Heterocyclic compounds as triggering receptor expressed on myeloid cells 2 agonists and methods of use

Abstract

The present disclosure provides compounds of Formula I, useful for the activation of Triggering Receptor Expressed on Myeloid Cells 2 (“TREM2”). ##STR00001## This disclosure also provides pharmaceutical compositions comprising the compounds, uses of the compounds, and compositions for treatment of, for example, a neurodegenerative disorder. Further, the disclosure provides intermediates useful in the synthesis of compounds of Formula I.

Claims

1. A compound selected from: ##STR01933## ##STR01934## ##STR01935## ##STR01936## ##STR01937## ##STR01938## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

2. The compound of claim 1, which is: ##STR01939## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

3. The compound of claim 1, which is: ##STR01940## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

4. The compound of claim 1, which is: ##STR01941## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

5. The compound of claim 1, which is: ##STR01942## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

6. The compound of claim 1, which is: ##STR01943## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

7. The compound of claim 1, which is: ##STR01944## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

8. The compound of claim 1, which is: ##STR01945## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

9. The compound of claim 1, which is: ##STR01946## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

10. The compound of claim 1, which is: ##STR01947## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

11. The compound of claim 1, which is: ##STR01948## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

12. The compound of claim 1, which is: ##STR01949## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

13. The compound of claim 1, which is: ##STR01950## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

14. The compound of claim 1, which is: ##STR01951## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

15. The compound of claim 1, which is: ##STR01952## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

16. A pharmaceutical composition comprising a compound selected from: ##STR01953## ##STR01954## ##STR01955## ##STR01956## ##STR01957## ##STR01958## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, and a pharmaceutically acceptable excipient.

17. The pharmaceutical composition of claim 16, wherein the compound is ##STR01959## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

18. The pharmaceutical composition of claim 16, wherein the compound is ##STR01960## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

19. The pharmaceutical composition of claim 16, wherein the compound is ##STR01961## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

20. The pharmaceutical composition of claim 16, wherein the compound is ##STR01962## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

21. The pharmaceutical composition of claim 16, wherein the compound is ##STR01963## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

22. The pharmaceutical composition of claim 16, wherein the compound is ##STR01964## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

23. The pharmaceutical composition of claim 16, wherein the compound is ##STR01965## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

24. The pharmaceutical composition of claim 16, wherein the compound is ##STR01966## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

25. The pharmaceutical composition of claim 16, wherein the compound is ##STR01967## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

26. The pharmaceutical composition of claim 16, wherein the compound is ##STR01968## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

27. The pharmaceutical composition of claim 16, wherein the compound is ##STR01969## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

28. The pharmaceutical composition of claim 16, wherein the compound is ##STR01970## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

29. The pharmaceutical composition of claim 16, wherein the compound is ##STR01971## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

30. The pharmaceutical composition of claim 16, wherein the compound is ##STR01972## or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The drawings show embodiments of the disclosed subject matter for the purpose of illustrating the invention. However, it should be understood that the present application is not limited to the precise arrangements and embodiments shown in the drawings.

(2) FIG. 1 is a graph showing the measured concentration of MCP-1 (CCL2) in the right cortex of mice 24 hours after administration of the compound of Example 192 or Antibody 13E7, as compared to controls. Error bars are shown as standard error of the mean (SEM).

(3) FIG. 2 is a graph showing the measured concentration of IP-10 (CXCL10) in the right cortex of mice 24 hours after administration of the compound of Example 192 or Antibody 13E7, as compared to controls. Error bars are shown as SEM.

(4) FIG. 3 is a graph showing the measured concentration of IP-10 (CXCL10) in plasma samples taken from mice 24 hours after administration of the compound of Example 192 or Antibody 13E7, as compared to controls. Error bars are shown as SEM.

(5) Reference will now be made in detail to embodiments of the present disclosure. While certain embodiments of the present disclosure will be described, it will be understood that it is not intended to limit the embodiments of the present disclosure to those described embodiments. To the contrary, reference to embodiments of the present disclosure is intended to cover alternatives, modifications, and equivalents as may be included within the spirit and scope of the embodiments of the present disclosure as defined by the appended claims.

DETAILED DESCRIPTION

(6) Provided herein as Embodiment 1 is a compound of Formula I

(7) ##STR00004##

(8) or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(9) Ring A together with the 6-membered ring system to which it is fused forms a bicyclic ring system of formula

(10) ##STR00005##
wherein

(11) X.sup.1 is CH or N;

(12) X.sup.2 is CH.sub.2, CHF, CF.sub.2, O, or NH;

(13) X.sup.3 is CH or N;

(14) X.sup.4 is CH or N;

(15) X.sup.5 is CH or N;

(16) X.sup.6 is CH or N;

(17) R.sup.1 is H or C.sub.1-3alkyl;

(18) R.sup.2 is H or C.sub.1-3alkyl;

(19) R.sup.3 is H or C.sub.1-3alkyl;

(20) R.sup.4 is C.sub.1-6alkyl, C.sub.1-6haloalkyl, diC.sub.1-3alkylamino, —C(═O)O(C.sub.1-6alkyl), C.sub.3-6cycloalkyl, C.sub.3-6heterocycloalkyl, phenyl, 5-membered heteroaryl, or 6-membered heteroaryl; wherein (1) the C.sub.3-6cycloalkyl or the C.sub.3-6heterocycloalkyl is optionally substituted with C═O; (2) the phenyl, 5-membered heteroaryl, or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from halogen, C.sub.1-6alkyl, C.sub.1-6haloalkyl, C.sub.1-6alkoxy, C.sub.1-6haloalkoxy, —(C.sub.1-3alkyl)O(C.sub.1-3alkyl), —CN, C.sub.2-4alkenyl, C.sub.3-6cycloalkyl, and C.sub.3-6heterocycloalkyl; wherein the C.sub.1-6alkyl and C.sub.1-6haloalkyl of subsection (2) are optionally substituted with OH; and wherein the C.sub.3-6heterocycloalkyl of subsection (2) is optionally substituted with 1 to 3 substituents selected from halogen, C.sub.1-3alkyl, and —C(═O)O(C.sub.1-6alkyl);

(21) R.sup.5 is C.sub.1-6alkyl, C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.1-6alkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, C.sub.1-3alkoxy, and C.sub.1-3haloalkoxy;

(22) R.sup.6 is H, halogen, or C.sub.1-3alkyl;

(23) R.sup.7 is H, halogen, or C.sub.1-3alkyl;

(24) R.sup.8 is H or C.sub.1-3alkyl;

(25) R.sup.9 is H or C.sub.1-5alkyl; and

(26) n is 0 or 1; provided that when X.sup.1 is N and n is 0, X.sup.2 is not NH or O.

(27) Provided herein as Embodiment 2 is the compound according to Embodiment 1, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is not 4-(3-fluoro-1-azetidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine; 4-(3,3-difluoro-1-piperidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pyrido[2,3-d]pyrimidine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-((cis-3-(trifluoromethyl)cyclobutyl)methoxy)pyrido[2,3-d]pyrimidine; or 2-methyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(cis-3-(trifluoromethyl)cyclobutyl)-2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-one.

(28) Provided herein as Embodiment 3 is the compound according to Embodiment 1 or Embodiment 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula II

(29) ##STR00006##

(30) Provided herein as Embodiment 4 is the compound according to Embodiment 1 or Embodiment 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIA

(31) ##STR00007##

(32) Provided herein as Embodiment 5 is the compound according to Embodiment 1 or Embodiment 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIB

(33) ##STR00008##

(34) Provided herein as Embodiment 6 is the compound according to Embodiment 1 or Embodiment 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIC

(35) ##STR00009##

(36) Provided herein as Embodiment 7 is the compound according to Embodiment 1 or Embodiment 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IID

(37) ##STR00010##

(38) Provided herein as Embodiment 8 is the compound according to Embodiment 1 or Embodiment 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIE

(39) ##STR00011##

(40) Provided herein as Embodiment 9 is the compound according to any one of Embodiments 1-4, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(41) X.sup.1 is CH.

(42) Provided herein as Embodiment 10 is the compound according to any one of Embodiments 1-4, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(43) X.sup.1 is N.

(44) Provided herein as Embodiment 11 is the compound according to any one of Embodiments 1-10, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(45) X.sup.2 is CH.sub.2, CF.sub.2, or O.

(46) Provided herein as Embodiment 12 is the compound according to any one of Embodiments 1-10, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(47) X.sup.2 is O.

(48) Provided herein as Embodiment 13 is the compound according to any one of Embodiments 1-12, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(49) X.sup.3 is CH.

