancer patients.
(61) In some embodiments, the present disclosure provides soluble TCRs, such as a MAGE-B2-specific TCR provided herein. Soluble TCRs may be used for investigating specific TCR-pMHC interactions or as a diagnostic tool to detect infection, or to detect autoimmune disease markers. Soluble TCRs may have applications in staining, for example to stain cells for the presence of a particular peptide antigen presented in the context of the MHC. Similarly, soluble TCRs can be used to deliver a therapeutic agent, for example a cytotoxic compound or an immunostimulating compound, to cells presenting a particular antigen. Soluble TCRs may also be used to inhibit T cells, for example, those reacting to an auto-immune peptide antigen. In some aspects, the TCR is linked to another molecule that delivers a cell in proximity to the tumor. In further aspects, the TCR delivers a toxin, a cytokine, costimulatory ligand, or inhibitor ligand and directs the molecule, cell or compound to the target cells expressing the peptide-MHC.
(62) In some aspects, the present disclosure provides a soluble T cell receptor (sTCR), which comprises (i) all or part of a TCR chain (e.g., SEQ ID NO: 2 or 3), except the transmembrane domain thereof, and (ii) all or part of a TCR chain (e.g., SEQ ID NO: 4 or 5), except the transmembrane domain thereof, wherein (i) and (ii) each comprise a functional variable domain and at least a part of the constant domain of the TCR chain, and are linked by a disulfide bond between constant domain residues which is not present in native TCR.
(63) In some aspects, the soluble TCR comprises a TCR or chain extracellular domain dimerized to a TCR or chain extracellular domain respectively, by means of a pair of C-terminal dimerization peptides, such as leucine zippers.
(64) A soluble TCR of the present disclosure may be provided in substantially pure form, or as a purified or isolated preparation. For example, it may be provided in a form which is substantially free of other proteins.
(65) A plurality of soluble TCRs of the present disclosure may be provided in a multivalent complex. Thus, the present disclosure provides, in one aspect, a multivalent TCR complex, which comprises a plurality of soluble TCRs as described herein. Each of the plurality of soluble TCRs is preferably identical.
(66) In its simplest form, a multivalent TCR complex according to the present disclosure comprises a multimer of two or three or four or more T cell receptor molecules associated (e.g. covalently or otherwise linked) with one another, preferably via a linker molecule. Suitable linker molecules include, but are not limited to, multivalent attachment molecules such as avidin, streptavidin, neutravidin and extravidin, each of which has four binding sites for biotin. Thus, biotinylated TCR molecules can be formed into multimers of TCRs having a plurality of TCR binding sites. The number of TCR molecules in the multimer will depend upon the quantity of TCR in relation to the quantity of linker molecule used to make the multimers, and also on the presence or absence of any other biotinylated molecules. Preferred multimers are dimeric, trimeric or tetrameric TCR complexes.
(67) Suitable structures for use in the present methods include membrane structures such as liposomes and solid structures which are preferably particles such as beads, for example latex beads. Other structures which may be externally coated with T cell receptor molecules are also suitable. Preferably, the structures are coated with T cell receptor multimers rather than with individual T cell receptor molecules.
(68) In the case of liposomes, the T cell receptor molecules or multimers thereof may be attached to or otherwise associated with the membrane. Techniques for this are well known to those skilled in the art.
(69) A label or another moiety, such as a toxic or therapeutic moiety, may be included in a multivalent TCR complex of the present disclosure. For example, the label or other moiety may be included in a mixed molecule multimer. An example of such a multimeric molecule is a tetramer containing three TCR molecules and one peroxidase molecule. This could be achieved by mixing the TCR and the enzyme at a molar ratio of 3:1 to generate tetrameric complexes, and isolating the desired complex from any complexes not containing the correct ratio of molecules. These mixed molecules could contain any combination of molecules, provided that steric hindrance does not compromise or does not significantly compromise the desired function of the molecules. The positioning of the binding sites on the streptavidin molecule is suitable for mixed tetramers since steric hindrance is not likely to occur.
