ANTI-BCMA NANOBODY AND USE THEREOF
20250026844 · 2025-01-23
Inventors
- Yayuan Fu (Shanghai, CN)
- Shumei YOU (Shanghai, CN)
- Bowei Yin (Shanghai, CN)
- Zhuoxiao Cao (Shanghai, CN)
- Renhong Tang (Shanghai, CN)
- Jinsheng REN (Jiangsu, CN)
Cpc classification
A61K49/0002
HUMAN NECESSITIES
C07K16/2863
CHEMISTRY; METALLURGY
C07K16/2875
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K16/283
CHEMISTRY; METALLURGY
A61K51/1033
HUMAN NECESSITIES
C07K16/22
CHEMISTRY; METALLURGY
G01N2333/70578
PHYSICS
C07K2317/22
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K51/10
HUMAN NECESSITIES
C07K16/22
CHEMISTRY; METALLURGY
Abstract
An antibody, or an antigen-binding fragment of same, specifically binding to a BCMA, a nucleic acid encoding same, an expression vector and an expression cell thereof, a preparation method therefor, a pharmaceutical composition thereof, and the use thereof in treating a disease, for example, the use thereof in treating a tumour.
Claims
1. An antibody or an antigen-binding fragment thereof that specifically binds to BCMA, wherein the antibody or the antigen-binding fragment thereof comprises CDR1, CDR2 and CDR3, and the CDR1 comprises HCDR1 of a VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101, the CDR2 comprises HCDR2 of a VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101, and the CDR3 comprises HCDR3 of a VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101.
2. The antibody or the antigen-binding fragment thereof of claim 1, wherein the HCDR1, HCDR2 and HCDR3 are determined according to the Kabat, IMGT or Chothia numbering system; optionally, the HCDR1 comprises an amino acid sequence as represented by SEQ ID NO: 34, 37, 40, 42, 45, 48, 50, 52, 54, 56, 58, 64, 67, 71, 74, 77, 81, 84, 86, 87, 104, 107, 113, 116, 119, 121, 124, 127, 131, 134, 138 or 141; optionally, the HCDR2 comprises an amino acid sequence as represented by SEQ ID NOs: 35, 38, 41, 43, 46, 49, 59, 61, 63, 65, 68, 70, 72, 75, 78, 79, 82, 85, 88, 89, 90, 91, 102, 105, 108, 109, 111, 114, 117, 120, 122, 125, 128, 129, 132, 135, 136, 139, 142, 143, 148, 150, 152, 153, 155 or 157; optionally, the HCDR3 comprises an amino acid sequence as represented by SEQ ID NO: 36, 39, 44, 47, 51, 53, 55, 57, 60, 62, 66, 69, 73, 76, 80, 83, 103, 106, 110, 112, 115, 118, 123, 126, 130, 133, 137, 140, 144, 145, 146, 147, 149, 151, 154 or 156; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 35 and 36; SEQ ID NOs: 37, 38 and 39; or SEQ ID NOs: 40, 41 and 36, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 42, 43 and 44; SEQ ID NOs: 45, 46 and 47; or SEQ ID NOs: 48, 49 and 44, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 50, 35 and 51; SEQ ID NOs: 52, 38 and 53; or SEQ ID NOs: 54, 41 and 51, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 35 and 55; SEQ ID NOs: 56, 38 and 57; or SEQ ID NOs: 58, 41 and 55, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 59 and 60; SEQ ID NOs: 56, 61 and 62; or SEQ ID NOs: 58, 63 and 60, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 64, 65 and 66; SEQ ID NOs: 67, 68 and 69; or SEQ ID NOs: 58, 70 and 66, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 71, 72 and 73; SEQ ID NOs: 74, 75 and 76; or SEQ ID NOs: 77, 78 and 73, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 79 and 80; SEQ ID NOs: 81, 82 and 83; or SEQ ID NOs: 84, 85 and 80, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 86, 35 and 36 respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 87, 88 and 44 respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 42, 88 and 44 respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 42, 89 and 44 respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 42, 90 and 44 respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 42, 91 and 44 respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 71, 102 and 103; SEQ ID NOs: 104, 105 and 106; or SEQ ID NOs: 107, 108 and 103, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 71, 109 and 110; SEQ ID NOs: 104, 111 and 112; or SEQ ID NOs: 107, 108 and 110, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 113, 114 and 115; SEQ ID NOs: 116, 117 and 118; or SEQ ID NOs: 119, 120 and 115, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 121, 122 and 123; SEQ ID NOs: 124, 125 and 126; or SEQ ID NOs: 127, 128 and 123, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 113, 129 and 130; SEQ ID NOs: 131, 132 and 133; or SEQ ID NOs: 134, 135 and 130, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 113, 136 and 137; SEQ ID NOs: 138, 139 and 140; or SEQ ID NOs: 141, 142 and 137, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 143 and 144; SEQ ID NOs: 37, 38 and 145; or SEQ ID NOs: 40, 41 and 144, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 143 and 146; SEQ ID NOs: 56, 38 and 147; or SEQ ID NOs: 58, 41 and 146, respectively; preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 34, 148 and 149; SEQ ID NOs: 37, 150 and 151; or SEQ ID NOs: 40, 152 and 149, respectively; and preferably, the HCDR1, HCDR2 and HCDR3 comprise amino acid sequences as represented by SEQ ID NOs: 71, 153 and 154; SEQ ID NOs: 104, 155 and 156; or SEQ ID NOs: 107, 157 and 154, respectively.
3. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the CDR1, CDR2 and/or CDR3 comprise(s) an amino acid sequence with 1, 2 or 3 mutations on the HCDR1, HCDR2 and/or HCDR3 of claim 1; the mutations are selected from insertion, deletion and/or substitution, and the substitution is preferably a conservative amino acid substitution.
4. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the CDR1, CDR2 and/or CDR3 comprise(s) an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the aforementioned HCDR1, HCDR2 and/or HCDR3.
5. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the antibody or the antigen-binding fragment thereof comprises a single domain antibody, and the single domain antibody comprises the CDR1, CDR2 and CDR3 of claim 1; preferably, the single domain antibody comprises an amino acid sequence as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101; optionally, the single domain antibody comprises an amino acid sequence with at most 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation relative to the amino acid sequence as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101, the mutation is selected from insertion, deletion and/or substitution, and the substitution is preferably a conservative amino acid substitution; optionally, the single domain antibody comprises an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the amino acid sequence as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101.
6. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the antibody comprises an FR region in the VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101; optionally, the antibody comprises an amino acid sequence with at most 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation relative to the FR region in the VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101, the mutation is selected from insertion, deletion and/or substitution, and the substitution is preferably a conservative amino acid substitution; optionally, the antibody comprises an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the FR region in the VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101.
7. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the antibody or the antigen-binding fragment thereof is selected from: (1) a chimeric antibody or a fragment thereof; (2) a humanized antibody or a fragment thereof; or (3) a fully human antibody or a fragment thereof.
8. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the antibody or the antigen-binding fragment thereof comprises or does not comprise an antibody heavy chain constant region; optionally, the antibody heavy chain constant region is selected from humans, llamas, mice, rats, rabbits and goats; optionally, the antibody heavy chain constant region is selected from IgG, IgM, IgA, IgE and IgD; optionally, the IgG is selected from IgG1, IgG2, IgG3 and IgG4; optionally, the heavy chain constant region is selected from an Fc region, a CH3 region and a complete heavy chain constant region, preferably, the heavy chain constant region is a human Fc region; and preferably, the antibody or the antigen-binding fragment thereof is a heavy chain antibody.
9. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the antibody or the antigen-binding fragment thereof is further coupled with a therapeutic agent or a tracer; preferably, the therapeutic agent is selected from a radioisotope, a chemotherapeutic drug and an immunomodulator, and the tracer is selected from a radiological contrast agent, a paramagnetic ion, a metal, a fluorescent tag, a chemiluminescence tag, an ultrasonic contrast agent and a photosensitizer.
10. The antibody or the antigen-binding fragment thereof of claim 1, wherein, the antibody or the antigen-binding fragment thereof is also linked to other functional molecules, and preferably, the other functional molecules are selected from one or more of the following: a signal peptide, a protein tag, a cytokine, an angiogenesis inhibitor and an immune checkpoint inhibitor.
11. A multispecific antigen-binding molecule, wherein the multispecific antigen-binding molecule comprises the antibody or the antigen-binding fragment thereof of claim 1, and an antigen-binding molecule binding to an antigen other than BCMA or binding to a different BCMA epitope than that of the antibody or the antigen-binding fragment thereof of claim 1; optionally, the antigen other than BCMA is selected from: CD3 (preferably CD3), CD16, CD137, CD258, PD-1, PD-L1, 4-1BB, CD40, CD64, EGFR, VEGF, HER2, HER1, HER3, IGF-1R, phosphatidylserine (PS), C-Met, HSA, GPRC5D, MSLN, blood-brain barrier receptor, GPC3, PSMA, CD33, GD2, ROR1, ROR2, FR and Gucy2C; preferably, the antigen-binding molecule is an antibody or an antigen-binding fragment thereof; preferably, the multispecific antigen-binding molecule is bispecific, trispecific or tetraspecific; preferably, the multispecific antigen-binding molecule is bivalent, trivalent, tetravalent, pentavalent or hexavalent.
12. An isolated nucleic acid fragment, wherein the nucleic acid fragment encodes the antibody or the antigen-binding fragment thereof of claim 1.
13. A vector, wherein the vector comprises the nucleic acid fragment of claim 12.
14. A host cell, wherein the host cell comprises the nucleic acid fragment of claim 12; and preferably, the cell is a prokaryotic cell or a eukaryotic cell, such as a bacterial (for example, Escherichia coli) cell, a fungal (for example, yeast) cell, an insect cell or a mammalian cell (for example, a CHO cell line or a 293T cell line).
15. A method for preparing the antibody or the antigen-binding fragment thereof of claim 1, wherein the method comprises culturing the cell of claim 14, and isolating the antibody, the antigen-binding fragment or the multispecific antigen-binding molecule expressed by the cell.
16. A pharmaceutical composition, wherein the pharmaceutical composition comprises the antibody or the antigen-binding fragment thereof of claim 1, optionally, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, a diluent or an auxiliary agent; and optionally, the pharmaceutical composition further comprises an additional anti-tumor agent.
17. A method for treating a tumor or a cancer, wherein the method comprises administering to a subject an effective amount of the antibody or the antigen-binding fragment thereof of claim 1; optionally, the tumor or the cancer is a BCMA-expressing tumor or cancer, preferably, the tumor or the cancer is B-cell lymphoma; and more preferably multiple myeloma (MM).
18. (canceled)
19. (canceled)
20. A kit, wherein the kit comprises the antibody or the antigen-binding fragment thereof of claim 1.
21. A method for detecting BCMA expression in a biological sample, wherein the method comprises contacting the biological sample with the antibody or the antigen-binding fragment thereof of claim 1 under conditions that allow the formation of a complex from the antibody or the antigen-binding fragment thereof and BCMA; and preferably, the method further comprises detecting the formation of the complex, thereby indicating the presence or expression level of BCMA in the sample.
22. (canceled)
Description
BRIEF DESCRIPTION OF THE FIGURES
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
DETAILED DESCRIPTION OF THE INVENTION
Definition and Description of Terminology
[0042] Unless otherwise defined herein, scientific and technical terms related to the present application shall have the meanings understood by one of ordinary skill in the art.
[0043] In addition, unless otherwise specified herein, terms in the singular form herein shall include that in the plural form, and terms in the plural form shall include that in the singular form. More specifically, as used in the description and the appended claims, the singular forms a/an and this include plural referents, unless otherwise clearly stated.
[0044] The terms include, comprise and have are used interchangeably herein and are intended to indicate the inclusiveness of the solution, meaning that the solution can have other elements than those listed. Furthermore, it should be understood that the description of include, comprise and have as used herein also provides the solution of consist of.
[0045] The term and/or as used herein includes the meanings of and, or and all or any other combination of elements linked by the term.
[0046] The term BCMA herein is the abbreviated name of B cell maturation antigen, which is a member of the tumor necrosis factor receptor family. BCMA is mainly expressed on the surface of late B cells, short-lived proliferative plasma cells and long-lived plasma cells, and is not expressed in naive B cells, CD34-positive hematopoietic stem cells and other normal tissue cells, but is highly expressed in MM cells. BCMA plays a key role in the survival, proliferation, metastasis and drug resistance of MM cells by mediating downstream signaling pathways, thereby being an ideal target antigen for the treatment of MM.
[0047] The term specifically bind herein means that an antigen-binding molecule (e.g., an antibody) typically specifically binds to an antigen and substantially the same antigen with a high affinity, but does not bind to an unrelated antigen with a high affinity. Affinity is generally reflected by the equilibrium dissociation constant (KD), where lower KD indicates higher affinity. Taking an antibody as an example, a high affinity generally means having a KD of about 10.sup.6 M or less, about 10.sup.7 M or less, about 10.sup.8 M or less or about 10.sup.9 M or less. KD is calculated as follows: KD=Kd/Ka, where Kd represents the dissociation rate and Ka represents the binding rate. The equilibrium dissociation constant KD can be measured using well-known methods in the art, such as surface plasmon resonance (e.g., Biacore) or equilibrium dialysis assay.
[0048] The term antigen-binding molecule is used herein in the broadest sense and refers to a molecule specifically binding to an antigen. Exemplarily, the antigen-binding molecule includes, but is not limited to, an antibody or an antibody mimetic. The antibody mimetic refers to an organic compound or a binding domain that can specifically bind to an antigen, but is not structurally related to an antibody. Exemplarily, the antibody mimetic includes, but is not limited to, affibody, affitin, affilin, a designed ankyrin repeat protein (DARPin), a nucleic acid aptamer or a Kunitz-type domain peptide.
[0049] The term antibody is used herein in the broadest sense and refers to a polypeptide or a combination of polypeptides comprising sufficient sequences from a heavy chain variable region of an immunoglobulin and/or sufficient sequences from a light chain variable region of an immunoglobulin to be able to specifically bind to an antigen. The antibody herein encompasses various forms and various structures as long as they exhibit the desired antigen-binding activity. The antibody herein includes an alternative protein scaffold or artificial scaffold with grafted complementarity determining regions (CDRs) or CDR derivatives. Such scaffolds include antibody-derived scaffolds comprising mutations introduced, e.g., to stabilize the three-dimensional structure of the antibody, and fully synthetic scaffolds comprising, e.g., biocompatible polymers. See, e.g., Korndorfer et al., 2003, Proteins: Structure, Function, and Bioinformatics, 53(1):121-129 (2003); Roque et al., Biotechnol. Prog. 20: 639-654 (2004). Such scaffolds may also include non-antibody-derived scaffolds, for example, scaffold proteins known in the art which can be used for grafting CDRs, including but not limited to tenascin, fibronectin, a peptide aptamer, etc.