(50) Provided herein as Embodiment 14 is the compound according to any one of Embodiments 1-12, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(51) X.sup.3 is N.

(52) Provided herein as Embodiment 15 is the compound according to any one of Embodiments 1-14, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(53) X.sup.4 is CH.

(54) Provided herein as Embodiment 16 is the compound according to any one of Embodiments 1-14, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(55) X.sup.4 is N.

(56) Provided herein as Embodiment 17 is the compound according to any one of Embodiments 1-16, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(57) X.sup.5 is CH.

(58) Provided herein as Embodiment 18 is the compound according to any one of Embodiments 1-16, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(59) X.sup.5 is N.

(60) Provided herein as Embodiment 19 is the compound according to any one of Embodiments 1-18, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(61) X.sup.6 is CH.

(62) Provided herein as Embodiment 20 is the compound according to any one of Embodiments 1-18, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(63) X.sup.6 is N.

(64) Provided herein as Embodiment 21 is the compound according to any one of Embodiments 1-20, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(65) R.sup.1 is H or methyl.

(66) Provided herein as Embodiment 22 is the compound according to any one of Embodiments 1-20, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(67) R.sup.1 is H.

(68) Provided herein as Embodiment 23 is the compound according to any one of Embodiments 1-22, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(69) ##STR00012##

(70) Provided herein as Embodiment 24 is the compound according to any one of Embodiments 1-22, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(71) R.sup.2 is H.

(72) Provided herein as Embodiment 25 is the compound according to any one of Embodiments 1-24, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(73) R.sup.3 is H or methyl.

(74) Provided herein as Embodiment 26 is the compound according to any one of Embodiments 1-24, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(75) R.sup.3 is H.

(76) Provided herein as Embodiment 27 is the compound according to any one of Embodiments 1-26, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(77) R.sup.4 is C.sub.1-6alkyl, C.sub.3-6heterocycloalkyl, 5-membered heteroaryl, or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, C.sub.3-6cycloalkyl, and C.sub.3-6heterocycloalkyl.

(78) Provided herein as Embodiment 28 is the compound according to any one of Embodiments 1-26, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(79) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl and C.sub.3-6cycloalkyl.

(80) Provided herein as Embodiment 29 is the compound according to any one of Embodiments 1-26, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(81) R.sup.4 is methyl, tetrahydrofuran-3-yl,

(82) ##STR00013##

(83) Provided herein as Embodiment 30 is the compound according to any one of Embodiments 1-26, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(84) R.sup.4 is N, or

(85) ##STR00014##

(86) Provided herein as Embodiment 31 is the compound according to any one of Embodiments 1-30, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(87) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy.

(88) Provided herein as Embodiment 32 is the compound according to any one of Embodiments 1-30, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(89) R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3, optionally substituted C.sub.3-6cycloalkyl, optionally substituted spiro[3.3]heptanyl, optionally substituted spiro[5.2]octanyl, optionally substituted

(90) ##STR00015##
optionally substituted cyclopent-1-en-1-yl, optionally substituted cyclohex-1-en-1-yl, optionally substituted phenyl, optionally substituted pyridinyl, substituted aziridine-1-yl, substituted pyrrolidine-1-yl, substituted azabicyclo[3.1.0]hexan-3-yl, substituted piperidine-1-yl, or substituted —OCH.sub.2—(C.sub.3-4cycloalkyl).

(91) Provided herein as Embodiment 33 is the compound according to any one of Embodiments 1-30, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(92) R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3,

(93) ##STR00016## ##STR00017##

(94) Provided herein as Embodiment 34 is the compound according to any one of Embodiments 1-33, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(95) R.sup.6 is H, chlorine, or methyl.

(96) Provided herein as Embodiment 35 is the compound according to any one of Embodiments 1-33, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(97) R.sup.6 is H, chlorine, or methyl.

(98) Provided herein as Embodiment 36 is the compound according to any one of Embodiments 1-33, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(99) R.sup.6 is H or methyl.

(100) Provided herein as Embodiment 37 is the compound according to any one of Embodiments 1-36, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(101) R.sup.7 is H, methyl, or ethyl.

(102) Provided herein as Embodiment 38 is the compound according to any one of Embodiments 1-36, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(103) R.sup.7 is H or methyl.

(104) Provided herein as Embodiment 39 is the compound according to any one of Embodiments 1-38, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(105) R.sup.8 is H or methyl.

(106) Provided herein as Embodiment 40 is the compound according to any one of Embodiments 1-39, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(107) R.sup.9 is H, methyl, ethyl, or iso-propyl.

(108) Provided herein as Embodiment 41 is the compound according to any one of Embodiments 1-40, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(109) n is 0.

(110) Provided herein as Embodiment 42 is the compound according to any one of Embodiments 1-40, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(111) n is 1.