(70) The TCR (or multivalent complex thereof) of the present disclosure may alternatively or additionally be associated with (e.g. covalently or otherwise linked to) a therapeutic agent which may be, for example, a toxic moiety for use in cell killing, or an immunostimulating agent such as an interleukin or a cytokine. A multivalent TCR complex of the present disclosure may have enhanced binding capability for a TCR ligand compared to a non-multimeric T cell receptor heterodimer. Thus, the multivalent TCR complexes according to the present disclosure are particularly useful for tracking or targeting cells presenting particular antigens in vitro or in vivo, and are also useful as intermediates for the production of further multivalent TCR complexes having such uses. The TCR or multivalent TCR complex may therefore be provided in a pharmaceutically acceptable formulation for use in vivo.
(71) The present disclosure also provides a method for delivering a therapeutic agent to a target cell, which method comprises contacting potential target cells with a TCR or multivalent TCR complex in accordance with the present disclosure under conditions to allow attachment of the TCR or multivalent TCR complex to the target cell, said TCR or multivalent TCR complex being specific for the TCR ligand and having the therapeutic agent associated therewith.
(72) In particular, the soluble TCR or multivalent TCR complex can be used to deliver therapeutic agents to the location of cells presenting a particular antigen. This would be useful in many situations and, in particular, against tumors. A therapeutic agent could be delivered such that it would exercise its effect locally but not only on the cell it binds to. Thus, one particular strategy envisages anti-tumor molecules linked to T cell receptors or multivalent TCR complexes specific for tumor antigens.
(73) Many therapeutic agents could be employed for this use, for instance radioactive compounds, enzymes (perforin for example) or chemotherapeutic agents (cisplatin for example). To ensure that toxic effects are exercised in the desired location the toxin could be inside a liposome linked to streptavidin so that the compound is released slowly. This will prevent damaging effects during the transport in the body and ensure that the toxin has maximum effect after binding of the TCR to the relevant antigen presenting cells.
(74) The soluble TCRs of the present disclosure may be used to modulate T cell activation by binding to specific TCR ligand and thereby inhibiting T cell activation. Autoimmune diseases involving T cell-mediated inflammation and/or tissue damage would be amenable to this approach, for example type I diabetes. Knowledge of the specific peptide epitope presented by the relevant pMHC is required for this use.
(75) The use of the soluble TCRs and/or multivalent TCR complexes of the present disclosure in the preparation of a composition for the treatment of cancer or autoimmune disease is also envisaged.
(76) Also provided is a method of treatment of cancer or autoimmune disease comprising administration to a patient in need thereof of an effective amount of the soluble TCRs and/or multivalent TCR complexes of the present disclosure.
(77) As is common in anti-cancer and autoimmune therapy the soluble TCRs of the present disclosure may be used in combination with other agents for the treatment of cancer and autoimmune disease, and other related conditions found in similar patient groups.
III. Methods of Use
(78) In another aspect, provided herein are methods for treating cancer in a subject comprising administering to the subject a therapeutically effective amount of the population of MAGE-B2 TCR-specific cells, such as T cells, NK cells, invariant NK cells, NKT cells, MSCs, or iPS cells, produced by any of the methods provided herein. The cells may be adoptively transferred to a subject with a cancer from which TILs may be cultured from or tumor antigen-specific CTLs can be generated from in vitro.
(79) Provided herein are methods for treating or delaying progression of cancer in an individual comprising administering to the individual an effective amount a MAGE-B2-specific T cell therapy. Adoptive T cell therapies with genetically engineered TCR-transduced T cells (conjugate TCR to other bioreactive proteins (e.g., anti-CD3)) are also provided herein. In further embodiments, methods are provided for the treatment of cancer comprising immunizing a subject with a purified tumor antigen or an immunodominant tumor antigen-specific peptide.