[0050] The term antibody includes an intact antibody and any antigen-binding fragment (i.e., antigen-binding moiety) or single chain thereof. The antibody refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains interconnected by a disulfide bond, or an antigen-binding moiety thereof. Each heavy chain consists of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region consists of three domains, CH1, CH2 and CH3. Each light chain consists of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region consists of one domain, CL. The VH and VL regions can be further subdivided into hypervariable regions known as complementarity determining regions (CDRs), which are interspersed among more conserved regions known as framework regions (FRs). Each VH and VL consists of three CDRs and four FRs, which are arranged in the following order from amino terminus to carboxyl terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that can interact with an antigen. The constant region of an antibody can mediate the binding of an immunoglobulin to a host tissue or factor, and the host tissue or factor includes various cells of the immune system (e.g., effector cells) and a first component of the classical complement system (C1q). Since the amino acid composition and arrangement sequence of the heavy chain constant region of an immunoglobulin are different, the antigenicity of the immunoglobulin is also different. Accordingly, immunoglobulin herein can be divided into five classes, or isotypes of immunoglobulins, namely IgM, IgD, IgG, IgA and IgE, and the corresponding heavy chains thereof are a chain, a chain, a chain, an chain and an chain, respectively. The same class of Ig can also be divided into different subclasses according to the differences in the amino acid composition of the hinge region thereof and the number and position of heavy chain disulfide bonds. For example, IgG can be divided into IgG1, IgG2, IgG3 and IgG4, and IgA can be divided into IgA1 and IgA2. The light chains are divided into a chain or a chain by the difference in the constant region. Each Ig class of the five Ig classes can have either a chain or a chain.
[0051] Antibody herein also includes an antibody that does not comprise light chains, for example, heavy-chain antibodies (HCAbs) produced from camelids, such as Camelus dromedarius, Camelus bactrianus, Lama glama, Lama guanicoe and Vicugna pacos, and Ig new antigen receptors (IgNARs) found in Chondrichthyes such as sharks.
[0052] The term antibody herein may be derived from any animal, including but not limited to humans and non-human animals selected from primates, mammals, rodents and vertebrates, such as Camelidae, Lama glama, Lama guanicoe, Vicugna pacos, sheep, rabbits, mice, rats or Chondrichthyes (such as sharks).
[0053] The term heavy chain antibody herein refers to an antibody that lacks light chains of a conventional antibody. The term specifically includes, but is not limited to, a homodimeric antibody comprising a VH antigen-binding domain and CH2 and CH3 constant domains in the absence of a CH1 domain.
[0054] The term nanobody herein refers to a single domain antibody, also known as VHH (Variable domain of heavy chain of heavy chain antibody) obtained by cloning the variable region of heavy chain antibody (a natural heavy chain antibody without light chains in camel, etc.), which only consists of a heavy chain variable region, and is the smallest functional antigen-binding fragment.
[0055] The terms VHH domain, nanobody and single domain antibody (sdAb) herein have the same meaning and are used interchangeably, and refer to a single domain antibody consisting of only one heavy chain variable region constructed by cloning the variable region of a heavy chain antibody, which is the smallest antigen-binding fragment with full functionality. Generally, a single domain antibody consisting of only one heavy chain variable region is constructed by obtaining a heavy chain antibody that naturally lacks light chains and heavy chain constant region 1 (CH1), and then cloning the heavy chain variable region of the antibody.
[0056] Further descriptions of heavy chain antibody and single domain antibody, and VHH domain and nanobody can be found in Hamers-Casterman et al., Nature. 1993; 363; 446-8; Muyldermans' review article (Reviews in Molecular Biotechnology 74: 277-302, 2001); and the following patent applications mentioned as general background art: WO 94/04678, WO 95/04079 and WO 96/34103; WO 94/25591, WO 99/37681, WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301, EP 1134231 and WO 02/48193; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527; WO 03/050531; WO 01/90190; WO 03/025020; and WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863, WO 04/062551, WO 05/044858, WO 06/40153, WO 06/079372, WO 06/122786, WO 06/122787 and WO 06/122825, and other prior art mentioned in these applications.
[0057] The term multispecific herein refers to the ability of an antibody or an antigen-binding fragment thereof to bind to, for example, different antigens or at least two different epitopes on the same antigen. Therefore, the terms such as bispecific, trispecific and tetraspecific refer to the number of different epitopes to which an antibody can bind. For example, a conventional monospecific IgG-type antibody has two identical antigen-binding sites (paratopes) and thus can only bind to the same epitope (rather than bind to different epitopes). In contrast, a multispecific antibody has at least two different types of paratopes/binding sites and thus can bind to at least two different epitopes. As described herein, complementarity determining region refers to an antigen-binding site of an antibody. Furthermore, single specific may refer to one, two, three or more identical complementarity determining regions in a single antibody (the actual number of complementarity determining regions/binding sites in a single antibody molecule is referred to as valent). For example, a single natural IgG antibody is monospecific and bivalent because it has two identical paratopes. Accordingly, a multispecific antibody comprises at least two (different) complementarity determining regions/binding sites. Therefore, the term multispecific antibody refers to an antibody that has more than one paratope and has the ability to bind to two or more different epitopes. The term multispecific antibody particularly includes the bispecific antibody as defined above, and generally also includes a protein, e.g., an antibody or a scaffold specifically binding to three or more different epitopes, i.e., an antibody having three or more paratopes/binding sites.
[0058] The term valent herein refers to the presence of a defined number of binding sites in an antibody/an antigen-binding molecule. Therefore, the terms monovalent, bivalent, tetravalent and hexavalent indicate the presence of one binding site, two binding sites, four binding sites and six binding sites in an antibody/antigen-binding molecule, respectively.
[0059] The full-length antibody, complete antibody and intact antibody are used interchangeably herein and mean that they have a structure substantially similar to that of a natural antibody.
[0060] The antigen-binding fragment and antibody fragment are used interchangeably herein, which do not possess the full structure of an intact antibody, and only comprise a part of an intact antibody or a variant of the part, wherein the part of the intact antibody or the variant of the part has the ability to bind to an antigen. Exemplarily, antigen-binding fragment or antibody fragment herein includes, but is not limited to, Fab, F(ab)2, Fab, Fab-SH, Fd, Fv, scFv, diabody and a single domain antibody.
[0061] The term chimeric antibody herein refers to an antibody that has a variable sequence of an immunoglobulin from a source organism (such as a rat, a mouse, a rabbit or a llama) and a constant region of an immunoglobulin from a different organism (such as human). Methods for producing a chimeric antibody are known in the art. See, for example, Morrison, 1985, Science 229(4719): 1202-7; Oi et al., 1986, Bio Techniques 4:214-221; and Gillies et al., 1985 J Immunol Methods 125:191-202; which are incorporated herein by reference.
[0062] The term humanized antibody herein refers to a non-human antibody that has been genetically engineered, with amino acid sequences modified to improve the homology with the sequences of a human antibody. Generally speaking, all or part of the CDR regions of a humanized antibody come from a non-human antibody (a donor antibody), and all or part of the non-CDR regions (for example, a variable region FR and/or a constant region) come from a human immunoglobulin (a receptor antibody). A humanized antibody usually retains or partially retains the expected properties of a donor antibody, including but not limited to, antigen specificity, affinity, reactivity, ability to enhance immune cell activity or ability to enhance immune response, etc.
[0063] The term fully human antibody herein refers to an antibody having variable regions in which both the FRs and CDRs are derived from human germline immunoglobulin sequences. Furthermore, if the antibody comprises a constant region, the constant region also is derived from human germline immunoglobulin sequences. The fully human antibody herein may include amino acid residues not encoded by human germline immunoglobulin sequences (for example, mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the fully human antibody herein does not include an antibody in which CDR sequences derived from the germline of another mammalian species (e.g., a mouse) have been grafted onto human framework sequences.
[0064] The term variable region herein refers to a region in the heavy or light chain of an antibody that is involved in enabling the antibody to bind to an antigen. Heavy chain variable region, VH and HCVR are used interchangeably, and light chain variable region, VL and LCVR are used interchangeably. The variable domains of the heavy and light chains of a natural antibody generally have similar structures, and each domain comprises four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, for example, Kindt et al., Kuby Immunology, 6th ed., W. H. Freeman and Co., p.91 (2007). A single VH or VL domain may be sufficient to confer antigen-binding specificity.
[0065] The terms complementarity determining region and CDR are used interchangeably herein and generally refer to hypervariable regions (HVRs) found in both light and heavy chain variable domains. The more conservative portion of a variable domain is called the framework region (FR). As understood in the art, the amino acid positions representing the hypervariable region of an antibody may vary according to the context and various definitions known in the art. Some positions within variable domains can be considered heterozygous hypervariable positions because these positions can be considered to be within the hypervariable regions under one set of criteria (such as IMGT or KABAT) but outside the hypervariable regions under a different set of criteria (such as KABAT or IMGT). One or more of these positions may also be found in extended hypervariable regions. The invention includes an antibody comprising modifications in these hybrid hypervariable positions. The heavy chain variable region CDR can be abbreviated as HCDR, and the light chain variable region CDR can be abbreviated as LCDR. The variable domains of a natural heavy chain and light chain each comprise four framework regions predominantly in a sheet configuration, which are linked by three CDRs (CDR1, CDR2 and CDR3) that form a loop linking the sheet structure, and in some cases form part of the sheet structure. The CDRs in each chain are closely held together in order of FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 by the FR region, and together with the CDRs from other antibody chains, contribute to the formation of an antigen-binding site of an antibody (see Kabat et al., Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda, Md.1987; which is incorporated herein by reference).
[0066] For a further description of CDR, with reference to Kabat et al., J. Biol. Chem., 252:6609-6616 (1977); Kabat et al., United States Department of Health and Human Services, Sequences of proteins of immunological interest (1991); Chothia et al., J. Mol. Biol. 196:901-917 (1987); Al-Lazikani B. et al., J.Mol. Biol., 273: 927-948(1997); MacCallum et al., J. Mol.Biol. 262:732-745 (1996); Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008); Lefranc M. P. et al., Dev. Comp. Immunol., 27: 55-77 (2003); and Honegger and Pluckthun, J. Mol. Biol., 309:657-670 (2001). The CDRs herein can be marked and defined by well-known methods in the art, including but not limited to Kabat numbering system, Chothia numbering system or IMGT numbering system. The tool websites used include, but are not limited to, AbRSA website (http://cao.labshare.cn/AbRSA/cdrs.php), abYsis website (www.abysis.org/abysis/sequence_input/key_annotation/key_annotation.cgi) and IMGT website (http://www.imgt.org/3Dstructure-DB/cgi/DomainGapAlign.cgi #results). The CDRs herein include overlaps and subsets of amino acid residues defined in different ways.
[0067] The term Kabat numbering system herein generally refers to the immunoglobulin alignment and numbering system proposed by Elvin A. Kabat (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991).
[0068] The term Chothia numbering system herein generally refers to the immunoglobulin numbering system proposed by Chothia et al., which is a classical rule for identifying the boundaries of CDR regions based on the location of structural loop regions (see, e.g., Chothia & Lesk (1987) J. Mol.Biol.196:901-917; Chothia et al. (1989) Nature 342:878-883).
[0069] The term IMGT numbering system herein generally refers to the numbering system based on The International ImMunoGeneTics Information System (IMGT) proposed by Lefranc et al., see Lefranc et al., Dev. Comparat. Immunol. 27:55-77, 2003.
[0070] The term heavy chain constant region herein refers to the carboxyl terminus portion of an antibody heavy chain, which is not directly involved in the binding of an antibody to an antigen, but exhibits an effector function, such as an interaction with an Fc receptor, and has a more conservative amino acid sequence relative to the variable domain of an antibody. The heavy chain constant region is selected from a CH1 domain, a hinge region, a CH2 domain, a CH3 domain, or a variant or fragment thereof. The heavy chain constant region includes a full-length heavy chain constant region and a heavy chain constant region fragment, the former has a structure substantially similar to that of a natural antibody constant region, while the latter only includes a portion of the full-length heavy chain constant region. Exemplarily, a typical full-length antibody heavy chain constant region consists of CH1 domain-hinge region-CH2 domain-CH3 domain, which also includes a CH4 domain when an IgE antibody is referred to, and does not include the CH1 domain when a heavy chain antibody is referred to. Exemplarily, a typical heavy chain constant region fragment is selected from Fc or a CH3 domain.
[0071] The term light chain constant region herein refers to the carboxyl terminus portion of an antibody light chain, which is not directly involved in the binding of an antibody to an antigen, and the light chain constant region is selected from a constant K domain or a constant A domain.
[0072] The term Fc region herein is used to define the C-terminal region of an antibody heavy chain that contains at least a portion of the constant region. The term includes a native sequence Fc region and a variant Fc region. Exemplarily, human IgG heavy chain Fc region can extend from Cys226 or Pro230 to the carboxyl terminus of the heavy chain. However, an antibody generated from a host cell may undergo post-translational cleavage whereby one or more, particularly one or two amino acids are cleaved off from the C-terminus of the heavy chain. Therefore, by expression of a specific nucleic acid molecule encoding a full-length heavy chain, the antibody generated from a host cell can include the full-length heavy chain, or a cleavage variant of the full-length heavy chain. This may be the case when the last two C-terminal amino acids of the heavy chain are glycine (G446) and lysine (K447, numbering according to the Kabat EU index). Therefore, the C-terminal lysine (Lys447), or the C-terminal glycine (Gly446) and lysine (Lys447) of the Fc region may or may not be present. Typically, an IgG Fc region comprises IgG CH2 and IgG CH3 domains, and optionally, on this basis, the IgG Fc region can also comprise a complete or partial hinge region, but does not comprise a CH1 domain. The CH2 domain of a human IgG Fc region generally extends from an amino acid residue at about position 231 to an amino acid residue at about position 340. In one embodiment, a carbohydrate chain is attached to the CH2 domain. The CH2 domain herein can be a native sequence CH2 domain or a variant CH2 domain. The CH3 domain comprises the stretch of residues at the C-terminus of the CH2 domain in the Fc region (i.e., from an amino acid residue at about position 341 to an amino acid residue at about position 447 of IgG). The CH3 region herein can be a native sequence CH3 domain or a variant CH3 domain (e.g., a CH3 domain having a knob introduced in one chain thereof and a hole correspondingly introduced in the other chain thereof; see U.S. Pat. No. 5,821,333, which is expressly incorporated herein by reference). As described herein, such variant CH3 domains can be used to facilitate heterodimerization of two non-identical antibody heavy chains.