(112) Provided herein as Embodiment 43 is the compound according to Embodiment 1, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine; 4-(4-chloro-2-fluorophenyl)-2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methylpteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)pteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl)pteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-(2-(tetrahydro-3-furanyl)-4-morpholinyl)pteridine; 4-(2,4-difluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2,4-difluorophenyl)-7-methylpteridine; 4-(2,4-difluorophenyl)-7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2-fluoro-4-methylphenyl)-7-methylpteridine; 4-(2-fluoro-4-methylphenyl)-7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)pteridine; 7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methyl-4-(cis-3-(trifluoromethyl)cyclobutyl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methyl-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine; 7-methyl-2-((2R)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl)-4-(cis-3-(trifluoromethyl)cyclobutyl)pteridine; 7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(cis-3-(trifluoromethyl)cyclobutyl)pteridine; 7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine; 4-(2-fluoro-4-(trifluoromethyl)phenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(3,4,5-trifluorophenyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(6-(trifluoromethyl)-3-pyridinyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(6-methyl-3-pyridinyl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine; 4-(4-chloro-2-fluorophenyl)-2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-6,7-dimethylpteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl) pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl) pteridine; 4-(4-chloro-2-fluorophenl)-6,7-dimcthyl-2-(2-(tetrahydro-3-furanyl)-4-morpholinyl) pteridine; 4-((1R,5S)-6,6-difluoro-3-azabicyclo[3.1.0]hexan-3-yl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1 H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(3-methoxy-1-azetidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(3-(trifluoromethyl)-1-azetidinyl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2,4-difuorophenyl)-6,7-dimethylpteridine; 4-(2,4-difluorophcnyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S)-2-((3R)-tetrahydro-3-furanyl)-4-morpholinyl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2R)-2-((3R)-tetrahydro-3-furanyl)-4-morpholinyl) pteridine; 4-(2,4-difluorophcml)-6,7-dimethyl-2-((2R)-2-((3S)-tetrahydro-3-furanyl)-4-morpholinyl) pteridine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 2-((2S)-2-(1-cvclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2-fluoro-4-methylphenyl)-6,7-dimethylpteridine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pridinyl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(3,3,3-trifluoropropyl) pteridine; 6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(3,3,3-trifluoropropyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(cis-3-(trifluoromethyl) cyclobutyl)pteridine; 4-(cis-3-(difluoromethyl)cyclobutyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1 H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(trans-3-(difluoromethyl)cyclobutyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(6,6-difluorospiro[3.3]heptan-2-yl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 2-((2S)-2-(1-cvclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(cis-3-(difluoromethyl) cyclobutyl)-6,7-dimethylpteridine: 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(trans-3-(difluoromethyl) cyclobutyl)-6,7-dimethylpteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(6,6-difluorospiro [3.3]heptan-2-yl)-6,7-dimethylpteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-6,7-dimethyl-4-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 6,7-dimethyl-2-((2S)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl)cyclobutyl) pteridine: 6,7-dimethyl-2-((2R)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 4-(cis-3-(difluoromethyl)cyclobutyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyrtdimyl)-4-morpholinyl) pteridine; 4-(trans-3-(difluoromethyl)cyclobutyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)pteridine; 6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 4-(6,6-difluoiospiro[3.3]heptan-2-yl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-((1R,2R)-2-(trifluoromethyl) cyclopropyl)pteridine; 4-(4-chloro-2-methylphenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(4-fluoro-2-methylphenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(3,4-difluorophcnyl)-6,7-dimethy 1-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methy 1-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2,3,4-trifluorophenyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2,4,5-trifluorophenyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(3-(trifluoromethyl) bicyclol[1.1.1]pentan-1-yl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-6,7-dimethyl-4-(3-(trifluoromethyl) bicyclol[1.1.1]pentan-1-yl)pteridine; 6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(3-(trifluoromethyl) bicyclo[1.1.1]pentan-1-yl)pteridine; 4-(4,4-difluoro-1-piperidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(4,4-dimethyl-1-piperidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-((3R)-3-fluoro-1-piperidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-((3S)-3-fluoro-1-pipcridinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(3,3-difluoro-1-pyrrolidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(3,3-dimethyl-1-pyrrolidinyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine: 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophcnyl)-3-methyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-7-((2S)-2-(1-ethyl-1H-pyrazol-4-yl)-4-morpholinyl)-2-methylpyrido [3,4-b]pyrazine; 5-(4-chloro-2-fluorophcnyl)-7-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-2-methylpyrido [3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophcnyl)-7-((2S)-2-(2-methoxy-4-pyridinyl)-4-morpholinyl)-2-methylpyrido [3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[3,4-b]pyrazine; 2,3-dimethyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-5-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[3,4-b]pyrazine; 7-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-2,3-dimethyl-5-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[3,4-b]pyrazine; 2,3-dimethyl-7-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-5-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[3,4-b]pyrazine; 4-(4-chloro-2-fluorophenyl)-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophcnyl)-2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methylpyrido [2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2R)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) ppyrido[2,3-d]pynmidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2R)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-7-methy]-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2,4-difluorophenyl)-methylpyrido [2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(2-fluoro-4-methylphenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2-fluoro-4-methylphenyl)-7-methylpyrido [2,3-d]pyrimidine; 4-(2-fluoro-4-methylphenyl)-7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methyl-4-(trans-3-(trifluoromlhyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(3-(trifluoromethyl) bicyclo[1.1.1]pentan-1-yl)pyrido[2,3-d]pyrimidine; 7-methyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(3-(trifluoromethyl) bicyclo[1.1.1]pentan-1-yl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophcnyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-5-pyrimidinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidme; 4-((3,3-difluorocyclobutyl)methoxy)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(((1R,2R)-2-(trifluoromethyl) cyclopropyl)methoxy)pyrido[2,3-d]pyrimidine; 4-(((1S)-2,2-dimethylcyclopropyl)methoxy)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-6,7-dimethyl-4-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 6,7-dimetyl-2-((2S)-2-(6-methyl-4-pyridazinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pyrido[2,3-d]pyrimidine; 6-chloro-4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-2-methyl-6-((2S)-2-methyl-4-morpholinyl)-2,3-dihydro-1H-pyrrolo [3,4-c]pyridin-1-one; 4-(4-chloro-2-fluorophenyl)-2-methyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-one; 4-(4-chloro-2-fluorophcnyl)-6-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-2-methyl-2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-one; 4-(4-chloro-2-fluorophenyl)-2-ethyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-one; 4-(4-chloro-2-fluorophcnyl)-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-2-(2-propanyl)-2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-one; 4-(4-chloro-2-fluorophenyl)-2-((3S)-4,4-difluoro-3-(1-methyl-1 H-pyrazol-4-yl)-1-piperidinyl)-6,7-dimethylpteridine; 4-(4-chloro-2-fluorophenyl)-2-((3R)-4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)-1-piperidinyl)-6,7-dimethylpteridine; 4-(4,4-difluoro-1-cyclohexen-1-yl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-((4R)-4-(trifluoromethyl)-1-cyclohexen-1-yl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-((4S)-4-(trifluoromethyl)-1-cyclohexen-1-yl) pteridine; 4-(1-cyclopcnten-1-yl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(1-(3-oxetanyl)-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[3,4-b]pyrazine; 4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(cis-4-(trifluoromethyl) cyclohexyl)pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(trans-4-(trifluoromethyl) cyclohcxyl)pteridine; 4-(4,4-difluorocyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-cyclohexyl-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-4-(cis-4-methylcyclohcxyl)-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-4-(trans-4-methylcyclohexyl)-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(spiro [2.5]octan-6-yl)pteridine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(4,4-difluorocyclohexyl)-6,7-dimethylpteridine; 4-(4,4-difluorocyclohexyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pteridine: 4-cyclopentyl-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 4-(4,4-difluorocyclohcxyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine: 7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(cis-4-(trifluoromethyl) cyclohexyl)pyrido[2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(4,4-difluorocyclohexyl)-7-methylpyrido [2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-7-methyl-4-(cis-4-(trifluoromethyl) cyclohexyl)pyrido[2,3-d[pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morphohnyl)-7-methyl-4-(trans-4-(trifluoromethyl) cyclohcxyl)pyrido[2,3-d]pyrimidine; 4-(3,3-difluorocyclobutyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pteridine; 5-(4-chloro-2-fluorophenyl)-6-methyl-3-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) isoquinoline; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,6-naphthyridine; 5-(4-chloro-2-fluorophenyl)-7-((2S)-2-(2-methoxy-4-pyridinyl)-4-morpholinyl)-2-methyl-1,6-naphthyridine; 5-(4-chloro-2-fluorophenyl)-7-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-2-methyl-1,6-naphthyridine; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl)-1,6-naphthyridine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,6-naphthyridine; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) quinazoline; 5-(2,4-difluorophenyl)-2-methyl-7-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) quinazoline; 4-(4-chloro-2-fluorophenyl)-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,8-naphthyridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,8-naphthyridine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,8-naphthyridine; 8-(4-chloro-2-fluorophenyl)-2-methyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-b]pyrazine; 8-(4-chloro-2-fluorophenyl)-3-methyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-b]pyrazine; 8-(4-chloro-2-fluorophenyl)-2,3-dimethyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-b]pyrazine; 8-(2,4-difluorophenyl)-2,3-dimethyl-6-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) quinoxaline; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S)-2-(2-methyl-4-pyndinyl)-4-morpholinyl) quinoxaline; 5-(2,4-difluorophcnyl)-2,3-dimethyl-7-((2S)-2-(1-methyl-1-pyrazol-4-yl)-4-morpholinyl) quinoxaline; 4-(trans-4-chlorocyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pvrazol-4-yl)-4-morpholinyl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-7-ethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S)-2-(2-methyl-4-pyridinyl)-4-morpholinyl) pyrido[2,3-d]pyrimidine; 2-((2S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-morpholinyl)-4-(2,4-difluorophenyl)-6,7-dimethylpyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)-7-methylpteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2R,4S)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S,4R)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2R,4S)-2-(2-methyl-5-pyrimidinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S,4R)-2-(2-methyl-5-pyrimidinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4,4-difluorocyclohcxyl)-6,7-dimethyl-2-((2S,4R)-2-(1-methyl-1 H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4,4-difluorocyclohexyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-2-((2S,4R)-2-(1-cyclopropyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)-6,7-dimethylpteridine; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)-6,7-dimethylpteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)ptendine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 8-(4-chloro-2-fluorophcnyl)-3-methyl-6-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-b]pyrazine; 8-(4-chloro-2-fluorophenyl)-2,3-dimethyl-6-((2S,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-b]pyrazine; 8-(4-chloro-2-fluorophenyl)-2,3-dimethyl-6-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-b]pyazine; 8-(2,4-difluorophenyl)-2,3-dimethyl-6-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-b]pyrazine; 8-(2-fluoro-4-methylphenyl)-2,3-dimethyl-6-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-b]pyrazine; 8-(2-fluoro-4-methylphenyl)-2,3-dimethyl-6-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2S,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 5-(2,4-difluorophenyl)-2,3-dimethyl-7-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 5-(2-fluoro-4-methylphenyl)-2,3-dimethyl-7-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)-7-methylpyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-2-((2S,4R)-2-(1-cyclopropyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)-6,7-dimethylpyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)-6,7-dimethylpyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophcnyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 6,7-dimethyl-2-((2R,4R)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S,4R)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4S)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(2-methoxy-4-pyridinyl)tetrahydro-2H-pyran-4-yl)-6,7-dimethylpteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4S)-2-(2-methyl-5-pyrimidinyl) tetrahydro-2H-pyran-4-yl)pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S,4R)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2R,4S)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S,4S)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl) pteridine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2R,4R)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl) pteridine; 6,7-dimethyl-2-((2S,4R)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 6,7-dimethyl-2-((2R,4S)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl) cyclobutyl)pteridine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4S,6R)-2-methyl-6-(1-methyl-1H-pyrazol-4-yl) tetrahydro-2H-pyran-4-yl)pteridine; 5-(4-chloro-2-fluorophcnyl)-2,3-dimethyl-7-((2S,4R)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2R,4S)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2R,4R)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S,4S)-2-(2-methyl-4-pyridinyl) tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-7-methyl-2-((2S,4S)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl) pyrido[2,3-d]pyrimidine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2R,4S)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2-fluoro-4-methylphenyl)-6,7-dimethyl-2-((2S,4R)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4R)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2S,4R)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S,4S)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2R,4R)-2-(2-methyl-4-pyridinyl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; 4-(4-chloro-2-fluorophenyl)-6,7-dimethyl-2-((2R,4S,6R)-2-methyl-6-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)pyrido[2,3-d]pyrimidine; or 5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2R,4S,6R)-2-methyl-6-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine.