(80) The MAGE-B2 peptide provided herein can be utilized to develop cancer vaccines or immunogens. These peptide specific vaccines or immunogens can be used for immunizing cancer patients directly to induce anti-tumor immuno-response in vivo, or for expanding antigen specific T cells in vitro with peptide or coded polynucleotide loaded APC stimulation. These large number of T cells can be adoptively transferred to patients to induce tumor regression.
(81) Tumors for which the present treatment methods are useful include any malignant cell type expressing MAGE-B2, such as those found in a solid tumor or a hematological tumor. Exemplary solid tumors can include, but are not limited to, a tumor of an organ selected from the group consisting of pancreas, colon, cecum, stomach, brain, head, neck, ovary, kidney, larynx, sarcoma, lung, bladder, melanoma, prostate, and breast. Exemplary hematological tumors include tumors of the bone marrow, T or B cell malignancies, leukemias, lymphomas, blastomas, myelomas, and the like. Further examples of cancers that may be treated using the methods provided herein include, but are not limited to, lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, various types of head and neck cancer, and melanoma.
(82) The cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma; endometroid carcinoma; skin appendage carcinoma; apocrine adenocarcinoma; sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma; cystadenocarcinoma; papillary cystadenocarcinoma; papillary serous cystadenocarcinoma; mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma; inflammatory carcinoma; paget's disease, mammary; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignant; thecoma, malignant; granulosa cell tumor, malignant; androblastoma, malignant; sertoli cell carcinoma; leydig cell tumor, malignant; lipid cell tumor, malignant; paraganglioma, malignant; extra-mammary paraganglioma, malignant; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; lentigo malignant melanoma; acral lentiginous melanomas; nodular melanomas; malignant melanoma in giant pigmented nevus; epithelioid cell melanoma; blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma, malignant; myxosarcoma; liposarcoma; leiomyosarcoma; rhabdomyosarcoma; embryonal rhabdomyosarcoma; alveolar rhabdomyosarcoma; stromal sarcoma; mixed tumor, malignant; mullerian mixed tumor; nephroblastoma; hepatoblastoma; carcinosarcoma; mesenchymoma, malignant; brenner tumor, malignant; phyllodes tumor, malignant; synovial sarcoma; mesothelioma, malignant; dysgerminoma; embryonal carcinoma; teratoma, malignant; struma ovarii, malignant; choriocarcinoma; mesonephroma, malignant; hemangiosarcoma; hemangioendothelioma, malignant; Kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma; osteosarcoma; juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; giant cell tumor of bone; ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma; astrocytoma; protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor; meningioma, malignant; neurofibrosarcoma; neurilemmoma, malignant; granular cell tumor, malignant; malignant lymphoma; Hodgkin's disease; Hodgkin's; paragranuloma; malignant lymphoma, small lymphocytic; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specified non-hodgkin's lymphomas; B-cell lymphoma; low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; Waldenstrom's macroglobulinemia; malignant histiocytosis; multiple myeloma; mast cell sarcoma; immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryoblastic leukemia; myeloid sarcoma; hairy cell leukemia; chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); acute myeloid leukemia (AML); and chronic myeloblastic leukemia.
(83) In certain embodiments, the method further comprises a step of performing lymphodepletion prior to administration of the therapeutically effective amount of the population of MAGE-B2 TCR cells. In certain embodiments, the lymphodepletion comprises non-myeloablative lymphodepleting chemotherapy. In certain embodiments, the non-myeloablative lymphodepleting chemotherapy comprises administration of cyclophosphamide and fludarabine.
(84) In certain embodiments, the method further comprises a step of administering a T-cell growth factor that promotes the growth and activation of autologous T cells to the subject, either concomitantly with the autologous T cells or subsequently to the autologous T cells. In certain embodiments, the T cell growth factor comprises any suitable growth factor that promotes the growth and activation of the autologous T-cells. In certain embodiments, the T cell growth factor is selected from the group consisting of interleukin (IL)-2, IL-7, IL-15, and IL-12, and combinations thereof (e.g., IL-2 and IL-7, IL-2 and IL-15, IL-7 and IL-15, IL-2, IL-7 and IL-15, IL-12 and IL-7, IL-12 and IL-15, or IL-12 and IL-2).