[0073] Unless otherwise specified herein, the numbering of amino acid residues in an Fc region or a constant region is according to the EU numbering system, also known as the EU index, as described in Sequences of Proteins of Immunological Interest, 5.sup.th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
[0074] The term Fc variant herein refers to changes in the structure or function of Fc caused by one or more amino acid substitution, insertion or deletion mutations at appropriate positions on the Fc. The interaction between Fc variants refers to the space-filling effect, electrostatic steering, hydrogen bonding effect, hydrophobic effect, etc. formed between Fc variants that have been subjected to a mutation design. The interaction between Fc variants contributes to the formation of a stable heterodimeric protein. A preferred mutation design is a mutation design in a Knob-into-Hole form.
[0075] The mutation design technique of Fc variants has been widely used in the field to prepare bispecific antibodies or heterodimeric Fc fusion protein forms. Representative ones include the Knob-into-Hole form proposed by Cater et al. (Protein Engineering vol. 9 no.7 pp. 617-621, 1996); an Fc-containing heterodimer form formed by using Electrostatic Steering by the technician in Amgen (US 20100286374 A1); The heterodimer form (SEEDbodies) formed by IgG/Ig chain exchange proposed by Jonathan H. Davis et al. (Protein Engineering, Design & Selection pp. 1-8, 2010); Bispecific molecules formed by Genmab's DuoBody (Science, 2007.317(5844)) platform technology; heterodimeric protein forms formed by combining structural calculation and Fc amino acid mutations and combining different modes of action by Xencor's technical staff (mAbs 3: 6, 546-557; November/December 2011); a heterodimeric protein form obtained by the charge network-based Fc modification method of Alphamab Oncology (CN 201110459100.7); and other genetic engineering methods for forming heterodimeric functional proteins based on Fc amino acid changes or functional modification means. The Knob/Hole structure on the Fc variant fragments of the present invention means that the two Fc fragments are mutated respectively, and can be combined in a Knob-into-Hole form after the mutations. Preferably, the Fc regions are subjected to site mutation modification using the Knob-into-hole model of Cater et al., so that the obtained first Fc variant and second Fc variant can be combined together in a Knob-into-hole form to form a heterodimer. The selection of particular immunoglobulin Fc regions from particular immunoglobulin classes and subclasses is within the range of those skilled in the art. The Fc regions of human antibodies IgG1, IgG2, IgG3 and IgG4 are preferred, and the Fc region of human antibody IgG1 is more preferred. Either of the first Fc variant or the second Fc variant is randomly selected for knob mutation and the other for hole mutation.
[0076] The term conservative amino acid herein generally refers to amino acids that belong to the same class or have similar characteristics (such as charge, side chain size, hydrophobicity, hydrophilicity, backbone conformation and rigidity). Exemplarily, the following amino acids in each group are each other's conservative amino acid residues, and a substitution of amino acid residues in the group is a substitution of conservative amino acids: [0077] 1) Alanine (A), Serine (S) and Threonine (T); [0078] 2) Aspartic acid (D) and Glutamic acid (E); [0079] 3) Asparagine (N) and Glutamine (Q); [0080] 4) Arginine (R), Lysine (K) and Histidine (H); [0081] 5) Isoleucine (I), Leucine (L), Methionine (M) and Valine (V); and [0082] 6) Phenylalanine (F), Tyrosine (Y) and Tryptophan (W).
[0083] The term identity herein can be calculated by the following method: To determine the percent identity of two amino acid sequences or two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (for example, gaps can be introduced in either or both of the first and second amino acid sequences or nucleic acid sequences for optimal alignment or non-homologous sequences can be discarded for comparison purposes). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When the position in the first sequence is occupied by the same amino acid residue or nucleotide as that at the corresponding position in the second sequence, the molecules are identical at that position. The percent identity between two sequences will vary with the identical positions shared by the sequences, considering the number of gaps that need to be introduced to optimally align the two sequences and the length of each gap.
[0084] The sequence comparison and the calculation of percent identity between two sequences can be achieved using a mathematical algorithm. For example, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch algorithm ((1970) J. Mol. Biol. 48: 444-453) in the GAP program that has been integrated into the GCG software package (available at www.gcg.com) and using the Blossum 62 matrix or the PAM250 matrix, with a gap weight of 16, 14, 12, 10, 8, 6 or 4 and a length weight of 1, 2, 3, 4, 5 or 6. For another example, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at www.gcg.com) and using the NWSgapdna.CMP matrix, with a gap weight of 40, 50, 60, 70 or 80 and a length weight of 1, 2, 3, 4, 5 or 6. A particularly preferred parameter set (and one parameter set that should be used unless otherwise stated) is the Blossum62 scoring matrix with a gap penalty of 12, a gap extension penalty of 4, and a gap frameshift penalty of 5. The percent identity between two amino acid sequences or nucleotide sequences can also be determined using the PAM120 weighted remainder table, with a gap length penalty of 12 and a gap penalty of 4, and using the E. Meyers and W. Miller algorithm ((1989) CABIOS, 4:11-17) that has been incorporated into the ALIGN program (version 2.0).
[0085] Additionally or alternatively, the nucleic acid and protein sequences of the present invention can further be used as query sequences to perform searches against public databases, e.g., to identify other family member sequences or related sequences. For example, the NBLAST and XBLAST programs (version 2.0) of Altschul et al., (1990) J. Mol. Biol. 215: 403-10 can be used to perform such searches. BLAST nucleotide searches can be performed with the NBLAST program, with score=100 and word length=12, to obtain the nucleotide sequences homologous to the nucleic acid molecules of the present invention. BLAST protein searches can be performed with the XBLAST program, with score=50 and word length=3, to obtain the amino acid sequences homologous to the protein molecules of the present invention. To obtain gapped alignment results for comparison purposes, gapped BLAST can be used as described in Altschul et al., (1997) Nucleic Acids Res. 25: 3389-3402. When BLAST and gapped BLAST programs are used, the default parameters of the corresponding programs (e.g., XBLAST and NBLAST) can be used. See www.ncbi.nlm.nih.gov.
[0086] The term nucleic acid herein includes any compound and/or substance comprising a polymer of nucleotides. Each nucleotide consists of a base, specifically a purine or pyrimidine base (i.e., cytosine (C), guanine (G), adenine (A), thymine (T) or uracil (U)), a sugar (i.e., deoxyribose or ribose) and a phosphate group. Generally, a nucleic acid molecule is described by a sequence of bases, whereby the bases represent the primary structure (linear structure) of the nucleic acid molecule. The sequence of bases is usually expressed as 5 to 3. In this context, the term nucleic acid molecule encompasses deoxyribonucleic acid (DNA), including for example complementary DNA (cDNA) and genomic DNA, ribonucleic acid (RNA), especially messenger RNA (mRNA), synthetic forms of DNA or RNA, and a polymer comprising a mixture of two or more of these molecules. The nucleic acid molecule can be linear or circular. Furthermore, the term nucleic acid molecule includes both sense strand and antisense strand, as well as single-stranded form and double-stranded form. Furthermore, the nucleic acid molecules described herein may contain naturally occurring or non-naturally occurring nucleotides. Examples of non-naturally occurring nucleotides include modified nucleotide bases with derivatized sugar or phosphate backbone linkages or chemically modified residues. The nucleic acid molecule also encompasses DNA and RNA molecules which are suitable as vectors for direct expression of the antibody of the invention in vitro and/or in vivo, for example in a host or patient. Such DNA (e.g., cDNA) or RNA (e.g., mRNA) vectors may be unmodified or modified. For example, mRNA can be chemically modified to enhance the stability of the RNA vector and/or the expression of the encoded molecule, so that the mRNA can be injected into a subject to generate an antibody in vivo (see, for example, Stadler et al., Nature Medicine 2017, Published online Jun. 12, 2017, doi: 10.1038/nm.4356 or EP 2101823B1).
[0087] The isolated nucleic acid herein refers to a nucleic acid molecule that has been separated from components of the natural environment thereof. The isolated nucleic acid includes a nucleic acid molecule contained in a cell that normally contains the nucleic acid molecule, but which is present extrachromosomally or at a chromosomal location other than the natural chromosomal location thereof.
[0088] The term vector herein refers to a nucleic acid molecule capable of amplifying another nucleic acid to which it is linked. The term includes a vector having a self-replicating nucleic acid structure and a vector that is integrated into the genome of a host cell into which the vector has been introduced. Certain vectors can direct the expression of the nucleic acid to which they are operably linked. Such vectors are referred to herein as expression vectors.
[0089] The term host cell herein refers to a cell into which a foreign nucleic acid is introduced, including the progenies of such a cell. The host cell includes transformant and transformed cell which include the primary transformed cell and progeny derived therefrom, regardless of the number of passages. The progeny may not be identical to the parental cell in nucleic acid content, and may contain a mutation. The mutant progeny with the same function or biological activity as those screened or selected in the initially transformed cells are included herein.
[0090] As used herein, the term pharmaceutical composition refers to a preparation that is present in a form which allows the active ingredients contained therein to be biologically effective and does not contain additional ingredients that would be unacceptably toxic to the subject to which the pharmaceutical composition is administered.
[0091] The term pharmaceutically acceptable carrier herein includes any and all solvents, dispersion media, coating materials, surfactants, antioxidants, preservatives (e.g., antibacterial agents and antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drug stabilizers, binders, excipients, disintegrants, lubricants, sweeteners, flavoring agents, dyes, etc., and a combination thereof, which are known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th ed., Mack Printing Company, 1990, pp. 1289-1329). Except in cases of incompatibility with the active ingredient, any conventional carrier is contemplated for use in a therapeutic or pharmaceutical composition.
[0092] The term treatment herein refers to surgical or therapeutic treatment, the purpose of which is to prevent and slow down (reduce) an undesired physiological change or pathology in a subject being treated, such as cancers and tumors. Beneficial or desired clinical outcomes include, but are not limited to, the alleviation of symptoms, the weakening of disease severity, the stabilization of disease state (i.e., no deterioration), the delay or slowing down of disease progression, the amelioration or mitigation of disease state, and remission (whether partial or complete), whether detectable or undetectable. Objects in need of treatment include those who already have a disorder or disease, those who are susceptible to a disorder or disease or those who intend to prevent a disorder or disease. When terms such as slowing down, alleviation, weakening, mitigation, and remission are referred to, their meanings also include elimination, disappearance, non-occurrence and other circumstances.
[0093] The term subject refers to an organism receiving treatment for a particular disease or condition as described herein. Exemplarily, a subject includes a mammal, such as a human, a primate (e.g., monkey) or a non-primate mammal, receiving treatment for a disease or a condition.
[0094] The term effective amount herein refers to an amount of a therapeutic agent effective to prevent or relieve a disease or a disorder or the progression of the disease when administered alone or in combination with another therapeutic agent to a cell, tissue or subject. The effective amount also refers to an amount of a compound sufficient to relieve symptoms, such as treating, curing, preventing or relieving related medical disorders, or increasing the speed of treating, curing, preventing or relieving these disorders. When the active ingredient is administered to an individual alone, a therapeutically effective dose refers to the ingredient alone. When a certain combination is applied, a therapeutically effective dose refers to the combined dosage of the active ingredients that produce a therapeutic effect, whether administered in combination, sequentially or simultaneously.
[0095] The term cancer herein refers to or describes the physiological condition in mammals that is typically characterized by unregulated cell growth. Both benign and malignant cancers are included in this definition. The term tumor or neoplasm herein refers to all neoplastic cell growth and proliferation, whether malignant or benign, and to all pre-cancerous and cancerous cells and tissues. The terms cancer and tumor are not mutually exclusive when referred to herein.
[0096] The term EC50 herein refers to the half-maximal effective concentration, which includes the concentration of an antibody that induces a response halfway between baseline and maximum after a specified exposure time. EC50 essentially represents the concentration of an antibody at which 50% of the maximal effect thereof is observed and which can be measured by methods known in the art.
Detailed Description of Embodiments
[0097] The present application provides an antibody or an antigen-binding fragment thereof that specifically binds to BCMA, a multispecific antigen-binding molecule, a chimeric antigen receptor, an immune effector cell, a nucleic acid fragment, a vector, a host cell, a pharmaceutical composition, a kit, a preparation method, and the use of the antibody or the antigen-binding fragment thereof in the treatment of diseases and detection of BCMA.
[0098] In a first aspect, the present application provides an antibody or an antigen-binding fragment thereof that specifically binds to BCMA, wherein the antibody or the antigen-binding fragment thereof comprises CDR1, CDR2 and CDR3, the CDR1 comprises HCDR1 of VHH domain shown in any sequence of SEQ ID NO: 7-21, 24-31 and 92-101, the CDR2 comprises HCDR2 of VHH domain shown in any sequence of SEQ ID NO: 7-21, 24-31 and 92-101, and the CDR3 comprises HCDR3 of VHH domain shown in any sequence of SEQ ID NO: 7-21, 24-31 and 92-101.
[0099] In some specific embodiments, the HCDR1, HCDR2 and HCDR3 are determined according to the Kabat, IMGT or Chothia numbering system.
[0100] In an optional embodiment, the HCDR1, HCDR2 and HCDR3 are selected from the amino acid sequences as represented by SEQ ID NO: 34-91 and 102-157.
[0101] In an optional embodiment, the HCDR1 comprises the amino acid sequence as represented by SEQ ID NOs: 34, 37, 40, 42, 45, 48, 50, 52, 54, 56, 58, 64, 67, 71, 74, 77, 81, 84, 86, 87, 104, 107, 113, 116, 119, 121, 124, 127, 131, 134, 138 or 141.
[0102] In an optional embodiment, the HCDR2 comprises the amino acid sequence as represented by SEQ ID NOs: 35, 38, 41, 43, 46, 49, 59, 61, 63, 65, 68, 70, 72, 75, 78, 79, 82, 85, 88, 89, 90, 91, 102, 105, 108, 109, 111, 114, 117, 120, 122, 125, 128, 129, 132, 135, 136, 139, 142, 143, 148, 150, 152, 153, 155 or 157.
[0103] In an optional embodiment, the HCDR3 comprises the amino acid sequence as represented by SEQ ID NO: 36, 39, 44, 47, 51, 53, 55, 57, 60, 62, 66, 69, 73, 76, 80, 83, 103, 106, 110, 112, 115, 118, 123, 126, 130, 133, 137, 140, 144, 145, 146, 147, 149, 151, 154 or 156.
[0104] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 35 and 36; SEQ ID NOs: 37, 38 and 39; or SEQ ID NOs: 40, 41 and 36, respectively.
[0105] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 42, 43 and 44; SEQ ID NOs: 45, 46 and 47; or SEQ ID NOs: 48, 49 and 44, respectively.
[0106] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 50, 35 and 51; SEQ ID NOs: 52, 38 and 53; or SEQ ID NOs: 54, 41 and 51, respectively.
[0107] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 35 and 55; SEQ ID NOs: 56, 38 and 57; or SEQ ID NOs: 58, 41 and 55, respectively.