(113) Provided herein as Embodiment 44 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof wherein the compound is

(114) ##STR00018##

(115) Provided herein as Embodiment 45 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(116) ##STR00019##

(117) Provided herein as Embodiment 46 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(118) ##STR00020##

(119) Provided herein as Embodiment 47 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(120) ##STR00021##

(121) Provided herein as Embodiment 48 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(122) ##STR00022##

(123) Provided herein as Embodiment 49 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(124) ##STR00023##

(125) Provided herein as Embodiment 50 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(126) ##STR00024##

(127) Provided herein as Embodiment 51 is the compound according to Embodiment 1, or a pharmaceutically acceptable salt thereof, wherein the compound is

(128) ##STR00025##

(129) Provided herein as Embodiment 52 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa;

(130) ##STR00026##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(131) Provided herein as Embodiment 53 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb;

(132) ##STR00027##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(133) Provided herein as Embodiment 54 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIc;

(134) ##STR00028##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(135) Provided herein as Embodiment 55 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIId;

(136) ##STR00029##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(137) Provided herein as Embodiment 56 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVa;

(138) ##STR00030##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(139) Provided herein as Embodiment 57 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVb;

(140) ##STR00031##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(141) Provided herein as Embodiment 58 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVc;

(142) ##STR00032##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(143) Provided herein as Embodiment 59 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va;

(144) ##STR00033##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(145) Provided herein as Embodiment 60 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vb;

(146) ##STR00034##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(147) Provided herein as Embodiment 61 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vc;

(148) ##STR00035##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(149) Provided herein as Embodiment 62 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIa;

(150) ##STR00036##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(151) Provided herein as Embodiment 63 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIb;

(152) ##STR00037##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(153) Provided herein as Embodiment 64 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vic;

(154) ##STR00038##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(155) Provided herein as Embodiment 65 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VII;

(156) ##STR00039##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(157) Provided herein as Embodiment 66 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIa;

(158) ##STR00040##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(159) Provided herein as Embodiment 67 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIb;

(160) ##STR00041##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(161) Provided herein as Embodiment 68 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIc;

(162) ##STR00042##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(163) Provided herein as Embodiment 69 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IXa;

(164) ##STR00043##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(165) Provided herein as Embodiment 70 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IXb;

(166) ##STR00044##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(167) Provided herein as Embodiment 71 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IXc;

(168) ##STR00045##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(169) Provided herein as Embodiment 72 is the compound according to Embodiment 1 or 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula X;

(170) ##STR00046##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(171) Provided herein as Embodiment 73 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula XI;

(172) ##STR00047##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(173) Provided herein as Embodiment 74 is the compound according to Embodiment 1 or 2, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula XII;

(174) ##STR00048##
wherein each variable is as defined above and described in embodiments herein both singly and in combination.

(175) Provided herein as Embodiment 75 is the compound according to any one of Embodiments 1-74, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl.

(176) Provided herein as Embodiment 76 is the compound according to any one of Embodiments 1-74, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H.

(177) Provided herein as Embodiment 77 is the compound according to any one of Embodiments 1-74, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is methyl.

(178) Provided herein as Embodiment 78 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl.

(179) Provided herein as Embodiment 79 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl and C.sub.3-6cycloalkyl. In some embodiments, R.sup.4 is 5-membered heteroaryl optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl and C.sub.3-6cycloalkyl. In some embodiments, R.sup.4 is 6-membered heteroaryl optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl and C.sub.3-6cycloalkyl.

(180) Provided herein as Embodiment 80 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(181) R.sup.4 is methyl, tetrahydrofuran-3-yl,

(182) ##STR00049##

(183) Provided herein as Embodiment 81 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(184) R.sup.4 is methyl, tetrahydrofuran-3-yl,

(185) ##STR00050##

(186) Provided herein as Embodiment 82 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(187) R.sup.4 is

(188) ##STR00051##

(189) Provided herein as Embodiment 83 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(190) R.sup.4 is

(191) ##STR00052##

(192) Provided herein as Embodiment 84 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(193) R.sup.4 is

(194) ##STR00053##

(195) Provided herein as Embodiment 85 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(196) R.sup.4 is

(197) ##STR00054##

(198) Provided herein as Embodiment 86 is the compound according to any one of Embodiments 1-77, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(199) R.sup.4 is

(200) ##STR00055##

(201) Provided herein as Embodiment 87 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(202) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy.

(203) In some embodiments, R.sup.5 is C.sub.1-6haloalkyl. In some embodiments, R.sup.5 is C.sub.3-6cycloalkyl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R.sup.5 is C.sub.5-8spiroalkyl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R.sup.5 is C.sub.5-8stricycloalkyl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R.sup.5 is cyclopent-1-en-1-yl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R.sup.5 is cyclohex-1-en-1-yl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R.sup.5 is phenyl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R.sup.5 is 6-membered heteroaryl optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl. In some embodiments, R is aziridine-1-yl substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy. In some embodiments, R.sup.5 is pyrrolidine-1-yl substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy. In some embodiments, R.sup.5 is azabicyclo[3.1.0]hexan-3-yl substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy. In some embodiments, R is piperidine-1-yl substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy. In some embodiments, R is —OCH.sub.2—(C.sub.3-6cycloalkyl) substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy.

(204) Provided herein as Embodiment 88 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3, optionally substituted C.sub.3-6cycloalkyl, optionally substituted spiro[3.3]heptanyl, optionally substituted spiro[5.2]octanyl, optionally substituted

(205) ##STR00056##
optionally substituted cyclopent-1-en-1-yl, optionally substituted cyclohex-1-en-1-yl, optionally substituted phenyl, optionally substituted pyridinyl, substituted aziridine-1-yl, substituted pyrrolidine-1-yl, substituted azabicyclo[3.1.0]hexan-3-yl, substituted piperidine-1-yl, or substituted —OCH.sub.2—(C.sub.3-4cycloalkyl). In some embodiments, R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3. In some embodiments, R.sub.5 is optionally substituted C.sub.3-6cycloalkyl. In some embodiments, R.sub.5 is optionally substituted spiro[3.3]heptanyl. In some embodiments, R.sup.5 is optionally substituted spiro[5.2]octanyl. In some embodiments, R.sup.5 is optionally substituted

(206) ##STR00057##
In some embodiments, R.sup.5 is optionally substituted cyclopent-1-en-1-yl. In some embodiments, R.sup.5 is optionally substituted cyclohex-1-en-1-yl. In some embodiments, R.sub.5 is optionally substituted phenyl. In some embodiments, R.sub.5 is optionally substituted pyridinyl. In some embodiments, R.sup.5 is optionally substituted aziridine-1-yl. In some embodiments, R.sup.5 is optionally substituted pyrrolidine-1-yl. In some embodiments, R.sup.5 is optionally substituted azabicyclo[3.1.0]hexan-3-yl. In some embodiments, R.sup.5 is optionally substituted piperidine-1-yl. In some embodiments, R.sup.5 is optionally substituted —OCH.sub.2—(C.sub.3-4cycloalkyl).

(207) Provided herein as Embodiment 89 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(208) R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3,

(209) ##STR00058## ##STR00059## ##STR00060##

(210) Provided herein as Embodiment 90 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(211) R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3,

(212) ##STR00061## ##STR00062##

(213) Provided herein as Embodiment 91 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.5 is optionally substituted phenyl.

(214) Provided herein as Embodiment 92 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(215) R.sup.5 is

(216) ##STR00063##

(217) Provided herein as Embodiment 93 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(218) R.sup.5 is

(219) ##STR00064##

(220) Provided herein as Embodiment 94 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(221) R.sup.5 is

(222) ##STR00065##

(223) Provided herein as Embodiment 95 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(224) R.sup.5 is

(225) ##STR00066##

(226) Provided herein as Embodiment 96 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(227) R.sup.5 is

(228) ##STR00067##

(229) Provided herein as Embodiment 97 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(230) R.sup.5 is

(231) ##STR00068##

(232) Provided herein as Embodiment 98 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.5 is optionally substituted C.sub.3-6cycloalkyl, optionally substituted spiro[3.3]heptanyl, optionally substituted spiro[5.2]octanyl, or optionally substituted.