(85) In certain embodiments, the therapeutically effective amount of the population of MAGE-B2 TCR-specific cells produced by any of the methods provided herein is administered to the subject intravenously, intratumorally, or intraperitoneally. The appropriate dosage of the cell therapy may be determined based on the type of cancer to be treated, the severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.
(86) A. Combination Therapies
(87) In certain embodiments, the methods provided herein further comprise a step of administering at least one additional therapeutic agent to the subject. All additional therapeutic agents disclosed herein will be administered to a subject according to good clinical practice for each specific composition or therapy, taking into account any potential toxicity, likely side effects, and any other relevant factors.
(88) In certain embodiments, the additional therapy may be immunotherapy, radiation therapy, surgery (e.g., surgical resection of a tumor), chemotherapy, bone marrow transplantation, or a combination of the foregoing. The additional therapy may be targeted therapy. In certain embodiments, the additional therapy is administered before the primary treatment (i.e., as adjuvant therapy). In certain embodiments, the additional therapy is administered after the primary treatment (i.e., as neoadjuvant therapy.
(89) In certain embodiments, the additional therapy comprises an immunotherapy. In certain embodiments, the immunotherapy comprises an immune checkpoint inhibitor. In certain embodiments, the immune checkpoint inhibitor inhibits an immune checkpoint protein selected from the group consisting of programmed cell death pathway 1 (PD-1/CD279) and its ligands (PD-L1/CD274 and PD-L2/CD273), cytotoxic T lymphocyte-associated antigen 4 (CTLA-4/CD152), lymphocyte-activation gene 3 (LAG-3/CD223), B and T lymphocyte attenuator (BTLA), T cell immunoreceptor with Ig and immunoreceptor tyrosine-based inhibitory motif (ITIM) domains (TIGIT), T cell immunoglobulin domain and mucin domain 3 (TIM-3/HAVcr2), killer immunoglobulin-like receptor (KIR/CD158), V-domain immunoglobulin suppressor of T cell activation (VISTA), and the adenosine A2a receptor (A2aR).
(90) In certain embodiments, the immune checkpoint inhibitor is a PD-1 binding antagonist. In certain embodiments, the PD-1 binding antagonist is an anti-PD-1 antibody. In certain embodiments, the anti-PD-1 antibody is selected from the group consisting of nivolumab, pembrolizumab, and CT-011. In certain embodiments, the PD-1 binding antagonist is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PDL1 or PDL2 fused to an immunoglobulin constant region (e.g., an Fc region of an immunoglobulin sequence).
(91) In certain embodiments, the immune checkpoint inhibitor is a CTLA-4 binding antagonist. In certain embodiments, the CTLA-4 binding antagonist is an anti-CTLA-4 antibody. In certain embodiments, the anti-CTLA-4 antibody is selected from the group consisting of ipilimumab and tremelimumab.
(92) In certain embodiments, the additional therapeutic agent comprises treatment with radiotherapy. In certain embodiments, the radiotherapy is selected from the group consisting of gamma rays (-rays), X-rays, microwaves, proton beam irradiation, ultraviolet irradiation, and the directed delivery of radioisotopes to the tumor. In certain embodiments, the radiotherapy comprises treatment with X-rays. In certain embodiments, the X-rays are administered in daily doses of 50 to 200 roentgens over a period of three to four weeks. In certain embodiments, the X-rays are administered in a single dose of 2000 to 6000 roentgens. In certain embodiments, the radiotherapy comprises directed delivery of radioisotopes to the tumor. Dosage ranges for radioisotopes vary widely depending on the half-life of the isotope, the strength and type of radiation emitted, and the degree of uptake by tumor cells, but determination of an appropriate therapeutically effective dose is within the level of ordinary skill in the art.