[0108] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 59 and 60; SEQ ID NOs: 56, 61 and 62; or SEQ ID NOs: 58, 63 and 60, respectively.
[0109] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 64, 65 and 66; SEQ ID NOs: 67, 68 and 69; or SEQ ID NOs: 58, 70 and 66, respectively.
[0110] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 71, 72 and 73; SEQ ID NOs: 74, 75 and 76; or SEQ ID NOs: 77, 78 and 73, respectively.
[0111] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 79 and 80; SEQ ID NOs: 81, 82 and 83; or SEQ ID NOs: 84, 85 and 80, respectively.
[0112] In a preferred embodiment, according to the Kabat numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 86, 35 and 36 respectively.
[0113] In a preferred embodiment, according to the Kabat numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 87, 88 and 44 respectively.
[0114] In a preferred embodiment, according to the Kabat numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 42, 88 and 44 respectively.
[0115] In a preferred embodiment, according to the Kabat numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 42, 89 and 44 respectively.
[0116] In a preferred embodiment, according to the Kabat numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 42, 90 and 44 respectively.
[0117] In a preferred embodiment, according to the Kabat numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 42, 91 and 44 respectively.
[0118] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 71, 102 and 103; SEQ ID NOs: 104, 105 and 106; or SEQ ID NOs: 107, 108 and 103, respectively.
[0119] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 71, 109 and 110; SEQ ID NOs: 104, 111 and 112; or SEQ ID NOs: 107, 108 and 110, respectively.
[0120] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 113, 114 and 115; SEQ ID NOs: 116, 117 and 118; or SEQ ID NOs: 119, 120 and 115, respectively.
[0121] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 121, 122 and 123; SEQ ID NOs: 124, 125 and 126; or SEQ ID NOs: 127, 128 and 123, respectively.
[0122] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 113, 129 and 130; SEQ ID NOs: 131, 132 and 133; or SEQ ID NOs: 134, 135 and 130, respectively.
[0123] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 113, 136 and 137; SEQ ID NOs: 138, 139 and 140; or SEQ ID NOs: 141, 142 and 137, respectively.
[0124] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 143 and 144; SEQ ID NOs: 37, 38 and 145; or SEQ ID NOs: 40, 41 and 144, respectively.
[0125] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 143 and 146; SEQ ID NOs: 56, 38 and 147; or SEQ ID NOs: 58, 41 and 146, respectively.
[0126] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 34, 148 and 149; SEQ ID NOs: 37, 150 and 151; or SEQ ID NOs: 40, 152 and 149, respectively.
[0127] In a preferred embodiment, according to the Kabat, IMGT or Chothia numbering system, the HCDR1, HCDR2 and HCDR3 comprise the amino acid sequences as represented by SEQ ID NOs: 71, 153 and 154; SEQ ID NOs: 104, 155 and 156; or SEQ ID NOs: 107, 157 and 154, respectively.
[0128] In some specific embodiments, the CDR1, CDR2 and/or CDR3 comprise(s) an amino acid sequence with 1, 2 or 3 mutations on the aforementioned HCDR1, HCDR2 and/or HCDR3; the mutations are selected from insertion, deletion and/or substitution, and the substitution is preferably a conservative amino acid substitution.
[0129] In some specific embodiments, the CDR1, CDR2 and/or CDR3 comprise(s) an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the aforementioned HCDR1, HCDR2 and/or HCDR3.
[0130] In some specific embodiments, the antibody or the antigen-binding fragment thereof comprises a single domain antibody, and the single domain antibody comprises the aforementioned CDR1, CDR2 and CDR3.
[0131] In some specific embodiments, the single domain antibody comprises an amino acid sequence selected from any one of SEQ ID NO: 7-21, 24-31, and 92-101.
[0132] In an optional embodiment, the single domain antibody comprises an amino acid sequence with at most 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation relative to the sequence as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101, the mutation is selected from insertion, deletion and/or substitution, and the substitution is preferably a conservative amino acid substitution.
[0133] In an optional embodiment, the single domain antibody comprises an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the sequence as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101.
[0134] In some specific embodiments, the antibody comprises an FR region in a VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101.
[0135] In an optional embodiment, the antibody comprises an amino acid sequence with at most 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation relative to the FR region in the VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101, the mutation is selected from insertion, deletion and/or substitution, and the substitution is preferably a conservative amino acid substitution;
[0136] In an optional embodiment, the antibody comprises an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the FR region in the VHH domain as shown in any one of SEQ ID NOs: 7-21, 24-31 and 92-101.
[0137] In some specific embodiments, the antibody or the antigen-binding fragment thereof is selected from: (1) a chimeric antibody or a fragment thereof; (2) a humanized antibody or a fragment thereof; or (3) a fully human antibody or a fragment thereof.
[0138] In some specific embodiments, the antibody or the antigen-binding fragment thereof comprises or does not comprise an antibody heavy chain constant region; optionally, the antibody heavy chain constant region is selected from humans, llamas, mice, rats, rabbits and goats; optionally, the antibody heavy chain constant region is selected from IgG, IgM, IgA, IgE and IgD; optionally, the IgG is selected from IgG1, IgG2, IgG3 and IgG4; optionally, the heavy chain constant region is selected from an Fc region, a CH3 region and a complete heavy chain constant region, preferably, the heavy chain constant region is a human Fc region; and preferably, the antibody or the antigen-binding fragment thereof is a heavy chain antibody.
[0139] In some specific embodiments, the antibody or the antigen-binding fragment thereof is further coupled with a therapeutic agent or a tracer; preferably, the therapeutic agent is selected from a radioisotope, a chemotherapeutic drug and an immunomodulator, and the tracer is selected from a radiological contrast agent, a paramagnetic ion, a metal, a fluorescent tag, a chemiluminescence tag, an ultrasonic contrast agent and a photosensitizer.
[0140] In some specific embodiments, the antibody or the antigen-binding fragment thereof is also linked to other functional molecules, and preferably, the other functional molecules are selected from one or more of the following: a signal peptide, a protein tag, a cytokine, an angiogenesis inhibitor and an immune checkpoint inhibitor.
[0141] In a second aspect, the present application further provides a multispecific antigen-binding molecule, wherein the multispecific antigen-binding molecule comprises the aforementioned antibody or the antigen-binding fragment thereof, and an antigen-binding molecule binding to an antigen other than BCMA or binding to a different BCMA epitope than that of the aforementioned antibody or the antigen-binding fragment thereof; optionally, the antigen other than BCMA is selected from: CD3 (preferably CD3E), CD16, CD137, CD258, PD-1, PD-L1, 4-1BB, CD40, CD64, EGFR, VEGF, HER2, HER1, HER3, IGF-1R, phosphatidylserine (PS), C-Met, HSA, GPRC5D, MSLN, blood-brain barrier receptor, GPC3, PSMA, CD33, GD2, ROR1, ROR2, FR and Gucy2C.
[0142] In a preferred embodiment, the antigen-binding molecule is an antibody or an antigen-binding fragment thereof.
[0143] In a preferred embodiment, the multispecific antigen-binding molecule can be bispecific, trispecific or tetraspecific.
[0144] In a preferred embodiment, the multispecific antigen-binding molecule can be bivalent, trivalent, tetravalent, pentavalent or hexavalent.
[0145] In a third aspect, the present application further provides an isolated nucleic acid fragment, wherein the nucleic acid fragment encodes the aforementioned antibody or the antigen-binding fragment thereof or the multispecific antigen-binding molecule.
[0146] In a fourth aspect, the present application also provides a vector, which comprises the aforementioned nucleic acid fragment.
[0147] In a fifth aspect, the present application further provides a host cell, which comprises the aforementioned vector; and preferably, the cell is a prokaryotic cell or a eukaryotic cell, such as a bacterial (for example, Escherichia coli) cell, a fungal (for example, yeast) cell, an insect cell or a mammalian cell (for example, a CHO cell line or a 293T cell line).
[0148] In a sixth aspect, the present application further provides a method for preparing the antibody or the antigen-binding fragment thereof or the aforementioned multispecific antigen-binding molecule, wherein the method comprises culturing the aforementioned cell, and isolating the antibody, antigen-binding fragment or multispecific antigen-binding molecule expressed by the cell.
[0149] In the seventh aspect, the present application further provides a pharmaceutical composition, wherein the pharmaceutical composition comprises the aforementioned antibody or the antigen-binding fragment thereof, multispecific antigen-binding molecule, nucleic acid fragment or vector, or a product prepared according to the aforementioned method; optionally, the pharmaceutical composition also comprises a pharmaceutically acceptable carrier, a diluent or an auxiliary agent; and optionally, the pharmaceutical composition further comprises an additional anti-tumor agent.
[0150] In some embodiments, the pharmaceutically acceptable carrier is a carrier that does not weaken the viability and function of immune cells and does not affect the specific binding of antibodies or antigen-binding fragments thereof to antigens, and includes but not limited to cell culture media, buffers, physiological saline, balanced salt solution, etc. Examples of buffers include isotonic phosphate, acetate, citrate, borate, carbonate, etc. In specific embodiments, the pharmaceutically acceptable carrier is phosphate buffered saline containing 1% serum.
[0151] The anti-tumor agents are, for example, various chemotherapeutic drugs, such as alkylating agent chemotherapeutic drugs, including but not limited to cyclophosphamide, ifosfamide, melphalan, carmustine, lomustine, nimustine, fotemustine, etc.; Anti-metabolite chemotherapeutic drugs, including but not limited to methotrexate, fluorouracil, tegafur, carmofur, deoxyfloxuridine, capecitabine, gemcitabine, raltitrexed, etc.; Anti-cancer antibiotics, including but not limited to actinomycin D, mitomycin, bleomycin, daunorubicin, doxorubicin, epirubicin, pirarubicin, etc.; Plant-based chemotherapeutic drugs, including but not limited to vincristine, vindesine, vinorelbine, irinotecan, topotecan, paclitaxel, docetaxel, etc.; Miscellaneous others, including but not limited to dacarbazine, cisplatin, carboplatin, oxaliplatin, nedaplatin, etc.
[0152] In an eighth aspect, the present application further provides a method for treating a tumor or a cancer, wherein the method comprises administering to a subject an effective amount of the aforementioned antibody or antigen-binding fragment thereof, the multispecific antigen-binding molecule, the nucleic acid fragment, the vector, a product prepared according to the aforementioned method or the aforementioned pharmaceutical composition; optionally, the tumor or cancer is a BCMA-expressing tumor or cancer, preferably a B-cell lymphoma, and more preferably multiple myeloma (MM).
[0153] In a ninth aspect, the present application further provides the use of the aforementioned antibody or the antigen-binding fragment thereof, the multispecific antigen-binding molecule, the nucleic acid fragment, the vector, a product prepared according to the aforementioned method or the aforementioned pharmaceutical composition in the preparation of a drug for treating a tumor or a cancer; optionally, the tumor or cancer is a BCMA-expressing tumor or cancer, preferably a B-cell lymphoma, and more preferably multiple myeloma (MM).
[0154] In a tenth aspect, the present application further provides the use of the aforementioned antibody or the antigen-binding fragment thereof, the multispecific antigen-binding molecule, the nucleic acid fragment, the vector, a product prepared according to the aforementioned method or the aforementioned pharmaceutical composition for treating a tumor or a cancer; optionally, the tumor or cancer is a BCMA-expressing tumor or cancer, preferably a B-cell lymphoma, and more preferably multiple myeloma (MM).
[0155] In an eleventh aspect, the present application further provides a kit, wherein the kit comprises the aforementioned antibody or the antigen-binding fragment thereof, the multispecific antigen-binding molecule, the nucleic acid fragment, the vector, a product prepared according to the aforementioned method or the aforementioned pharmaceutical composition.
[0156] In a twelfth aspect, the present application further provides a method for detecting BCMA expression in a biological sample, wherein the method comprises contacting the biological sample with the aforementioned antibody or the antigen-binding fragment thereof under conditions that allow the formation of a complex from the antibody or the antigen-binding fragment thereof and BCMA; and preferably, the method further comprises detecting the formation of the complex, thereby indicating the presence or expression level of BCMA in the sample.
[0157] In a thirteenth aspect, the present application further provides the use of the aforementioned antibody or the antigen-binding fragment thereof in preparing a BCMA detection reagent.
EXAMPLES
[0158] The present application will be further described below in conjunction with specific examples, and the advantages and characteristics of the present application will become clearer along with the description. If no specific conditions are indicated in the examples, conventional conditions or the conditions suggested by the manufacturer shall be followed. Any reagents or instruments used, unless the manufactures stated, are conventional products that are commercially available.
[0159] The examples herein are only exemplary and do not limit the scope of the present application in any way. Those skilled in the art should understand that the details and forms of the technical solutions of the present application can be modified or replaced without departing from the spirit and scope of the present application, but these modifications and replacements all fall within the scope of protection of the present application.
Example 1 Preparation of Control Antibodies, Identification of Endogenous Cells and Preparation of Overexpression Cell Lines
(A) Preparation of Control Antibodies
[0160] A REGN5459 and HPN217 are both antibodies that recognize human BCMA protein. The sequence of REGN5459 comes from US Patent Publication No. US 2020/0024356A1, and the HPN217 sequence comes from US Patent Publication No. US 20190112381A1. The heavy chain variable region (VH) of REGN5459 was recombined into an expression vector containing a signal peptide and human antibody IgG1 heavy chain constant region, and the light chain variable region (VL) sequence was recombined into an expression vector containing a signal peptide and human antibody IgG1 light chain, thus a recombinant plasmid was obtained and the synthesized antibody was named REGN5459-hlgG1. The VHH sequence of HPN217 was recombined into an expression vector containing a signal peptide and human antibody IgG1 Fc to obtain a recombinant plasmid. The synthesized antibody was named HPN217-hHcAb. The negative control antibody hlgG1 was the antibody anti-hel-hlgG1 (purchased from Biointron, catalog number: B117901, hereinafter referred to as hlgG1) against Hen Egg Lysozyme chicken egg lysozyme.
TABLE-US-00001 TABLE1 Listofsequencesofcontrolantibodies Designationof Sequence sequence number Aminoacidsequence REGN5459VH SEQIDNO:1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSNFWMTWVRQA PGKGLEWVANMNQDGSEKYYVDSVKGRFTISRDNAKSSL YLQMNSLRAEDTAVYYCARDREYCISTSCYDDFDYWGQG TLVTVSS REGN5459VL SEQIDNO:2 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPG KAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCQQSYSTPPITFGQGTRLEIK HPN217VHH SEQIDNO:3 EVQLVESGGGLVQPGRSLTLSCAASTNIFSISPYGWYRQAPG KQRELVAAIHGTSTLYADSVKGRFTISRDNAKNSIYLQMNS LRPEDTALYYCNKVPWGDYHPGNVYWGQGTQVTVSS IgG1Fc SEQIDNO:4 EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK IgG1heavy SEQIDNO:5 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW chainconstant NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC region NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK IgG1light SEQIDNO:6 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW chainconstant KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH region KVYACEVTHQGLSSPVTKSFNRGEC
Notes: The IgG1 Fc contains the C220S mutation.