(233) ##STR00069##

(234) Provided herein as Embodiment 99 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(235) R.sup.5 is

(236) ##STR00070##
In some embodiments, R.sup.5 is

(237) ##STR00071##

(238) Provided herein as Embodiment 100 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(239) R.sup.5 is

(240) ##STR00072##

(241) Provided herein as Embodiment 101 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(242) R.sup.5 is

(243) ##STR00073##

(244) Provided herein as Embodiment 102 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(245) R.sup.5 is

(246) ##STR00074##

(247) Provided herein as Embodiment 103 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.5 is optionally substituted cyclopent-1-en-1-yl, or optionally substituted cyclohex-1-en-1-yl.

(248) Provided herein as Embodiment 104 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(249) R.sup.5 is

(250) ##STR00075##

(251) Provided herein as Embodiment 105 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.5 is optionally substituted pyridinyl.

(252) Provided herein as Embodiment 106 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(253) R.sup.5 is

(254) ##STR00076##

(255) Provided herein as Embodiment 107 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.5 is substituted aziridine-1-yl, substituted pyrrolidine-1-yl, substituted azabicyclo[3.1.0]hexan-3-yl, or substituted piperidine-1-yl.

(256) Provided herein as Embodiment 108 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(257) R.sup.5 is

(258) ##STR00077##

(259) Provided herein as Embodiment 109 is the compound according to any one of Embodiments 1-86, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein

(260) R.sup.5 is

(261) ##STR00078##

(262) Provided herein as Embodiment 110 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H, chlorine, or methyl.

(263) Provided herein as Embodiment 111 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H or methyl.

(264) Provided herein as Embodiment 112 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H.

(265) Provided herein as Embodiment 113 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is methyl.

(266) Provided herein as Embodiment 114 is the compound according to any one of Embodiments 1-113, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.7 is H, methyl, or ethyl.

(267) Provided herein as Embodiment 115 is the compound according to any one of Embodiments 1-113, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.7 is H.

(268) Provided herein as Embodiment 116 is the compound according to any one of Embodiments 1-113, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.7 is methyl.

(269) Provided herein as Embodiment 117 is the compound according to any one of Embodiments 1-113, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.7 is ethyl.

(270) Provided herein as Embodiment 118 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H or methyl and R.sup.7 is H or methyl.

(271) Provided herein as Embodiment 119 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H or methyl and R.sup.7 is methyl.

(272) Provided herein as Embodiment 120 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H and R.sup.7 is methyl.

(273) Provided herein as Embodiment 121 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is methyl and R.sup.7 is methyl.

(274) Provided herein as Embodiment 122 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is Cl and R.sup.7 is methyl.

(275) Provided herein as Embodiment 123 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is H and R.sup.7 is ethyl.

(276) Provided herein as Embodiment 124 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.9 is H, methyl, ethyl, or iso-propyl.

(277) Provided herein as Embodiment 125 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.9 is methyl, ethyl, or iso-propyl.

(278) Provided herein as Embodiment 126 is the compound according to any one of Embodiments 1-125125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(279) ##STR00079##
R.sup.5 is

(280) ##STR00080##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(281) Provided herein as Embodiment 127 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(282) ##STR00081##
R.sup.5 is

(283) ##STR00082##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(284) Provided herein as Embodiment 128 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(285) ##STR00083##
R.sup.5 is

(286) ##STR00084##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(287) Provided herein as Embodiment 129 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(288) ##STR00085##
R.sup.5 is

(289) ##STR00086##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(290) Provided herein as Embodiment 130 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(291) ##STR00087##
R.sup.5 is

(292) ##STR00088##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(293) Provided herein as Embodiment 131 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(294) ##STR00089##
R.sup.5 is

(295) ##STR00090##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(296) Provided herein as Embodiment 132 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(297) ##STR00091##
R.sup.5 is

(298) ##STR00092##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(299) Provided herein as Embodiment 133 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(300) ##STR00093##
R.sup.5 is

(301) ##STR00094##
R.sup.6 is H or methyl and R.sup.7 is methyl.

(302) Provided herein as Embodiment 134 is the compound according to any one of Embodiments 1-125, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.2 is H or methyl; R.sup.4 is

(303) ##STR00095##
R.sup.5 is

(304) ##STR00096##
and R.sup.9 is methyl, ethyl or iso-propyl.

(305) Provided herein as Embodiment 135 is the compound according to any one of Embodiments 1-131, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein at least one hydrogen atom of the compound is a deuterium atom.

(306) Provided herein as Embodiment 136 is the compound according to any one of Embodiments 1-131, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein at least one C.sub.1-C.sub.6alkyl group of the compound is substituted with at least one deuterium atom.

(307) Provided herein as Embodiment 137 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 is —CD.sub.3.

(308) Provided herein as Embodiment 138 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.7 is —CD.sub.3.

(309) Provided herein as Embodiment 139 is the compound according to any one of Embodiments 1-109, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein R.sup.6 and R.sup.7 are both —CD.sub.3.

(310) Provided herein as Embodiment 140 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(311) ##STR00097##
wherein

(312) R.sup.2 is H or methyl;

(313) R.sup.4 is

(314) ##STR00098##

(315) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(316) R is H or methyl; and

(317) R.sup.7 is methyl;

(318) provided that;

(319) when R.sup.4 is

(320) ##STR00099##
and R.sup.2 is H, R.sup.5 is not

(321) ##STR00100##
and

(322) when R.sup.4 is

(323) ##STR00101##
and R.sup.2 is H, R.sup.5 is not

(324) ##STR00102##

(325) Provided herein as Embodiment 141 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(326) ##STR00103##
wherein

(327) R.sup.2 is H or methyl;

(328) R.sup.4 is

(329) ##STR00104##

(330) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(331) R.sup.6 is H or methyl; and

(332) R.sup.7 is methyl.

(333) Provided herein as Embodiment 142 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(334) ##STR00105##
wherein

(335) R.sup.2 is methyl;

(336) R.sup.4 is

(337) ##STR00106##

(338) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(339) R.sup.6 is H or methyl; and

(340) R.sup.7 is methyl.

(341) Provided herein as Embodiment 143 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(342) ##STR00107##
wherein

(343) R.sup.2 is H or methyl;

(344) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(345) R.sup.5 is

(346) ##STR00108##

(347) R.sup.6 is H or methyl; and

(348) R.sup.7 is methyl.

(349) Provided herein as Embodiment 144 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(350) ##STR00109##
wherein

(351) R.sup.2 is H or methyl;

(352) R.sup.4 is

(353) ##STR00110##

(354) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(355) R.sup.6 is H or methyl; and

(356) R.sup.7 is methyl;

(357) provided that;

(358) when R.sup.4 is

(359) ##STR00111##
R.sup.5 is not

(360) ##STR00112##

(361) when R.sup.4 is

(362) ##STR00113##
and R.sup.2 is H, R.sup.5 is not

(363) ##STR00114##
and

(364) when R.sup.4 is

(365) ##STR00115##
R.sup.5 is not

(366) ##STR00116##

(367) Provided herein as Embodiment 145 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(368) ##STR00117##
wherein

(369) R.sup.2 is H or methyl;

(370) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(371) R.sup.5 is

(372) ##STR00118##

(373) R.sup.6 is H or methyl; and

(374) R.sup.7 is methyl;

(375) provided that when R.sup.4 is

(376) ##STR00119##
R.sup.5 is not

(377) ##STR00120##

(378) Provided herein as Embodiment 146 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(379) ##STR00121##
wherein

(380) R.sup.2 is H or methyl;

(381) R.sup.4 is;

(382) ##STR00122##

(383) R.sup.5 is

(384) ##STR00123##

(385) R.sup.6 is H or methyl; and

(386) R.sup.7 is methyl.

(387) Provided herein as Embodiment 147 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(388) ##STR00124##
wherein

(389) R.sup.2 is H or methyl;

(390) R.sup.4 is

(391) ##STR00125##

(392) R.sup.5 is

(393) ##STR00126##
or R.sup.5 is

(394) ##STR00127##
when R.sup.2 is methyl;

(395) R.sup.6 is H or methyl; and

(396) R.sup.7 is methyl.