(93) In certain embodiments, the additional therapeutic agent comprises administration of agents for the treatment of side-effects associated with the primary treatment (e.g., nausea, cachexia, and the like). In certain embodiments, the additional therapy comprises an immunotherapy. In certain embodiments, the additional therapy comprises radiation therapy. In some embodiments, the radiotherapy comprises gamma irradiation. In certain embodiments, the additional therapy comprises surgery. In certain embodiments, the additional therapy comprises a combination of radiation therapy and surgery. In certain embodiments, the additional therapy comprises treatment with a class of chemotherapeutic agent selected from the group consisting of alkylating agents, anthracyclines, cytoskeletal disruptors, epothilones, histone deacetylase inhibitors, topoisomerase I inhibitors, topoisomerase II inhibitors, kinase inhibitors, nucleotide analogs and nucleotide precursor analogs, peptide antibiotics, platinum-based compounds, retinoids, vinca alkaloids and derivatives thereof.
(94) The additional therapies contemplated herein may be administered before, after, or concurrently with administration of the compositions provided herein. In certain embodiments, the additional therapy is administered before the compositions provided herein. In certain embodiments, the additional therapy is administered after the compositions provided herein. In certain embodiments, the additional therapy is administered at one or more intervals before or after administration of the compositions provided herein. Determination of an appropriate interval for administration of an additional therapy such that the subject being treated benefits from the combination therapy is within the level of ordinary skill in the art.
(95) B. Pharmaceutical Compositions
(96) In another aspect, provided herein are pharmaceutical compositions and formulations comprising MAGE-B2 TCR-specific cells and a pharmaceutically acceptable carrier.
(97) Pharmaceutical compositions and formulations as described herein can be prepared by mixing the active ingredients (such as an antibody or a polypeptide) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 22.sup.nd edition, 2012), in the form of aqueous solutions, such as normal saline (e.g., 0.9%) and human serum albumin (e.g., 10%). Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e g Zinc-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
IV. Examples
(98) The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1Production and Characterization of MAGE-B2-Specific T Cells
(99) The expression of MAGE-B2 was analyzed in lung cancer cell lines and immortalized normal human small air epithelial cells (HSAEC1-KT and HSAEC2-KT) (
(100) To generate MAGE-B2 specific CD8+ CTLs, dendritic cells were pulsed with RNA encoding the MAGE-B2 HLA-A2 restricted epitope. Next, T cells were stimulated with the pulsed dendritic cells and the CD8.sup.+ tetramers with detected by flow cytometry. The T cells were then sorted, cloned and expanded by the random expansion protocol (REP). The T cells were then characterized by functional screening before cloning of the functional MAGE-B2-specific TCR.
(101) Thus, the MAGE-B2 HLA-A2 restricted epitope was used for the generation of MAGE-B2-specific cytotoxic T lymphocytes (CTLs). Nave T cells were derived from a healthy HLA-A2 donor and stimulated with autogeneous mature dendritic cells (mDC) pulsed with full length MAGE-B2 RNA. After two rounds of stimulation, a tetramer with the HLA-A2 restricted MAGE-B2 epitope (GVYDGEEHSV; SEQ ID NO: 1) was used to detect the T cell population which recognized the epitope. The CD8.sup.+tetramer.sup.+ population was then sorted and expanded with the rapid expansion protocol (REP) to generate the CTL cell line. The correlated CTL clones were generated using the limiting dilution method. Over 99% of the cells were observed to be CD8.sup.+ and tetramer.sup.+ (
(102) Functional avidity of the MAGE-B2-specific T cells was tested next. In a peptide titration assay, T2 cells were pulsed with different concentration of MAGE-B2 peptide (from 10 pg/ml to 10 g/ml) (