[0161] The binding activity of the control antibody to human BCMA-His protein (purchased from Acro, catalog number: BCA-H522y) and monkey BCMA-His protein (purchased from Acro, catalog number: BCA-C52H7) was detected by ELISA. The specific method was as follows: The antigen protein was diluted with PBS to a final concentration of 1 g/mL, and then added to a 96-well ELISA plate at 50 l per well. The plate was sealed with a plastic film and incubated overnight at 4 C., the plate was washed twice with PBS the next day, and then a blocking solution [PBS+2% (w/v) BSA] was added for blocking at room temperature for 2 h. The blocking solution was poured off and 50 l of 100 nM serially diluted control antibody or negative control antibody was added to each well. After incubation at 37 C. for 2 h, the plate was washed 3 times with PBS. HRP (horseradish peroxidase)-labeled secondary antibody (purchased from Merck, catalog number: AP113P) was added, and incubated at 37 C. for 1 h, and the plate was washed 5 times with PBS. TMB substrate was added at 50 l/well, and incubated at room temperature for 10 min, then a stop solution (1.0 M HCl) was added at 50 al/well. The OD450 nm values were read by an ELISA microplate reader (Multimode Plate Reader, EnSight, purchased from Perkin Elmer). The results are shown in Tables 2 and 3 and
TABLE-US-00002 TABLE 2 ELISA detection of binding activity of control antibody with human BCMA-his protein Antibody concentration (nM) Designation of Blank antibody 100 10 1 0.1 0.01 0.001 0.0001 control REGN5459-hIgG1 2.89 2.63 2.00 1.54 0.50 0.14 0.07 0.06 HPN217-hHcAb 2.75 2.64 2.34 1.39 0.56 0.24 0.17 0.07 hIgG1 0.12 0.07 0.05 0.05 0.05 0.05 0.05 0.06
TABLE-US-00003 TABLE 3 ELISA detection of binding activity of control antibody with monkey BCMA-his protein Antibody concentration (nM) Designation of Blank antibody 100 10 1 0.1 0.01 0.001 0.0001 control REGN5459-hIgG1 3.10 2.82 2.57 2.06 0.78 0.21 0.09 0.06 HPN217-hHcAb 0.16 0.06 0.05 0.05 0.05 0.05 0.05 0.05 hIgG1 0.10 0.06 0.05 0.05 0.04 0.05 0.05 0.05
(B) Identification of Cell Lines Expressing BCMA Protein Endogenously
[0162] H929 cells and U266 cells were scale-up cultured in T-75 cell culture flasks to the logarithmic growth phase, and the cells were pipetted into a single cell suspension. After the cells were counted, the cells were centrifuged and the cell pellet was resuspended in FACS buffer (PBS+2% fetal calf serum) to 210.sup.6 cells per ml, and the suspension was added to the 96-well FACS reaction plate at 50 l per well, REGN5459-hlgG1 and HPN217-hHcAb antibodies were used as primary antibodies, and APC-labeled goat anti-human IgG (H+L) secondary antibodies (purchased from Jackson, catalog number: 109-605-088) were detected and analyzed by FACS (FACS Canto, purchased from BD Corporation). The results are shown in Table 4 and
TABLE-US-00004 TABLE 4 FACS detection results of endogenous cell lines H929 and U266 H929 U266 Maximum Maximum mean mean Designation fluorescence EC50 fluorescence EC50 of antibody intensity (nM) intensity (nM) REGN5459-hIgG1 4993 6.78 1097 9.12 HPN217-hHcAb 4015 2.24 708 1.83 hIgG1 110 Negative 103 Negative
(C) Preparation of Flp-inCHO Recombinant Cell Lines of Human BCMA Protein and Monkey BCMA Protein
[0163] The nucleotide sequences encoding the amino acid sequences of human BCMA and monkey BCMA were cloned into pcDNA5/FRT vector (purchased from Clontech) respectively. Human BCMA NCBI Gene ID: 608, Monkey BCMA NCBI Gene ID: 712212. The Flp-inCHO cell lines (purchased from the cell bank of the Type Culture Collection Committee of Chinese Academy of Sciences) were transfected (Lipofectamine 3000 Transfection Kit, purchased from Invitrogen, catalog number: L3000-015) respectively, and then selectively cultured in F12K Medium (Gibco, catalog number: 21127030) containing 600 g/ml hygromycin (ThermoFisher, catalog number: 10687010) and 10% (v/v) fetal bovine serum (ExCell Bio, catalog number: FND500) for 2 weeks. REGN5459-hlgG1 and goat anti-human IgG(H+L) antibody (Jackson, catalog number: 109605088) were used for detection on FACS Cantoll (purchased from BD Biosciences), and the cells with high expression and single peak shape were proliferated, and the proliferated cells were retested by flow cytometry. The positive cell pool with better growth, higher fluorescence intensity and better homogeneity was selected for further scale-up culture and then cryopreserved in liquid nitrogen. Table 5 shows that a Flp-inCHO high-expression cell population with human BCMA-positive expression and a Flp-inCHO high-expression cell population with monkey BCMA-positive expression have been prepared respectively. In
TABLE-US-00005 TABLE 5 FACS detection results of Flp-inCHO recombinant cell line expressing human BCMA protein Stably transfected Cell mean fluorescence density positive cell IgG subtype BCMA No. population control antibody 1 Flp-in CHO-human BCMA 54.6 4313 2 Flp-in CHO-monkey BCMA 49 2984
Example 2 Preparation of Alpaca Nanobody Against BCMA
(A) Animal Immunization and Serum Titer Determination
[0164] The immunized animal was an alpaca (Alpaca, No. NB254). Before immunization, 10 mL of blood was taken as a negative control. 0.5 mg of human BCMA(Met1-Ala54)-hFc protein (purchased from Acro, catalog number: BC7-H5254) was mixed with 1 mL of complete Freund's adjuvant (CFA) and injected subcutaneously for primary immunization. For the second immunization on day 21, 0.25 mg of human BCMA-hFc protein was mixed with 1 mL of incomplete Freund's adjuvant (IFA) and then injected subcutaneously. For the third immunization on day 42, 0.25 mg of each of human BCMA-hFc protein and cynomolgus BCMA (Met1-Ala53)-hFc protein (purchased from Acro, catalog number: BCA-C5253) was mixed with 1 mL of IFA and injected subcutaneously. Thereafter, booster immunity would be given every three weeks according to the method used in the third immunization.
[0165] Blood was collected 1 week after each booster immunization, and serum antibody titer and specificity were detected using ELISA. The results are shown in Table 6. This shows that the serum of alpacas immunized with human BCMA-hFc and cynomolgus monkey BCMA-hFc proteins can bind to the immunogen to varying degrees, showing an antigen-antibody reaction. The blank control was 1% (w/v) BSA, and the fourth and fifth immunizations referred to the alpaca serum on the seventh day after the fourth and fifth immunizations respectively. The data in the table are OD450 nm values, and k represents 1000.
TABLE-US-00006 TABLE 6 ELISA detection of antibody titer in alpaca serum after protein immunization The The The The fourth fifth fourth fifth immuni- immuni- immuni- immuni- Serum zation zation zation zation dilution huBCMA-His CynoBCMA-his 1:16k 3.95 3.85 1.71 1.72 1:32k 3.64 3.56 1.42 1.22 1:64k 3.12 2.67 0.90 0.66 1:128k 2.26 1.90 0.42 0.36 1:256k 1.15 0.92 0.22 0.21 1:512k 0.79 0.62 0.18 0.15 1:1024k 0.41 0.33 0.08 0.09 Blank control 0.04 0.05 0.04 0.04
(B) Phage Library Construction
[0166] PBMC were separated from 50 mL of peripheral blood collected after the fourth and fifth immunizations according to the instructions for using the lymphocyte separation solution. RNAiso Plus reagent was used to extract total RNA of PBMC obtained from the NB254 subjected to the fourth and fifth immunizations. PrimeScript II 1st Strand cDNA Synthesis Kit (Takara, catalog number: 6210A) was used for reverse transcription, and cDNA was prepared by reverse transcription according to the instructions, and a total of 5 g RNA was transcribed. The cDNA stock solutions from the fourth and fifth immunizations were mixed in equal proportions and then the mixture was diluted 5-fold for nested amplification, and then the gel was cut to recover the VHH fragment. The vector and the target fragment were digested with Sfil overnight at 50 C. and recovered. The vector and the target fragment were ligated at a ratio of 1:3. 10 electroporation transformations were performed on the ligation product. Immediately after electroporation, 1 mL of 2YT medium (preheated at 37 C.) was added to the electroporation cuvette for recovery. The electroporation product was aspirated out and the electroporation cuvette was washed with 2YT culture medium. Recovery was performed at 37 C. and 180 rpm for 45 min. 100 L was taken and gradiently diluted to 10.sup.3 and 10.sup.4 to determine the number of transformants in the library, and spread on a 90 mm plate. The rest was centrifuged, 8 mL of 2YT culture medium was added for resuspension and the suspension was spread on eight 200 mm plates. Counting was performed on the next day to calculate storage capacity as 2.1410.sup.9. 48 clones were randomly selected and cultured, and the insertion rate was 100% by PCR.
[0167] E. coli library was inoculated into 2300 mL 2YT (Amp: 100 g/ml, Glu:1%) culture medium until its initial OD600=0.1-0.2, and cultured at 37 C. and 230 rpm until OD600=0.8 or above. The amount of helper phage M13K07 added was calculated based on OD600 (M13K07:E. coli=20:1), the cells were left to be infected at rest at 37 C. for 30 min and then the infected cells were cultured at 37 C. and 180 rpm for 30 min. The supernatant was removed by centrifugation at 5000 rpm, the medium was replaced with 2YT (100 g/mL Amp+50 g/mL Kan) medium and culture was performed at 30 C. and 220 rpm overnight. The phage library was precipitated according to the procedure on NEB official website and the titer was determined.
(C) Panning of Nanobody Against BCMA
[0168] The microplate was coated with human BCMA-hFc protein at 0.5 g/well, with a total of 8 wells. The input amount of the phage library was 2.210.sup.11, and the measured titer of the elution product in first round was 1.8510.sup.7. After identification by ELISA, the product of the first round panning has a positive rate of 89.58% for the binding to human BCMA protein, a positive rate of 4.2% for binding to monkey BCMA protein, and a positive rate of 4.2% for cross-binding to human and monkey BCMA proteins. The elution product of the first round panning was amplified according to the conventional procedure, and the titer of the amplified phage was determined to be 1.1410.sup.13. The microplate for the second round panning was coated with monkey BCMA protein at 0.2 g/well, with a total of 4 wells; The input amount of phage library was 2.210.sup.11, and the titer of the elution product was determined to be 1.3210.sup.7. After identification by ELISA, the product of the second round panning has a positive rate of 92.1% for the binding to human BCMA protein, a positive rate of 39.3% for binding to monkey BCMA protein, and a positive rate of 39.3% for cross-binding to human and monkey BCMA proteins.
(D) Sequencing
[0169] After panning, a total of 70 human-monkey cross positive clones were obtained. The positive clones were sent for sequencing analysis. A phylogenetic tree was constructed based on the VHH encoding protein sequence. After cluster analysis, it was found that the 70 sequences belonged to 3 lines, and a total of 8 clones (Lab01, 02, 03, 04, 05, 06, 07 and 08) were selected for construction, expression and identification, respectively.
Example 3 Construction and Expression of Recombinant Candidate Antibodies
[0170] The VHH sequence of interest was recombined into the expression vector of human IgG1 Fc to obtain a recombinant plasmid (see SEQ ID NO: 4 for the sequence of human IgG1 Fc). The recombinant candidate antibody plasmid and transfection reagent PEI (purchased from Polysciences, catalog number: 24765-1) were added to OPTI-MEM (Gibco, catalog number: 11058021), mixed well, let stand for 15 min, and then added to Expi293F cells (Manufacturer: Thermofisher, catalog number: A14527), the obtained mixture was put in a shaker for culture at 5% CO.sub.2, 120 rpm and 37 C. On the second day of transfection, OPM-293 ProFeed (Shanghai OPM Biosciences Co., Ltd., catalog number: F081918-001) and 6 g/L glucose (Manufacturer: Sigma, catalog number: G7528) were added. On the sixth day of transfection, the cell supernatant was collected. The culture supernatant was collected and purified by affinity chromatography with Protein A. The packing used was Mabselect SuRe (No. 10054120, purchased from GE Healthcare). The buffer was Mab affinity balance solution (PBS Buffer) and Mab affinity elution liquid (containing 1M NaCl in PBS buffer) and Mab affinity eluent (citrate buffer). Concentration was determined with an ultramicrovolume spectrophotometer (Nanodrop8000, Thermo). Protein samples to be detected were analyzed by SEC-HPLC to characterize the molecular size homogeneity and purity of the proteins. The HPLC used was Agilent 1260, the chromatographic column TSKgel G3000SWXL was from Tosoh Bioscience, the mobile phase was 200 mM phosphate buffer (pH 7.0)/isopropanol (v/v 9:1) (batch number: 20210519001), the detection temperature was 25 C., the flow rate was 0.5 mL/min, and the detection wavelength was 280 nm. For the SEC-HPLC data, the chromatogram was analyzed by a manual integration method, and the protein purity was calculated by an area normalization method. The main peak was considered as a monomer, the chromatographic peak before the main peak was called an aggregate, and the chromatographic peak after the main peak was called a fragment. The results are shown in Table 7. The final product of the candidate antibody had high purity.