(397) Provided herein as Embodiment 148 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va

(398) ##STR00128##
wherein

(399) R.sup.2 is H or methyl;

(400) R.sup.4 is

(401) ##STR00129##

(402) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(403) R.sup.6 is H or methyl; and

(404) R.sup.7 is methyl;

(405) provided that;

(406) when R.sup.6 is Me and R.sup.2 is H, R.sup.5 is not

(407) ##STR00130##
and

(408) when both R.sup.2 and R.sup.6 are H, R.sup.5 is not

(409) ##STR00131##

(410) Provided herein as Embodiment 149 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vb

(411) ##STR00132##
wherein

(412) R.sup.2 is H or methyl;

(413) R.sup.4 is

(414) ##STR00133##

(415) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8cycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(416) R.sup.6 is H or methyl; and

(417) R.sup.7 is methyl;

(418) provided that when R.sup.2 is H, R.sup.5 is not

(419) ##STR00134##

(420) Provided herein as Embodiment 150 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va or Vb

(421) ##STR00135##
wherein

(422) R.sup.2 is H or methyl;

(423) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(424) R.sup.5 is

(425) ##STR00136##

(426) R.sup.6 is H or methyl; and

(427) R.sup.7 is methyl.

(428) Provided herein as Embodiment 151 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va or Vb

(429) ##STR00137##
wherein

(430) R.sup.2 is H or methyl;

(431) R.sup.4 is

(432) ##STR00138##

(433) R.sup.5 is

(434) ##STR00139##

(435) R.sup.6 is H or methyl; and

(436) R.sup.7 is methyl.

(437) Provided herein as Embodiment 152 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va or Vb

(438) ##STR00140##
wherein

(439) R.sup.2 is methyl;

(440) R.sup.4 is

(441) ##STR00141##

(442) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(443) R.sup.6 is H or methyl; and

(444) R.sup.7 is methyl.

(445) Provided herein as Embodiment 153 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vb

(446) ##STR00142##
wherein

(447) R.sup.2 is H or methyl;

(448) R.sup.4 is

(449) ##STR00143##

(450) R.sup.5 is

(451) ##STR00144##

(452) R.sup.6 is H or methyl; and

(453) R.sup.7 is methyl;

(454) provided that when R.sup.2 is H, R.sup.5 is not.

(455) ##STR00145##

(456) Provided herein as Embodiment 154 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIa

(457) ##STR00146##
wherein

(458) R.sup.2 is H or methyl;

(459) R.sup.4 is

(460) ##STR00147##

(461) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and
wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(462) R.sup.6 is H or methyl; and

(463) R.sup.7 is Me

(464) provided that R.sup.5 is not

(465) ##STR00148##

(466) Provided herein as Embodiment 155 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIa

(467) ##STR00149##
wherein

(468) R.sup.2 is H or methyl;

(469) R.sup.4 is

(470) ##STR00150##

(471) R.sup.5 is

(472) ##STR00151##

(473) R.sup.6 is H or methyl; and

(474) R.sup.7 is methyl.

(475) Provided herein as Embodiment 156 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIb

(476) ##STR00152##
wherein

(477) R.sup.2 is H or methyl;

(478) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(479) R.sup.5 is C.sub.1-6haloalkyl, C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(480) R.sup.6 is H or methyl; and

(481) R.sup.7 is methyl.

(482) Provided herein as Embodiment 157 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVb

(483) ##STR00153##
wherein

(484) R.sup.2 is H or methyl;

(485) R.sup.4 is

(486) ##STR00154##

(487) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(488) R.sup.6 is H or methyl; and

(489) R.sup.7 is Me;

(490) provided that when R.sup.2 is H, R.sup.5 is not

(491) ##STR00155##

(492) Provided herein as Embodiment 158 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(493) ##STR00156##
wherein

(494) R2 is H;

(495) R.sup.4 is

(496) ##STR00157##

(497) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(498) R.sup.6 is H or methyl; and

(499) R.sup.7 is methyl;

(500) provided that R.sup.5 is not

(501) ##STR00158##

(502) Provided herein as Embodiment 159 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(503) ##STR00159##
wherein

(504) R.sup.2 is H;

(505) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(506) R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3,

(507) ##STR00160## ##STR00161##

(508) R.sup.6 is H or methyl; and

(509) R.sup.7 is methyl;

(510) provided that R.sup.4 is not

(511) ##STR00162##

(512) Provided herein as Embodiment 160 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIa

(513) ##STR00163##
wherein

(514) R.sup.2 is H;

(515) R.sup.4 is

(516) ##STR00164##

(517) R.sup.5 is —CH.sub.2CH.sub.2CF.sub.3,

(518) ##STR00165## ##STR00166##

(519) R.sup.6 is H or methyl; and

(520) R.sup.7 is methyl.

(521) Provided herein as Embodiment 161 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(522) ##STR00167##
wherein

(523) R.sup.2 is Me and R.sup.4 is

(524) ##STR00168##
or

(525) R.sup.2 is H and R.sup.4 is

(526) ##STR00169##

(527) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(528) R.sup.6 is H or methyl; and

(529) R.sup.7 is methyl;

(530) provided that;

(531) R.sup.5 is not

(532) ##STR00170##

(533) when R.sup.4 is

(534) ##STR00171##
R.sup.5 is not

(535) ##STR00172##
and

(536) when R.sup.4 is

(537) ##STR00173##
R.sup.5 is not

(538) ##STR00174##

(539) Provided herein as Embodiment 162 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(540) ##STR00175##
wherein

(541) R.sup.2 is H or methyl;

(542) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(543) R.sup.5 is

(544) ##STR00176##

(545) R.sup.6 is H or methyl; and

(546) R.sup.7 is methyl;

(547) provided that;

(548) when R.sup.4 is

(549) ##STR00177##
R.sup.5 is not

(550) ##STR00178##
and

(551) when R.sup.4 is

(552) ##STR00179##
R.sup.5 is not

(553) ##STR00180##

(554) Provided herein as Embodiment 163 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IIIb

(555) ##STR00181##
wherein

(556) R.sup.2 is Me and R.sup.4 is

(557) ##STR00182##
or

(558) R.sup.2 is H and R.sup.4 is

(559) ##STR00183##

(560) R.sup.5 is

(561) ##STR00184##

(562) R.sup.6 is H or methyl; and

(563) R.sup.7 is methyl;

(564) provided that;

(565) when R.sup.4 is

(566) ##STR00185##
R.sup.5 is not

(567) ##STR00186##
and

(568) when R.sup.4 is

(569) ##STR00187##
R.sup.5 is not

(570) ##STR00188##

(571) Provided herein as Embodiment 164 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVa

(572) ##STR00189##
wherein

(573) R.sup.2 is H or methyl;

(574) R.sup.4 is

(575) ##STR00190##

(576) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(577) R.sup.6 is H or methyl; and

(578) R.sup.7 is Me, Cl or ethyl.

(579) Provided herein as Embodiment 165 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVa

(580) ##STR00191##
wherein

(581) R.sup.2 is H or methyl;

(582) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(583) R.sup.5 is

(584) ##STR00192##

(585) R.sup.6 is H or methyl; and

(586) R.sup.7 is Me, Cl or ethyl.

(587) Provided herein as Embodiment 166 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula IVa

(588) ##STR00193##
wherein

(589) R.sup.2 is H or methyl;

(590) R.sup.4 is

(591) ##STR00194##

(592) R.sup.5 is

(593) ##STR00195##

(594) R.sup.6 is H or methyl; and

(595) R.sup.7 is Me, C.sub.1 or ethyl.

(596) Provided herein as Embodiment 167 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va

(597) ##STR00196##
wherein

(598) R.sup.2 is H;

(599) R.sup.4 is

(600) ##STR00197##

(601) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(602) R.sup.6 is H or methyl; and

(603) R.sup.7 is methyl;

(604) provided that R.sup.5 is not

(605) ##STR00198##

(606) Provided herein as Embodiment 168 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va

(607) ##STR00199##
wherein

(608) R.sup.2 is H;

(609) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(610) R.sup.5 is

(611) ##STR00200##

(612) R.sup.6 is H or methyl; and

(613) R.sup.7 is methyl.

(614) Provided herein as Embodiment 169 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Va

(615) ##STR00201##
wherein

(616) R.sup.2 is H;

(617) R.sup.4 is

(618) ##STR00202##
R.sup.5 is

(619) ##STR00203##

(620) R.sup.6 is H or methyl; and

(621) R.sup.7 is methyl.