(103) To generate MAGE-B2 TCR engineered T cells (TCR-T), the TCR from the MAGE-B2 CTL clone was cloned out and inserted into the retrovirus vector pMSGV1. A linker fragment containing a Furin cleavage site, a SGSG linker and a P2A cleavage site was inserted between the TCR- chain and TCR- chain to guarantee that both chains were expressed equally under the MSCV promoter. The recombinant retrovirus was generated by co-transfection of the retrovirus vector and an envelope vector RD114 into the package cell line GP2-293. Two to three days after transfection, the supernatant containing the retrovirus was used to infect the allogeneic PBMCs which were activated for two days with 50 ng/mg OKT3 and 300 U/ml IL-2 stimulation. The infection was performed one more time after one day of the first infection. After 5 days, a clear CD8.sup.+Tetramer.sup.+ population was detected by flow cytometry (
(104) A peptide titration assay was performed with T2 cells pulsed with different concentrations of MAGE-B2 peptide (from 10 pg/ml to 10 g/ml) as target cells. The T2 cells were co-cultured with the MAGE-B2 TCR-T cell line (E:T=20:1). The cytotoxicity was detected with the standard .sup.51Cr release assay (
(105) Finally, the MAGE-B2 TCR-T cells were functionally characterized by intracellular cytokine staining (ICS). The MAGE-B2 TCR-T cell line was co-cultured with the lung cancer cell line H2023, normal lung cell line HSAEC2-KT, T2 pulsed with MAGE-B2 peptide, as well as T2 pulsed with MART-1 peptide M26. The IFN-, TNF-, IL-2 and antigen specific response markers CD137 and CD69 were detected by the ICS assay. After co-culturing, IFN-, TNF-, IL-2, CD137 and CD69 levels of MAGE-B2 TCR-T cell line were significantly enhanced when the TCR-T cells were co-cultured with the lung cancer cell line H2023 or T2 pulsed with MAGE-B2 peptide, compared with co-culture with the normal lung cell line HSAEC2-KT or T2 pulsed with control peptide M26 (
(106) Thus, the MAGE-B2 TCR-T cells may be used for the treatment of HLA-A2 (e.g., HLA-A*0201, HLA-A*0202, HLA-A*0203, HLA-A*0204, or HLA-A*0205) positive patients with advanced or recurrent cancer, such as by generating and expanding TCR gene modified CTLs using allogeneic PBMCs. After functional detection (e.g., phenotype and cytotoxicity), the TCR modified T cells are infused to patients.
Example 2Materials and Methods
(107) Generate T Cell Clone:
(108) Full length MAGE-B2 RNA was transfected to matured dendritic cells (DCs) derived from an HLA-A2 healthy donor. The RNA transfected DC were co-cultured with nave T cell at the ratio of DC:T=1:10 in the presence of IL-21. After one week, the RNA-transfected DC were used to re-stimulate the T cells. After two rounds of stimulation, the CD8 and tetramer double positive T cell population was sorted and expanded with the rapid expansion protocol (REP). The T cell clones were generated with the limiting dilution method. The high activity CTL clones were screened via a cytotoxicity assay against cancer cells.
(109) T Cell Receptor (TCR) Cloning and Retrovirus Expression Vector Construction:
(110) The TCR (including alpha chain and beta chain) were cloned using the 5-RACE method according manufacturer's instructions. The TCR V-alpha and TCR V-beta usage were identified with the IMGT/V-QUEST annotation tool. For the TCR expression retrovirus vector construction, the forward primers were designed according to the TCR V-alpha or beta usage. The reverse primers were designed according to the sequence of TCR alpha or beta constant region. Expression cassettes containing the alpha- and beta-TCR chains separated by the Furin and P2A linker peptide were generated and the full-length PCR products were cloned into the retrovirus vector pMSGV1. The cloned DNA sequences were verified with sequencing.
(111) Retrovirus Generation and Infection of Human Peripheral Blood Lymphocytes (PBL):
(112) The pMSGV1 vector containing the TCR and the envelope vector RD114 were co-transfected to the package cell line GP2-293. After transfection for 6-8 hours, the medium was refreshed. The supernatant was harvested 24 hours later and was added to the 6 well plate which has been coated with 20 g/mL RetroNectin followed by centrifugation (2000g) at 32 C. for 2 hours. The supernatant was removed then and the PBL which were activated with 50 ng/ml OKT3 and 300 U/ml IL-2 for two days were added to the retrovirus loaded plate followed by centrifugation (1000g) at 32 C. for 10 min Cells were then incubated overnight at 32 C., and the procedure was repeated the following day (total of two transductions). After that, the cells were expanded at 37 C. in a 5% CO2 incubator and split as necessary.