TABLE-US-00007 TABLE 7 Results of expression quantity and SEC purity of BCMA VHH-hFc candidate antibody Expression Concen- Vol- SEC Designation Expression volume tration ume monomer of antibody system (ml) (mg/ml) (ml) (%) BCMA-Lab01 expi 293F 40 2.46 2 98.43 BCMA-Lab05 expi 293F 40 3.01 2 96.04 BCMA-Lab06 expi 293F 40 2.31 2 98.15 BCMA-Lab07 expi 293F 40 6.91 2 97.91 BCMA-Lab04 expi 293F 40 2.15 2 97.59 BCMA-Lab08 expi 293F 40 2.45 2 98.48 BCMA-Lab03 expi 293F 40 1.71 2 98.81 BCMA-Lab02 expi 293F 40 3.47 2 97.6
Example 4 Identification of Recombinant Candidate Antibodies
(A) Detection of binding of BCMA recombinant candidate antibodies to human BCMA protein and cross-binding of BCMA recombinant candidate antibodies to monkey BCMA protein by enzyme-linked immunosorbent assay (ELISA)
[0171] The specific method was as follows: Human BCMA protein (purchased from Acro, catalog number: BCA-H522y) and monkey BCMA protein (purchased from Acro, catalog number: BCA-C52H7) were diluted with PBS to a final concentration of 1 g/mL, respectively, and then added to a 96-well ELISA plate at 50 al/well. The plate was sealed with a plastic film and incubated overnight at 4 C., the plate was washed twice with PBS the next day, and then a blocking solution [PBS+2% (w/v) BSA] was added for blocking at room temperature for 2 h. The blocking solution was discarded, the plate was washed 3 times with PBS, and 100 nM BCMA recombinant chimeric nanobody diluted gradiently or negative control antibody was added at 50 l/well. After incubation at 37 C. for 2 h, the plate was washed 3 times with PBS. HRP (horseradish peroxidase)-labeled secondary antibody (purchased from Merck, catalog number: AP113P) was added, and incubated at 37 C. for 1 h, and the plate was washed 5 times with PBS. TMB substrate was added at 50 l/well, and incubated at room temperature for 10 min, then a stop solution (1.0 M HCl) was added at 50 l/well. The OD450 nm values were read by an ELISA microplate reader (Multimode Plate Reader, EnSight, purchased from Perkin Elmer). The results are shown in
(B) Detection of Binding of BCMA Recombinant Candidate Antibodies to Endogenous Cells Expressing BCMA by Flow Cytometry Experiment (FACS)
[0172] The desired cells were scale-up cultured in T-75 cell culture flasks to the logarithmic growth phase, and the cells were pipetted into a single cell suspension. After the cells were counted, the cells were centrifuged and the cell pellet was resuspended in FACS buffer (PBS+2% fetal calf serum) to 210.sup.6 cells per ml, and the suspension was added to the 96-well FACS reaction plate at 50 l per well, then the sample to be tested of the candidate antibody was added at 50 l per well and the mixture was incubated at 4 C. for 1 h. The obtained mixture was centrifuged and washed 3 times with a PBS buffer. Secondary antibody anti-hlgG(Fc) Alexa 647 (purchased from Jackson, catalog number: 109-605-098) was added at 50 l/well, and incubated on ice for 1 h. The obtained mixture was centrifuged and washed 3 times with a PBS buffer. 100 l of the mixture was taken for detection and result analysis by FACS (FACS Canto, purchased from BD Company). Data analysis was performed by software (FlowJo) to obtain the mean fluorescence intensity (MFI) of the cells. Then, a software (GraphPad Prism8) was used for analysis, data fitting and EC50 calculation. The results are shown in Table 8 and
TABLE-US-00008 TABLE 8 FACS detection of binding activity of recombinant candidate antibodies with H929 and U266 cells H929 U266 Maximum Maximum mean mean fluores- fluores- Designation cence EC50 cence EC50 of antibody intensity (nM) intensity (nM) BCMA-Lab01 6983 2.82 3137 1.80 BCMA-Lab05 3186 1.42 714 3.63 BCMA-Lab06 125 Negative 75 Negative BCMA-Lab07 6081 2.85 985 10.80 BCMA-Lab04 6897 7.72 2512 3.93 BCMA-Lab08 2772 3.34 693 5.14 REGN5459-hIgG1 8957 5.24 4272 7.14 hIgG1 99 Negative 108 Negative BCMA-Lab03 7757 5.36 1280 7.05 REGN5459-hIgG1 10349 9.39 2202 16.61 hIgG1 91 Negative 111 Negative BCMA-Lab02 15783 0.96 2671 0.62 REGN5459-hIgG1 15256 6.46 2654 9.49 hIgG1 167 Negative 119 Negative
(C) Detection of Blocking Effect of Recombinant Candidate Antibodies on the Binding of Ligand APRIL to Human BCMA Protein by Ligand Binding Competition ELISA
[0173] The antigen protein was diluted with PBS to a final concentration of 1 g/mL, and then added to a 96-well ELISA plate at 50 l per well. The plate was sealed with a plastic film and incubated overnight at 4 C., the plate was washed twice with PBS the next day, and then a blocking solution [PBS+2% (w/v) BSA] was added for blocking at room temperature for 2 h. The blocking solution was discarded, the plate was washed 3 times with PBS, and 200 nM BCMA recombinant chimeric nanobody diluted gradiently or negative control antibody was added at 50 l/well. hAPRIL-biotin (purchased from Acro, catalog number: APL-H82F5) was diluted to 0.5 g/mL, with 50 l per well. After incubation at 37 C. for 1.5 h, the plate was washed 3 times with PBS. HRP (horseradish peroxidase)-labeled secondary antibody (purchased from Sigma, catalog number: S2438-250 g) was added, and incubated at 37 C. for 1 h, and the plate was washed 5 times with PBS. TMB substrate was added at 50 l/well, and incubated at room temperature for 10 min, then a stop solution (1.0 M HCl) was added at 50 al/well. The OD450 nm values were read by an ELISA microplate reader (Multimode Plate Reader, EnSight, purchased from Perkin Elmer). The results are shown in
Example 5 Detection of Affinity of BCMA Recombinant Candidate Antibodies
[0174] Anti-BCMA recombinant candidate antibodies were captured using a Protein A chip (GE Healthcare; 29-127-558). A sample buffer and a running buffer were HBS-EP+(10 mM HEPES, 150 mM NaCl, 3 mM EDTA and 0.05% surfactant P20) (GE Healthcare; BR-1006-69). The flow cell was set to 25 C. The sample block was set to 16 C. Both were pretreated with the running buffer. In each cycle, an antibody to be detected was first captured with a Protein A chip, and then a single concentration of BCMA antigen protein was injected. The binding and dissociation processes of the antibody and the antigen protein were recorded, and finally Glycine pH 1.5 (GE Healthcare; BR-1003-54) was used to complete chip regeneration. Binding was measured by injecting different concentrations of BCMA-His in solution for 240 s with a flow rate of 30 L/min. The concentration started from 200 nM (see the detailed results for the actual concentration in the test) and was diluted at 1:1, making a total of 5 concentrations. The dissociation phase was monitored for up to 600 s and was triggered by switching from sample solution to running buffer. The surface was regenerated by washing with a 10 mM glycine solution (pH 1.5) for 30 s at a flow rate of 30 L/min. Bulk refractive index difference was corrected by subtracting the response obtained from the goat anti-human Fc surface. Blank injection was also subtracted (=double reference). For calculation of apparent KD and other kinetic parameters, Langmuir 1:1 model was used. The binding rate (K.sub.a), dissociation rate (K.sub.dis) and binding affinity (KD) of the recombinant candidate antibody to human BCMA protein are shown in the table, wherein REGN5459-hlgG1 antibody was used as a control. As shown in Table 9, the KD values of all the recombinant candidate antibodies for human BCMA protein are below 1E-7M.
TABLE-US-00009 TABLE 9 Binding affinity of recombinant candidate antibodies to human BCMA protein Designation K.sub.a K.sub.dis KD of antibody (1/Ms) (1/s) (M) BCMA-Lab01 1.33E+06 7.02E04 5.27E10 BCMA-Lab04 8.36E+05 2.69E03 3.22E09 BCMA-Lab08 1.32E+07 2.75E01 2.08E08 BCMA-Lab03 8.29E+05 3.15E03 3.79E09 BCMA-Lab02 6.88E+05 4.93E05 7.16E11 REGN5459-hIgG1 7.66E+05 1.78E04 2.33E10
[0175] After a series of experimental screenings, BCMA-Lab01 and BCMA-Lab02 alpaca antibodies were selected for subsequent humanization engineering. The sequences of BCMA-Lab01-BCMA-Lab08 alpaca antibodies are shown in Table 10, and the CDR sequences analyzed by Kabat, IMGT, and Chothia methods are shown in Table 11.
TABLE-US-00010 TABLE10 TheaminoacidsequencesofBCMAalpacaantibodies Designation ofantibody No. Aminoacidsequence BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCSGSGFTLD Lab01 NO:7 YYMIGWFRQAPGKEREGLSSISPADGSTYY ADSVKGRFTISRDSAKNTVYLQMNNLKPED TALYYCAAGNEATISWGFGPWEYDYWGQGT QVTVSS BCMA- SEQID QVQLVESGGGLVQSRGSLRLSCAASESISS Lab02 NO:8 IHIMAWYRRAPGKQRELVAGIRNDGSTVYA DSAKGRFTISRDNAKNTVYLQMNSLKPEDT AVYYCNADQGFGSYSEWERRSRWGQGTEVT VSS BCMA- SEQID EVQVVESGGGLVQPGGSLRLSCAGSGFTLA Lab03 NO:9 HYMIGWFRQAPGKEREGLSSISPADGSTYY ADSVKGRFTISRDNAKNTVYLQMNSLKPED TALYYCAAGNEATISWGFGPYEYDYWGQGT QVTVSS BCMA- SEQID EVQVVESGGGLVQPGGSLRLSCAGSGFTLA Lab04 NO:10 YYMIGWFRQAPGKEREGLSSISPADGSTYY ADSVKGRFTISRDNAKNTVYLQMNSLKPED TALYYCAAGNEAAITWGFGPYEYDYWGQGT QVTVSS BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCAASGFTLA Lab05 NO:11 YYMIGWFRQAPGKEREGVSSISSGTGSTYY ANSVKDRFTISRDNAANKVYLEMNSLKPED TAIYYCAAGNEATITWGFGPYEYDYWGQGT QVTVSS BCMA- SEQID EVQVVESGGGLVQPGGSLRLSCAASGFTLA Lab06 NO:12 YYGIGWFRQAPGQEREGVASITASDGSTYY ADSVKDRFTISRDNAANTVYLQMNSLKPED TAVYFCAAGNDGAISWGFGPYEYDYWGQGT QVTVSS BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCAASGFTFR Lab07 NO:13 SSAMSWARQAPGKGLEWVSAIYPDGRTYYA DSIKGRFTSSRDNAKNTVYLQMNSLRSEDT AIYYCTIGNQLSDLPLGQGTQVTVSS BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCTDSGFTLN Lab08 NO:14 YYMIGWFRQAPGKEQEGLSSISAGDGSTYY ADSVKGRFTISRDYAKNTVYLEMNDLKPED TGVYYCAAGNEGAITWGFGPYEYDYWGQGT QVTVSS
TABLE-US-00011 TABLE11 AnalysisofCDRsequencesbyKabat,IMGTandChothianumbering Designation Analysis ofantibody method CDR1 CDR2 CDR3 BCMA- Kabat YYMIG SISPADGSTYYADSVKG GNEATISWGFGPWEYDY Lab01 (SEQIDNO:34) (SEQIDNO:35) (SEQIDNO:36) IMGT GFTLDYYM ISPADGST AAGNEATISWGFGPWEYDY (SEQIDNO:37) (SEQIDNO:38) (SEQIDNO:39) Chothia GFTLDYY SPADGS GNEATISWGFGPWEYDY (SEQIDNO:40) (SEQIDNO:41) (SEQIDNO:36) BCMA- Kabat IHIMA GIRNDGSTVYADSAKG DQGFGSYSEWERRSR Lab02 (SEQIDNO:42) (SEQIDNO:43) (SEQIDNO:44) IMGT ESISSIHI IRNDGST NADQGFGSYSEWERRSR (SEQIDNO:45) (SEQIDNO:46) (SEQIDNO:47) Chothia ESISSIH RNDGS DQGFGSYSEWERRSR (SEQIDNO:48) (SEQIDNO:49) (SEQIDNO:44) BCMA- Kabat HYMIG SISPADGSTYYADSVKG GNEATISWGFGPYEYDY Lab03 (SEQIDNO:50) (SEQIDNO:35) (SEQIDNO:51) IMGT GFTLAHYM ISPADGST AAGNEATISWGFGPYEYDY (SEQIDNO:52) (SEQIDNO:38) (SEQIDNO:53) Chothia GFTLAHY SPADGS GNEATISWGFGPYEYDY (SEQIDNO:54) (SEQIDNO:41) (SEQIDNO:51) BCMA- Kabat YYMIG SISPADGSTYYADSVKG GNEAAITWGFGPYEYDY Lab04 (SEQIDNO:34) (SEQIDNO:35) (SEQIDNO:55) IMGT GFTLAYYM ISPADGST AAGNEAAITWGFGPYEYDY (SEQIDNO:56) (SEQIDNO:38) (SEQIDNO:57) Chothia GFTLAYY SPADGS GNEAAITWGFGPYEYDY (SEQIDNO:58) (SEQIDNO:41) (SEQIDNO:55) BCMA- Kabat YYMIG SISSGTGSTYYANSVKD GNEATITWGFGPYEYDY Lab05 (SEQIDNO:34) (SEQIDNO:59) (SEQIDNO:60) IMGT GFTLAYYM ISSGTGST AAGNEATITWGFGPYEYDY (SEQIDNO:56) (SEQIDNO:61) (SEQIDNO:62) Chothia GFTLAYY SSGTGS GNEATITWGFGPYEYDY (SEQIDNO:58) (SEQIDNO:63) (SEQIDNO:60) BCMA- Kabat YYGIG SITASDGSTYYADSVKD GNDGAISWGFGPYEYDY Lab06 (SEQIDNO:64) (SEQIDNO:65) (SEQIDNO:66) IMGT GFTLAYYG ITASDGST AAGNDGAISWGFGPYEYDY (SEQIDNO:67) (SEQIDNO:68) (SEQIDNO:69) Chothia GFTLAYY TASDGS GNDGAISWGFGPYEYDY (SEQIDNO:58) (SEQIDNO:70) (SEQIDNO:66) BCMA- Kabat SSAMS AIYPDGRTYYADSIKG GNQLSDLP Lab07 (SEQIDNO:71) (SEQIDNO:72) (SEQIDNO:73) IMGT GFTFRSSA IYPDGRT TIGNQLSDLP (SEQIDNO:74) (SEQIDNO:75) (SEQIDNO:76) Chothia GFTFRSS YPDGR GNQLSDLP (SEQIDNO:77) (SEQIDNO:78) (SEQIDNO:73) BCMA- Kabat YYMIG SISAGDGSTYYADSVKG GNEGAITWGFGPYEYDY Lab08 (SEQIDNO:34) (SEQIDNO:79) (SEQIDNO:80) IMGT GFTLNYYM ISAGDGST AAGNEGAITWGFGPYEYDY (SEQIDNO:81) (SEQIDNO:82) (SEQIDNO:83) Chothia GFTLNYY SAGDGS GNEGAITWGFGPYEYDY (SEQIDNO:84) (SEQIDNO:85) (SEQIDNO:80)
Example 6 Humanization of Nanobodies
[0176] By aligning the IMGT (http://imgt.cines.fr) human antibody heavy and light chain variable region germline gene database, germline genes of heavy chain variable region having high homology to the VHH nanobody were selected as templates, respectively, and the CDRs of the VHH nanobody were grafted into the corresponding human template, to form a variable region sequence in the order of FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. According to needs, the key amino acids in the framework sequence were back-mutated to the corresponding amino acids of the VHH nanobody to ensure the original affinity, and thus the humanized monoclonal antibody was obtained. The CDR amino acid residues of the antibody were determined and annotated by the Kabat numbering system.