(622) Provided herein as Embodiment 170 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vb

(623) ##STR00204##
wherein

(624) R.sup.2 is H;

(625) R.sup.4 is

(626) ##STR00205##

(627) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(628) R.sup.6 is H or methyl; and

(629) R.sup.7 is methyl;

(630) provided that R.sup.5 is not

(631) ##STR00206##

(632) Provided herein as Embodiment 171 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vb

(633) ##STR00207##
wherein

(634) R.sup.2 is H;

(635) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(636) R.sup.5 is

(637) ##STR00208##

(638) R.sup.6 is H or methyl; and

(639) R.sup.7 is methyl;

(640) provided that when R.sup.4 is

(641) ##STR00209##
R.sup.5 is not

(642) ##STR00210##

(643) Provided herein as Embodiment 172 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula Vb

(644) ##STR00211##
wherein

(645) R.sup.2 is H;

(646) R.sup.4 is

(647) ##STR00212##
and R.sup.5 is

(648) ##STR00213##
or

(649) R.sup.4 is

(650) ##STR00214##
and R.sup.5 is

(651) ##STR00215##

(652) R.sup.6 is H or methyl; and

(653) R.sup.7 is methyl.

(654) Provided herein as Embodiment 173 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIa

(655) ##STR00216##
wherein

(656) R.sup.2 is H;

(657) R.sup.4 is

(658) ##STR00217##

(659) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy;

(660) R.sup.6 is H or methyl; and

(661) R.sup.7 is methyl;

(662) provided that when R.sup.4 is

(663) ##STR00218##
R.sup.5 is not

(664) ##STR00219##

(665) Provided herein as Embodiment 174 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIa

(666) ##STR00220##
wherein

(667) R.sup.2 is H;

(668) R.sup.4 is 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(669) R.sup.5 is

(670) ##STR00221##

(671) R.sup.6 is H or methyl; and

(672) R.sup.7 is methyl.

(673) Provided herein as Embodiment 175 is the compound according to Embodiment 1, 2, or 3, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula VIIIa

(674) ##STR00222##
wherein

(675) R.sub.2 is H;

(676) R.sup.4 is

(677) ##STR00223##

(678) R.sup.5 is

(679) ##STR00224##

(680) R.sup.6 is H or methyl; and

(681) R.sup.7 is methyl.

(682) Provided herein as Embodiment 176 is the compound according to Embodiment 1 or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula XII

(683) ##STR00225##
wherein

(684) R.sup.2 is H;

(685) R.sup.4 is C.sub.1-6alkyl, 5-membered heteroaryl or 6-membered heteroaryl; wherein the 5-membered heteroaryl or 6-membered heteroaryl group is optionally substituted with 1 to 3 substituents independently selected from C.sub.1-6alkyl, C.sub.1-6alkoxy, and C.sub.3-6cycloalkyl;

(686) R.sup.5 is C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8stricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, 6-membered heteroaryl, aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, or —OCH.sub.2—(C.sub.3-6cycloalkyl), wherein the C.sub.3-6cycloalkyl, C.sub.5-8spiroalkyl, C.sub.5-8tricycloalkyl, cyclopent-1-en-1-yl, cyclohex-1-en-1-yl, phenyl, and 6-membered heteroaryl is further optionally substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, and C.sub.1-3haloalkyl, and wherein the aziridine-1-yl, pyrrolidine-1-yl, 3-azabicyclo[3.1.0]hexan-3-yl, piperidine-1-yl, and —OCH.sub.2—(C.sub.3-6cycloalkyl) is further substituted with 1 to 4 substituents independently selected from halogen, C.sub.1-3alkyl, C.sub.1-3haloalkyl, and C.sub.1-3alkoxy; and

(687) R.sup.9 is methyl, ethyl or isopropyl.

(688) Provided herein as Embodiment 177 is the compound according to Embodiment 1 or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, wherein the compound is a compound of Formula XII

(689) R.sup.4

(690) ##STR00226##
wherein

(691) R.sup.2 is H;

(692) R.sup.4 is methyl,

(693) ##STR00227##

(694) R.sup.5 is

(695) ##STR00228##
and

(696) R.sup.9 is methyl, ethyl or isopropyl.

(697) Exemplary compounds of the invention are set forth in Table A, below. In some embodiments, the compound is a compound set forth in Table A. Provided herein as Embodiment 178 is a compound depicted in Table A or a pharmaceutically acceptable salt thereof.