(113) TCR Engineered T Cell Clone Generation:
(114) After infection, the CD8.sup.+ and tetramer.sup.+ T cell population were sorted and expanded with rapid expansion protocol (REP).
(115) .sup.51Cr Release Assay:
(116) The killing ability of the TCR engineered T cell or CTL clone to lyse HLA-A2 tumor targets was measured using a standard .sup.51Cr release assay. Tumor cells or normal cells were labeled for 2 h at 37 C. with 200 Ci of .sup.51Cr. Labeled target cells were washed and then incubated with effector cells at the different ratios for 4 h at 37 C. in 0.2 ml of complete medium. Harvested supernatants were counted using automatic gamma counter. Maximal and spontaneous .sup.51Cr release was determined by incubating the labeled target cells in either trypan lysis buffer or medium for 4 h at 37 C. Each data point was determined as an average of quadruplicate wells. The percent specific lysis was calculated as follows: % killing=((specific releasespontaneous release)/(total releasespontaneous release))100.
(117) Intracellular Cytokine Staining (ICS) Assay:
(118) The T cells were incubated with target cells at 10:1 ration in the presence of brefeldin A (BFA) at 37 C. overnight. After co-culturing, the T cells were harvested and washed. The cells were stained with flow antibody anti surface marker first. After that, the cells were washed and fixed with Fix Buffer and then were permeabilized using Permeabilizing Solution. Permeabilized cells are then stained with intracellular cytokine flow antibody. Finally, the level of cytokine producing in the cells was analyzed using FACS.
Example 3Generation of MAGE-B2 HLA-A2 Restricted-Peptide (MB2-231)-Specific TCR-T Generation
(119) Additional MAGE-B2 specific T cell products were generated using MAGE-B2 peptide (GVYDGEEHSV; SEQ ID NO: 1) pulsed dendritic cells to stimulate the PBMC derived from the same healthy donor (
(120) The functional avidity of 3 MAGE-B2 specific CTL cell lines was shown by the lysis of T2 cell lines pulsed with various concentrations of MAGE-B2 peptide (GVYDGEEHSV; SEQ ID NO: 1) with an effector to target (E:T) ratio of 20:1. The cytotoxicity was detected with the standard 51Cr release assay (
(121) To generate MAGE-B2 TCR engineered T cells (TCR-T), the TCR from the MAGE-B2 CTL cell line C5 was cloned out and inserted into the retrovirus vector pMSGV1. A linker fragment containing a Furin cleavage site, a SGSG linker and a P2A cleavage site was inserted between the TCR- chain and TCR- chain to guarantee that both chain were expressed equally under the MSCV promoter. The recombinant retrovirus was generated by co-transfection of the retrovirus vector and an envelope vector RD114 into the package cell line Phoenix-GP. Two to three days after transfection, the supernatant containing the retrovirus was used to infect the allogeneic HLA-A*0201+healthy donor's PBMCs which were activated for two days with 50 ng/mg OKT3 and 300 U/ml IL-2 stimulation. After 5 days, a clear CD8+Tetramer+ population was detected by flow cytometry (
(122) Finally, the MAGE-B2 TCR-T cells were functionally characterized by intracellular cytokine staining (ICS). The MAGE-B2 TCR-T cell line was co-cultured with the T2 pulsed with MAGE-B2 peptide (GVYDGEEHSV; SEQ ID NO: 1), as well as T2 pulsed with MART-1 peptide M26 (as control) (
(123) All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
REFERENCES
(124) The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. Barnea et al., Eur J Immunol, 32(1):213-22, 2002. Remington: The Science and Practice of Pharmacy, 22nd Edition, Pharmaceutical Press, 2012. Shraibman et al., Mol Cell Proteomics, 15(9):3058-70, 2016.