(A) Humanization of BCMA-Lab01 Antibody
[0177] The humanization heavy chain templates of VHH nanobody BCMA-Lab01 are IGHV3-64*04 and IGHJ3*01. The CDRs of VHH nanobody BCMA-Lab01 were grafted into the human templates of the nanobody respectively, and thus the corresponding humanized versions were obtained. According to needs, the key amino acids in the FR region sequence of the humanized antibody of BCMA-Lab01 were back-mutated to the corresponding amino acids of the VHH nanobody to ensure the original affinity. There were sites prone to chemical modification in the antibody, and point mutations at these sites had eliminated the risk of modification. The specific mutation designs are shown in Table 12.
TABLE-US-00012 TABLE 12 Mutation design of humanized antibody of BCMA-Lab01 VHH H1 Graft(IGHV3-64*04) + H35G, V37F, G44E, L45R, Y47G, A50S H2 Graft(IGHV3-64*04) + H35G, V37F, G44E, L45R, Y47G, A50S, N74S H3 Graft(IGHV3-64*04) + M34I, H35G, V37F, G44E, L45R, Y47G, A50S, N74S, L79V H4 Graft(IGHV3-64*04) + M34I, H35G, V37F, G44E, L45R, Y47G, A50S, N74S, S75A, L79V H5 Graft(IGHV3-64*04) + M34I, H35G, V37F, G44E, L45R, Y47G, A50S, N74S, L79V, V93L, M121Q H6 Graft(IGHV3-64*04) + M34I, H35G, V37F, G44E, L45R, Y47G, V48L, A50S, N74S, L79V H7 Graft(IGHV3-64*04) + M34I, H35G, V37F, G44E, L45R, Y47G, A50S, N74S, L79V + E1Q
Notes: Graft represents the grafting of the CDRs of the VHH nanobody into the FR region sequence of the human germline template; H35G represents the mutation of H at position 35 of Graft into G, and so on. The numbering of backmutated amino acids is according to the natural sequence numbering.
[0178] The specific sequence of the variable region of the humanized antibody of BCMA-Lab01 is as follows:
The amino acid sequence of BCMA-Lab01-VHH1 is as shown in SEQ ID NO: 15:
TABLE-US-00013 EVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMMGWFRQAPGKEREGVSS ISPADGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAGN EATISWGFGPWEYDYWGQGTMVTVSS
The amino acid sequence of BCMA-Lab01-VHH2 is as shown in SEQ ID NO: 16:
TABLE-US-00014 EVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMMGWFRQAPGKEREGVSS ISPADGSTYYADSVKGRFTISRDSSKNTLYLQMNSLRAEDTAVYYCAAGN EATISWGFGPWEYDYWGQGTMVTVSS
The amino acid sequence of BCMA-Lab01-VHH3 is as shown in SEQ ID NO: 17:
TABLE-US-00015 EVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMIGWFRQAPGKEREGVSS ISPADGSTYYADSVKGRFTISRDSSKNTVYLQMNSLRAEDTAVYYCAAGN EATISWGFGPWEYDYWGQGTMVTVSS
The amino acid sequence of BCMA-Lab01-VHH4 is as shown in SEQ ID NO: 18:
TABLE-US-00016 EVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMIGWFRQAPGKEREGVSS ISPADGSTYYADSVKGRFTISRDSAKNTVYLQMNSLRAEDTAVYYCAAGN EATISWGFGPWEYDYWGQGTMVTVSS
The amino acid sequence of BCMA-Lab01-VHH5 is as shown in SEQ ID NO: 19:
TABLE-US-00017 EVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMIGWFRQAPGKEREGVSS ISPADGSTYYADSVKGRFTISRDSSKNTVYLQMNSLRAEDTALYYCAAGN EATISWGFGPWEYDYWGQGTQVTVSS
The amino acid sequence of BCMA-Lab01-VHH6 is as shown in SEQ ID NO: 20:
TABLE-US-00018 EVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMIGWFRQAPGKEREGLSS ISPADGSTYYADSVKGRFTISRDSSKNTVYLQMNSLRAEDTAVYYCAAGN EATISWGFGPWEYDYWGQGTMVTVSS
The amino acid sequence of BCMA-Lab01-VHH7 is as shown in SEQ ID NO: 21:
TABLE-US-00019 QVQLVESGGGLVQPGGSLRLSCSASGFTLDYYMIGWFRQAPGKEREGVSS ISPADGSTYYADSVKGRFTISRDSSKNTVYLQMNSLRAEDTAVYYCAAGN EATISWGFGPWEYDYWGQGTMVTVSS
The amino acid sequence of humanization heavy chain template IGHV3-64*04 is as shown in SEQ ID NO: 22:
TABLE-US-00020 QVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSA ISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
The amino acid sequence of humanization heavy chain template IGHJ3*01 is as shown in SEQ ID NO: 23:
TABLE-US-00021 WGQGTMVTVSS
According to the Kabat numbering system, the analysis results of the VHH sequence of the above-mentioned humanized nanobody are shown in Table 13.
TABLE-US-00022 TABLE13 KabatanalysisresultsoftheVHHsequenceof thehumanizednanobodyofBCMA-Lab01 Variableregion CDR1 CDR2 CDR3 BCMA-Lab01-VHH1 YYMMG SISPADGSTYYADSVKG GNEATISWGFGPWEYDY BCMA-Lab01-VHH2 (SEQIDNO:86) (SEQIDNO:35) (SEQIDNO:36) BCMA-Lab01-VHH3 YYMIG SISPADGSTYYADSVKG GNEATISWGFGPWEYDY BCMA-Lab01-VHH4 (SEQIDNO:34) (SEQIDNO:35) (SEQIDNO:36) BCMA-Lab01-VHH5 BCMA-Lab01-VHH6 BCMA-Lab01-VHH7
(B) Humanization of BCMA-Lab02 Antibody
[0179] The humanization heavy chain templates of VHH single domain antibody BCMA-Lab02 are IGHV3-7*01 and IGHJ6*01. The CDRs of VHH single domain antibody BCMA-Lab2 were grafted into the human templates of the nanobody respectively, and thus the corresponding humanized versions were obtained. According to needs, the key amino acids in the FR region sequence of the humanized antibody of BCMA-Lab02 were back-mutated to the corresponding amino acids of the VHH single domain antibody to ensure the original affinity. There were sites prone to chemical modification in the antibody, and point mutations at these sites had eliminated the risk of modification. The specific mutation designs are shown in Table 14.
TABLE-US-00023 TABLE 14 Mutation design of humanized antibody of BCMA-Lab02 VH H1 Graft(IGHV3-7*01) + V37Y, G44Q, L45R, W47L H2 Graft(IGHV3-7*01) + S35A, V37Y, G44Q, L45R, W47L H3 Graft(IGHV3-7*01) + S35A, V37Y, G44Q, L45R, W47L, N50G H4 Graft(IGHV3-7*01) + S35A, V37Y, G44Q, L45R, W47L, N50G, Y58V H5 Graft(IGHV3-7*01) + S35A, V37Y, Q39R, G44Q, L45R, W47L, N50G, Y58V H6 Graft(IGHV3-7*01) + S35A, V37Y, G44Q, L45R, W47L, N50G, Y58V, V60A H7 Graft(IGHV3-7*01) + S35A, V37Y, G44Q, L45R, W47L, N50G, Y58V, L78V H8 Graft(IGHV3-7*01) + S35A, V37Y, Q39R, G44Q, L45R, W47L, N50G, Y58V, T118E Notes: Graft represents the grafting of the CDRs of the VHH single domain antibody into the FR region sequence of the human germline template; W47L represents the mutation of W at position 47 of Graft into L, and so on. The numbering of backmutated amino acids is according to the natural sequence numbering.
[0180] The specific sequence of the variable region of the humanized antibody of BCMA-Lab02 is as follows:
The amino acid sequence of BCMA-Lab02-VHH1 is as shown in SEQ ID NO: 24:
TABLE-US-00024 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMSWYRQAPGKQRELVAN IRNDGSTYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH2 is as shown in SEQ ID NO: 25:
TABLE-US-00025 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRQAPGKQRELVAN IRNDGSTYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH3 is as shown in SEQ ID NO: 26:
TABLE-US-00026 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRQAPGKQRELVAG IRNDGSTYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH4 is as shown in SEQ ID NO: 27:
TABLE-US-00027 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRQAPGKQRELVAG IRNDGSTVYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH5 is as shown in SEQ ID NO: 28:
TABLE-US-00028 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRRAPGKQRELVAG IRNDGSTVYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH6 is as shown in SEQ ID NO: 29:
TABLE-US-00029 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRQAPGKQRELVAG IRNDGSTVYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH7 is as shown in SEQ ID NO: 30:
TABLE-US-00030 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRQAPGKQRELVAG IRNDGSTVYVDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTTVTVSS
The amino acid sequence of BCMA-Lab02-VHH8 is as shown in SEQ ID NO: 31:
TABLE-US-00031 EVQLVESGGGLVQPGGSLRLSCAASESISSIHIMAWYRRAPGKQRELVAG IRNDGSTVYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNADQG FGSYSEWERRSRWGQGTEVTVSS
The amino acid sequence of humanization heavy chain template IGHV3-7*01 is as shown in SEQ ID NO: 32:
TABLE-US-00032 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVAN IKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
The amino acid sequence of humanization heavy chain template IGHJ6*01 is as shown in SEQ ID NO: 33:
TABLE-US-00033 WGQGTTVTVSS
According to the Kabat numbering system, the analysis results of the VHH sequence of the above-mentioned humanized single domain antibody are shown in Table 15.
TABLE-US-00034 TABLE15 KabatanalysisresultsoftheVHHsequenceof thehumanizedsingledomainantibodyofBCMA-Lab02 Variableregion CDR1 CDR2 CDR3 BCMA-Lab02-VHH1 IHIMS NIRNDGSTYYVDSVKG DQGFGSYSEWERRSR (SEQIDNO:87) (SEQIDNO:88) (SEQIDNO:44) BCMA-Lab02-VHH2 IHIMA NIRNDGSTYYVDSVKG DQGFGSYSEWERRSR (SEQIDNO:42) (SEQIDNO:88) (SEQIDNO:44) BCMA-Lab02-VHH3 IHIMA GIRNDGSTYYVDSVKG DQGFGSYSEWERRSR (SEQIDNO:42) (SEQIDNO:89) (SEQIDNO:44) BCMA-Lab02-VHH4 IHIMA GIRNDGSTVYVDSVKG DQGFGSYSEWERRSR BCMA-Lab02-VHH5 BCMA-Lab02-VHH7 (SEQIDNO:42) (SEQIDNO:90) (SEQIDNO:44) BCMA-Lab02-VHH8 BCMA-Lab02-VHH6 IHIMA GIRNDGSTVYADSVKG DQGFGSYSEWERRSR (SEQIDNO:42) (SEQIDNO:91) (SEQIDNO:44)
Example 7 Construction, Expression and Purity Determination of Humanized Candidate Nanobodies
[0181] The specific operating method referred to Example 3. The humanized VHH sequence of interest was recombined into the expression vector of human IgG1 Fc to obtain a recombinant plasmid (see SEQ ID NO: 4 for the sequence of human IgG1 Fc). The cell supernatant obtained by expressing the humanized VHH-Fc chimeric antibody was collected, and the purity of the obtained antibody was qualitatively analyzed by SEC-HPLC. The results are shown in Table 16, where / indicates that no detection was performed.
TABLE-US-00035 TABLE 16 Results of expression quantity and SEC purity of BCMA humanized candidate nanobody Designation Expression Expression Concentration Volume SEC of antibody system volume (ml) (mg/ml) (ml) monomer BCMA-Lab01-VHH1 expi 293F 40 0.80 2 98.44 BCMA-Lab01-VHH2 expi 293F 40 0.13 2 99.26 BCMA-Lab01-VHH3 expi 293F 40 0.83 2 98.70 BCMA-Lab01-VHH4 expi 293F 40 1.55 2 98.58 BCMA-Lab01-VHH5 expi 293F 40 0.86 2 98.49 BCMA-Lab01-VHH6 expi 293F 40 0.96 2 98.81 BCMA-Lab01-VHH7 expi 293F 40 1.08 2 98.58 BCMA-Lab02-VHH1 expi 293F 40 4.15 2 / BCMA-Lab02-VHH2 expi 293F 40 5.34 2 / BCMA-Lab02-VHH3 expi 293F 40 4.45 2 / BCMA-Lab02-VHH4 expi 293F 40 5.05 2 / BCMA-Lab02-VHH5 expi 293F 40 12.69 1.8 97.67 BCMA-Lab02-VHH6 expi 293F 40 5.61 2 / BCMA-Lab02-VHH7 expi 293F 40 5.56 2 98.67 BCMA-Lab02-VHH8 expi 293F 40 4.73 2 /
Example 8 Identification of BCMA Humanized Candidate Nanobodies
(A) Detection of Binding of BCMA Humanized Candidate Nanobodies to Human BCMA Protein and Cross-Binding of BCMA Humanized Candidate Nanobodies to Monkey BCMA Protein by Enzyme-Linked Immunosorbent Assay (ELISA)
[0182] The specific method was the same as in Example 4(A). The results are shown in
(B) Detection of Binding of Humanized Candidate Nanobodies to Endogenous Cells Expressing BCMA by Flow Cytometry Experiment (FACS)
[0183] The specific method was the same as in Example 4(B). The results are shown in Table 17 and
TABLE-US-00036 TABLE 17 FACS detection of the binding activity of humanized candidate nanobodies with H929 and U266 cells. H929 U266 Maximum Maximum mean mean fluores- fluores- Designation cence EC50 cence EC50 of antibody intensity (nM) intensity (nM) BCMA-Lab01-VHH1 6347 4.08 1031 5.43 BCMA-Lab01-VHH2 6617 4.22 1304 6.75 BCMA-Lab01-VHH3 9133 2.85 1659 3.48 BCMA-Lab01-VHH4 8229 2.88 1608 3.99 BCMA-Lab01-VHH5 9094 3.82 1591 4.01 BCMA-Lab01-VHH6 10054 3.50 1753 3.25 BCMA-Lab01-VHH7 8619 3.06 1596 3.71 BCMA-Lab01 10017 3.05 1752 3.07 REGN5459-hIgG1 10349 9.39 2202 16.61 hIgG1 91 Negative 111 Negative BCMA-Lab02-VHH1 68 Negative 76 Negative BCMA-Lab02-VHH2 66 Negative 73 Negative BCMA-Lab02-VHH3 9830 2.27 1752 3.02 BCMA-Lab02-VHH4 10061 1.45 1764 1.18 BCMA-Lab02-VHH5 10219 1.33 1938 5.56 BCMA-Lab02-VHH6 10141 1.54 1827 1.86 BCMA-Lab02-VHH7 9842 0.39 1853 0.74 BCMA-Lab02-VHH8 10151 1.49 1768 1.48 BCMA-Lab02 10020 1.67 1840 1.45 REGN5459-hIgG1 9206 13.16 1663 32.17 hIgG1 121 Negative 124 Negative
(C) Detection of Blocking Effect of Humanized Candidate Nanobodies on the Binding of Ligand APRIL to Human BCMA Protein by Ligand Binding Competition ELISA
[0184] The specific method was the same as in Example 4(C). The results are shown in
Example 9 Detection of Affinity of BCMA Humanized Candidate Nanobodies
[0185] The specific operating method referred to Example 5. The binding rate (Ka), dissociation rate (Kdis) and binding affinity (KD) of the humanized candidate nanobodies to human BCMA protein are shown Table 18, wherein REGN5459-hlgG1 antibody was used as a control. As shown in Table 18, the KD values of all the humanized candidate nanobodies for human BCMA protein are below 1E-8M.
TABLE-US-00037 TABLE 18 Binding affinity of humanized candidate nanobodies to human BCMA protein Designation ka kd KD of antibody (1/Ms) (1/s) (M) BCMA-Lab01-VHH1 1.19E+06 8.41E03 7.07E09 BCMA-Lab01-VHH2 1.04E+06 3.61E03 3.48E09 BCMA-Lab01-VHH3 1.15E+06 1.38E03 1.20E09 BCMA-Lab01-VHH4 1.14E+06 1.37E03 1.20E09 BCMA-Lab01-VHH5 1.20E+06 1.41E03 1.17E09 BCMA-Lab01-VHH6 1.31E+06 8.02E04 6.13E10 BCMA-Lab01-VHH7 1.11E+06 1.47E03 1.32E09 BCMA-Lab01 1.28E+06 6.81E04 5.33E10 BCMA-Lab02-VHH4 9.37E+05 1.37E04 1.46E10 BCMA-Lab02-VHH5 7.84E+05 1.03E04 1.32E10 BCMA-Lab02-VHH7 8.05E+05 7.10E05 8.82E11 BCMA-Lab02 7.38E+05 4.47E05 6.06E11 REGN5459-hIgG1 7.81E+05 1.62E04 2.08E10
Example 10 Panning of Nanobody Against BCMA and Identification of Recombinant Candidate Antibodies
(A) Panning of Nanobody Against BCMA
[0186] According to the method of Example 2(C), positive clones that bound to human BCMA were further panned, and a total of 10 clones of Lab09 to 18 were selected for construction, expression, and identification.
(B) Construction and Expression of Recombinant Candidate Antibodies
[0187] According to the method in Example 3, the recombinant candidate antibodies of VHH-IgG1 were obtained. At the same time, it was identified by SEC-HPLC that the purity of the final products of the candidate antibodies were relatively high.
(C) ELISA Detection of the Binding of BCMA Recombinant Candidate Antibodies to Human BCMA Protein
[0188] Referring to the method in Example 4(A), ELISA was used to detect the binding of the recombinant candidate antibodies to human BCMA. The results are shown in
(D) FACS Detection of Binding of BCMA Recombinant Candidate Antibodies to Endogenous Cells Expressing BCMA
[0189] According to the method in Example 4(B), FACS was used to identify the binding of the recombinant candidate antibodies to endogenous cells expressing BCMA, and the results are shown in
TABLE-US-00038 TABLE 19 FACS detection of binding activity of recombinant candidate antibodies with H929 and U266 cells H929 U266 Maximum Maximum mean mean Designation fluorescence EC50 fluorescence EC50 of antibody intensity (nM) intensity (nM) BCMA-Lab09 704 44.08 141 Negative BCMA-Lab10 5154 2.91 1246 1.41 BCMA-Lab11 5096 4.03 1361 2.03 BCMA-Lab12 4572 9.36 858 4.29 BCMA-Lab13 5507 3.53 1596 2.24 BCMA-Lab14 4955 5.60 1299 3.50 BCMA-Lab15 4648 4.12 1337 2.03 BCMA-Lab16 5003 3.51 1401 1.48 BCMA-Lab17 3313 1.74 1010 0.98 BCMA-Lab18 5272 2.79 1415 1.76 HPN217-hHcAb 5021 4.12 1260 2.80 hIgG1 93 Negative 149 Negative
(E) Detection of Blocking Effect of Recombinant Candidate Antibodies on the Binding of Ligand APRIL to Human BCMA Protein by Ligand Binding Competition ELISA
[0190] According to the method in Example 4(C), ligand competition ELISA was used to detect the blocking effect of the recombinant antibodies on the binding of the ligand APRIL to human BCMA protein. The results are shown in
Example 11 Detection of Affinity of BCMA Recombinant Candidate Antibodies
[0191] According to the method in Example 5, Biacore was used to detect the affinity of the recombinant antibodies to human BCMA protein. The results are shown in Table 20. The results show that all antibodies had strong affinity to human BCMA protein. The sequences of the nanobodies are shown in Table 21, and the CDR sequences of the nanobodies were shown in Table 22.
TABLE-US-00039 TABLE 20 Binding affinity of chimeric antibodies to human BCMA protein Designation ka kd KD of antibody (1/Ms) (1/s) (M) BCMA-Lab09 5.00E+04 3.99E03 7.97E08 BCMA-Lab10 8.02E+06 5.51E03 6.87E10 BCMA-Lab11 5.83E+06 1.26E03 2.17E10 BCMA-Lab12 6.92E+05 1.03E02 1.49E08 BCMA-Lab13 5.78E+06 1.71E04 2.97E11 BCMA-Lab14 4.43E+06 2.48E03 5.60E10 BCMA-Lab15 2.47E+06 2.19E03 8.87E10 BCMA-Lab16 2.82E+06 1.57E03 5.58E10 BCMA-Lab17 4.15E+06 1.76E02 4.25E09 BCMA-Lab18 2.04E+06 2.06E03 1.01E09 HPN217-hHcAb 2.64E+06 3.10E03 1.17E09 REGN5459-hIgG1 7.39E+05 1.97E04 2.67E10
TABLE-US-00040 TABLE21 ListofsequencesofBCMArecombinantnanobodies Designation ofantibody No. Aminoacidsequence BCMA- SEQID EVQVVESGGGLVQPGGSLRLSCAASGFTFSSSAMSWARQAPGKGL Lab09 NO:92 EWVSGIYPDGSAEYTDSMKGRFTITRDNAKNTVYLQMNSLKPEDT AVYYCAIGRGPSIQAMFRPGGWGQGTQVTVSS BCMA- SEQID EVQVVESGGGLVQPGGSLRLSCAASGFTFSSSAMSWARQAPGKGR Lab10 NO:93 EWVSGIYPDGSTEYADSMKGRFTITRDNAQNTVYLQMDNLRPEDT AVYYCAVGRPINADRPSELWGRGTQVTVSS BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCAASGSIFSIYAMGWYRQAPGKQR Lab11 NO:94 ELVAAITSGTNTYYRDSVKGRFTISRDNAKNTVYLQMNSLKPEDTA VYSCNVAPWGDYDGAADFVSWGQGTQVTVSS BCMA- SEQID QLQLVESGGGLVQAGGSLRLSCEASGSIFSINAIGWFRQAPGKERE Lab12 NO:95 GVSCISRSDGKTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDT AVYYCATDPSTRYGCYDPALFDSWGQGTQVTVSS BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCAASGSISSIYAMGWYRQAPGKQR Lab13 NO:96 ELVAAIRSAGSTFYRDSVKGRFTISRDNVKNTVYLQMNSLKPEDTA VYQCNVAPWGDYDGAADFTSWGQGTQVTVSS BCMA- SEQID EVQVVESGGGLVQPGGSLRLSCAASGSIFNIYAMGWYRQAPGKQR Lab14 NO:97 ELVAAITSGGSTYYRESVKGRFTISRDNAKNTMYLQMNSLKPEDTA VYYCNVAPWGDYDGAADFDSWGQGTQVTVSS BCMA- SEQID QLQLVESGGGLVQPGGSLRLSCAGSGFTLDYYMIGWFRQAPGKER Lab15 NO:98 EGLSCISPADGSTYYADSVKGRFTISRDSAKNTVYLQMNSLKPEDT ALYYCAAGNEGGISWGFGPYEYDYWGQGTQVTVSS BCMA- SEQID QLQLVESGGGLVQPGESLRLSCTGSGFTLAYYMIGWFRQAPGKER Lab16 NO:99 EGLSCISPADGSTYYADSVKGRFTISRDNAKNVVYLQMNNLKPEDT GVYYCAAGNEAAITWGFGPYEYDQWGQGTQVTVSS BCMA- SEQID QVQLVESGGGLVQPGGSLRLSCTGSGFTLDYYMIGWFRQAPGKER Lab17 NO:100 EGLSCISSGDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDT AVYYCAAGNEATITWGFGPWEYDYWGQGTQVTVSS BCMA- SEQID QVQLVESGGRLVQPGESLRLSCVASGFTFSSSAMSWARQAPGKGLE Lab18 NO:101 WMSGIYPDGTPVYADSMKGRFTVSRDNAKNMVYLQMNSLKPED TAVYYCAVGIRLSDYQGQRRQLLGQGTQVTVSS
TABLE-US-00041 TABLE22 AnalysisofCDRsequencesbyKabat,IMGTandChothianumbering Designation Analysis ofantibody method CDR1 CDR2 CDR3 BCMA- Kabat SSAMS GIYPDGSAEYTDSMKG GRGPSIQAMFRPGG Lab09 (SEQIDNO:71) (SEQIDNO:102) (SEQIDNO:103) IMGT GFTFSSSA IYPDGSA AIGRGPSIQAMFRPGG (SEQIDNO:104) (SEQIDNO:105) (SEQIDNO:106) Chothia GFTFSSS YPDGS GRGPSIQAMFRPGG (SEQIDNO:107) (SEQIDNO:108) (SEQIDNO:103) BCMA- Kabat SSAMS GIYPDGSTEYADSMKG GRPINADRPSEL Lab10 (SEQIDNO:71) (SEQIDNO:109) (SEQIDNO:110) IMGT GFTFSSSA IYPDGST AVGRPINADRPSEL (SEQIDNO:104) (SEQIDNO:111) (SEQIDNO:112) Chothia GFTFSSS YPDGS GRPINADRPSEL (SEQIDNO:107) (SEQIDNO:108) (SEQIDNO:110) BCMA- Kabat IYAMG AITSGTNTYYRDSVKG APWGDYDGAADFVS Lab11 (SEQIDNO:113) (SEQIDNO:114) (SEQIDNO:115) IMGT GSIFSIYA ITSGTNT NVAPWGDYDGAADFVS (SEQIDNO:116) (SEQIDNO:117) (SEQIDNO:118) Chothia GSIFSIY TSGTN APWGDYDGAADFVS (SEQIDNO:119) (SEQIDNO:120) (SEQIDNO:115) BCMA- Kabat INAIG CISRSDGKTYYADSVKG DPSTRYGCYDPALFDS Lab12 (SEQIDNO:121) (SEQIDNO:122) (SEQIDNO:123) IMGT GSIFSINA ISRSDGKT ATDPSTRYGCYDPALFDS (SEQIDNO:124) (SEQIDNO:125) (SEQIDNO:126) Chothia GSIFSIN SRSDGK DPSTRYGCYDPALFDS (SEQIDNO:127) (SEQIDNO:128) (SEQIDNO:123) BCMA- Kabat IYAMG AIRSAGSTFYRDSVKG APWGDYDGAADFTS Lab13 (SEQIDNO:113) (SEQIDNO:129) (SEQIDNO:130) IMGT GSISSIYA IRSAGST NVAPWGDYDGAADFTS (SEQIDNO:131) (SEQIDNO:132) (SEQIDNO:133) Chothia GSISSIY RSAGS APWGDYDGAADFTS (SEQIDNO:134) (SEQIDNO:135) (SEQIDNO:130) BCMA- Kabat IYAMG AITSGGSTYYRESVKG APWGDYDGAADFDS Lab14 (SEQIDNO:113) (SEQIDNO:136) (SEQIDNO:137) IMGT GSIFNIYA ITSGGST NVAPWGDYDGAADFDS (SEQIDNO:138) (SEQIDNO:139) (SEQIDNO:140) Chothia GSIFNIY TSGGS APWGDYDGAADFDS (SEQIDNO:141) (SEQIDNO:142) (SEQIDNO:137) BCMA- Kabat YYMIG CISPADGSTYYADSVKG GNEGGISWGFGPYEYDY Lab15 (SEQIDNO:34) (SEQIDNO:143) (SEQIDNO:144) IMGT GFTLDYYM ISPADGST AAGNEGGISWGFGPYEYDY (SEQIDNO:37) (SEQIDNO:38) (SEQIDNO:145) Chothia GFTLDYY SPADGS GNEGGISWGFGPYEYDY (SEQIDNO:40) (SEQIDNO:41) (SEQIDNO:144) BCMA- Kabat YYMIG CISPADGSTYYADSVKG GNEAAITWGFGPYEYDQ Lab16 (SEQIDNO:34) (SEQIDNO:143) (SEQIDNO:146) IMGT GFTLAYYM ISPADGST AAGNEAAITWGFGPYEYDQ (SEQIDNO:56) (SEQIDNO:38) (SEQIDNO:147) Chothia GFTLAYY GNEAAITWGFGPYEYDQ (SEQIDNO:58) (SEQIDNO:146) BCMA- Kabat YYMIG CISSGDGSTYYADSVKG GNEATITWGFGPWEYDY Lab17 (SEQIDNO:34) (SEQIDNO:148) (SEQIDNO:149) IMGT GFTLDYYM ISSGDGST AAGNEATITWGFGPWEYDY (SEQIDNO:37) (SEQIDNO:150) (SEQIDNO:151) Chothia GFTLDYY SSGDGS GNEATITWGFGPWEYDY (SEQIDNO:40) (SEQIDNO:152) (SEQIDNO:149) BCMA- Kabat SSAMS GIYPDGTPVYADSMKG GIRLSDYQGQRRQL Lab18 (SEQIDNO:71) (SEQIDNO:153) (SEQIDNO:154) IMGT GFTFSSSA IYPDGTP AVGIRLSDYQGQRRQL (SEQIDNO:104) (SEQIDNO:155) (SEQIDNO:156) Chothia GFTFSSS YPDGT GIRLSDYQGQRRQL (SEQIDNO:107) (SEQIDNO:157) (SEQIDNO:154)