(698) TABLE-US-00001 TABLE A Exemplary Compounds I-# Structure I-1 embedded image I-2 0embedded image I-3 embedded image I-4 embedded image I-5 embedded image I-6 embedded image I-7 embedded image I-8 embedded image I-9 embedded image I-10 embedded image I-11 embedded image I-12 0embedded image I-13 embedded image I-14 embedded image I-15 embedded image I-16 embedded image I-17 embedded image I-18 embedded image I-19 embedded image I-20 embedded image I-21 embedded image I-22 0embedded image I-23 embedded image I-24 embedded image I-25 embedded image I-26 embedded image I-27 embedded image I-28 embedded image I-29 embedded image I-30 embedded image I-31 embedded image I-32 0embedded image I-33 embedded image I-34 embedded image I-35 embedded image I-36 embedded image I-37 embedded image I-38 embedded image I-39 embedded image I-40 embedded image I-41 embedded image I-42 0embedded image I-43 embedded image I-44 embedded image I-45 embedded image I-46 embedded image I-47 embedded image I-48 embedded image I-49 embedded image I-50 embedded image I-51 embedded image I-52 0embedded image I-53 embedded image I-54 embedded image I-55 embedded image I-56 embedded image I-57 embedded image I-58 embedded image I-59 embedded image I-60 embedded image I-61 embedded image I-62 0embedded image I-63 embedded image I-64 embedded image I-65 embedded image I-66 embedded image I-67 embedded image I-68 embedded image I-69 embedded image I-70 embedded image I-71 embedded image I-72 00embedded image I-73 01embedded image I-74 02embedded image I-75 03embedded image I-76 04embedded image I-77 05embedded image I-78 06embedded image I-79 07embedded image I-80 08embedded image I-81 09embedded image I-82 0embedded image I-83 embedded image I-84 embedded image I-85 embedded image I-86 embedded image I-87 embedded image I-88 embedded image I-89 embedded image I-90 embedded image I-91 embedded image I-92 0embedded image I-93 embedded image I-94 embedded image I-95 embedded image I-96 embedded image I-97 embedded image I-98 embedded image I-99 embedded image I-100 embedded image I-101 embedded image I-102 0embedded image I-103 embedded image I-104 embedded image I-105 embedded image I-106 embedded image I-107 embedded image I-108 embedded image I-109 embedded image I-110 embedded image I-111 embedded image I-112 0embedded image I-113 embedded image I-114 embedded image I-115 embedded image I-116 embedded image I-117 embedded image I-118 embedded image I-119 embedded image I-120 embedded image I-121 embedded image I-122 0embedded image I-123 embedded image I-124 embedded image I-125 embedded image I-126 embedded image I-127 embedded image I-128 embedded image I-129 embedded image I-130 embedded image I-131 embedded image I-132 0embedded image I-133 embedded image I-134 embedded image I-135 embedded image I-136 embedded image I-137 embedded image I-138 embedded image I-139 embedded image I-140 embedded image I-141 embedded image I-142 0embedded image I-143 embedded image I-144 embedded image I-145 embedded image I-146 embedded image I-147 embedded image I-148 embedded image I-149 embedded image I-150 embedded image I-151 embedded image I-152 0embedded image I-153 embedded image I-154 embedded image I-155 embedded image I-156 embedded image I-157 embedded image I-158 embedded image I-159 embedded image I-160 embedded image I-161 embedded image I-162 0embedded image I-163 embedded image I-164 embedded image I-165 embedded image I-166 embedded image I-167 embedded image I-168 embedded image I-169 embedded image I-170 embedded image I-171 embedded image I-172 00embedded image I-173 01embedded image I-174 02embedded image I-175 03embedded image I-176 04embedded image I-177 05embedded image I-178 06embedded image I-179 07embedded image I-180 08embedded image I-181 09embedded image I-182 0embedded image I-183 embedded image I-184 embedded image I-185 embedded image I-186 embedded image I-187 embedded image I-188 embedded image I-189 embedded image I-190 embedded image I-191 embedded image I-192 0embedded image I-193 embedded image I-194 embedded image I-195 embedded image I-196 embedded image I-197 embedded image I-198 embedded image I-199 embedded image I-200 embedded image I-201 embedded image I-202 0embedded image I-203 embedded image I-204 embedded image I-205 embedded image I-206 embedded image I-207 embedded image I-208 embedded image I-209 embedded image I-210 embedded image I-211 embedded image I-212 0embedded image I-213 embedded image I-214 embedded image I-215 embedded image I-216 embedded image I-217 embedded image I-218 embedded image I-219 embedded image I-220 embedded image I-221 embedded image I-222 0embedded image I-223 embedded image I-224 embedded image I-225 embedded image I-226 embedded image I-227 embedded image I-228 embedded image I-229 embedded image I-230 embedded image I-231 embedded image I-232 0embedded image I-233 embedded image I-234 embedded image I-235 embedded image I-236 embedded image I-237 embedded image I-238 embedded image I-239 embedded image I-240 embedded image I-241 embedded image I-242 0embedded image I-243 embedded image I-244 embedded image I-245 embedded image I-246 embedded image I-247 embedded image I-248 embedded image I-249 embedded image I-250 embedded image I-251 embedded image I-252 0embedded image I-253 embedded image I-254 embedded image I-255 embedded image I-256 embedded image I-257 embedded image I-258 embedded image I-259 embedded image I-260 embedded image I-261 embedded image I-262 0embedded image I-263 embedded image I-264 embedded image I-265 embedded image I-266 embedded image I-267 embedded image I-268 embedded image I-269 embedded image I-270 embedded image I-271 embedded image I-272 00embedded image I-273 01embedded image I-274 02embedded image I-275 03embedded image I-276 04embedded image I-277 05embedded image I-278 06embedded image I-279 07embedded image I-280 08embedded image I-281 09embedded image I-282 0embedded image I-283 embedded image I-284 embedded image I-285 embedded image I-286 embedded image I-287 embedded image I-288 embedded image I-289 embedded image I-290 embedded image I-291 embedded image I-292 0embedded image I-293 embedded image I-294 embedded image I-295 embedded image I-296 embedded image I-297 embedded image I-298 embedded image I-299 embedded image I-300 embedded image I-301 embedded image I-302 0embedded image I-303 embedded image I-304 embedded image I-305 embedded image I-306 embedded image I-307 embedded image I-308 embedded image I-309 embedded image I-310 embedded image I-311 embedded image I-312 0embedded image I-313 embedded image I-314 embedded image I-315 embedded image I-316 embedded image I-317 embedded image I-318 embedded image I-319 embedded image I-320 embedded image I-321 embedded image I-322 0embedded image I-323 embedded image I-324 embedded image I-325 embedded image I-326 embedded image I-327 embedded image I-328 embedded image I-329 embedded image I-330 embedded image I-331 embedded image I-332 0embedded image I-333 embedded image I-334 embedded image I-335 embedded image I-336 embedded image I-337 embedded image I-338 embedded image I-339 embedded image I-340 embedded image I-341 embedded image I-342 0embedded image I-343 embedded image I-344 embedded image I-345 embedded image I-346 embedded image I-347 embedded image I-348 embedded image I-349 embedded image I-350 embedded image I-351 embedded image I-352 0embedded image I-353 embedded image I-354 embedded image I-355 embedded image I-356 embedded image I-357 embedded image I-358 embedded image I-359 embedded image I-360 embedded image I-361 embedded image I-362 0embedded image I-363 embedded image I-364 embedded image I-365 embedded image I-366 embedded image I-367 embedded image I-368 embedded image I-369 embedded image I-370 embedded image I-371 embedded image I-372 00embedded image I-373 01embedded image I-374 02embedded image I-375 03embedded image I-376 04embedded image I-377 05embedded image I-378 06embedded image I-379 07embedded image I-380 08embedded image I-381 09embedded image I-382 0embedded image I-383 embedded image I-384 embedded image I-385 embedded image I-386 embedded image I-387 embedded image I-388 embedded image I-389 embedded image I-390 embedded image I-391 embedded image I-392 0embedded image I-393 embedded image I-394 embedded image I-395 embedded image I-396 embedded image I-397 embedded image I-398 embedded image I-399 embedded image I-400 embedded image I-401 embedded image I-402 0embedded image I-403 embedded image I-404 embedded image I-405 embedded image I-406 embedded image I-407 embedded image I-408 embedded image I-409 embedded image I-410 embedded image I-411 embedded image I-412 0embedded image I-413 embedded image I-414 embedded image I-415 embedded image I-416 embedded image I-417 embedded image I-418 embedded image I-419 embedded image I-420 embedded image I-421 embedded image I-422 0embedded image I-423 embedded image I-424 embedded image I-425 embedded image I-426 embedded image I-427 embedded image I-428 embedded image I-429 embedded image I-430 embedded image I-431 embedded image I-432 0embedded image I-433 embedded image I-434 embedded image I-435 embedded image I-436 embedded image I-437 embedded image I-438 embedded image I-439 embedded image I-440 embedded image I-441 embedded image I-442 0embedded image I-443 embedded image I-444 embedded image I-445 embedded image I-446 embedded image I-447 embedded image I-448 embedded image I-449 embedded image I-450 embedded image I-451 embedded image I-452 0embedded image I-453 embedded image I-454 embedded image I-455 embedded image I-456 embedded image I-457 embedded image I-458 embedded image I-459 embedded image I-460 embedded image I-461 embedded image I-462 0embedded image I-463 embedded image I-464 embedded image I-465 embedded image I-466 embedded image I-467 embedded image I-468 embedded image I-469 embedded image I-470 embedded image I-471 embedded image I-472 00embedded image I-473 01embedded image I-474 02embedded image I-475 03embedded image I-476 04embedded image I-477 05embedded image I-478 06embedded image I-479 07embedded image I-480 08embedded image I-481 09embedded image I-482 0embedded image I-483 embedded image I-484 embedded image I-485 embedded image I-486 embedded image I-487 embedded image I-488 embedded image I-489 embedded image I-490 embedded image I-491 embedded image I-492 0embedded image I-493 embedded image I-494 embedded image I-495 embedded image I-496 embedded image I-497 embedded image I-498 embedded image I-499 embedded image I-500 embedded image I-501 embedded image I-502 0embedded image I-503 embedded image I-504 embedded image I-505 embedded image I-506 embedded image I-507 embedded image I-508 embedded image I-509 embedded image I-510 embedded image I-511 embedded image I-512 0embedded image I-513 embedded image I-514 embedded image I-515 embedded image I-516 embedded image I-517 embedded image I-518 embedded image I-519 embedded image I-520 embedded image I-521 embedded image I-522 0embedded image I-523 embedded image I-524 embedded image I-525 embedded image I-526 embedded image I-527 embedded image I-528 embedded image I-529 embedded image I-530 embedded image I-531 embedded image I-532 0embedded image I-533 embedded image I-534 embedded image I-535 embedded image I-536 embedded image I-537 embedded image I-538 embedded image I-539 embedded image I-540 embedded image I-541 embedded image I-542 0embedded image I-543 embedded image I-544 embedded image I-545 embedded image I-546 embedded image I-547 embedded image I-548 embedded image I-549 embedded image I-550 embedded image I-551 embedded image I-552 0embedded image I-553 embedded image I-554 embedded image I-555 embedded image I-556 embedded image I-557 embedded image I-558 embedded image I-559 embedded image I-560 embedded image I-561 embedded image I-562 0embedded image I-563 embedded image I-564 embedded image I-565 embedded image I-566 embedded image I-567 embedded image I-568 embedded image I-569 embedded image I-570 embedded image I-571 embedded image I-572 00embedded image I-573 01embedded image I-574 02embedded image I-575 03embedded image I-576 04embedded image I-577 05embedded image I-578 06embedded image I-579 07embedded image I-580 08embedded image I-581 09embedded image I-582 0embedded image I-583 embedded image I-584 embedded image I-585 embedded image I-586 embedded image I-587 embedded image I-588 embedded image I-589 embedded image I-590 embedded image I-591 embedded image I-592 0embedded image I-593 embedded image I-594 embedded image I-595 embedded image I-596 embedded image I-597 embedded image I-598 embedded image I-599 embedded image I-600 embedded image I-601 embedded image I-602 0embedded image I-603 embedded image I-604 embedded image I-605 embedded image I-606 embedded image I-607 embedded image I-608 embedded image I-609 embedded image I-610 embedded image I-611 embedded image I-612 0embedded image I-613 embedded image I-614 embedded image I-615 embedded image I-616 embedded image I-617 embedded image I-618 embedded image I-619 embedded image I-620 embedded image I-621 embedded image I-622 0embedded image I-623 embedded image I-624 embedded image I-625 embedded image I-626 embedded image I-627 embedded image I-628 embedded image I-629 embedded image I-630 embedded image I-631 embedded image I-632 0embedded image I-633 embedded image I-634 embedded image I-635 embedded image I-636 embedded image I-637 embedded image I-638 embedded image I-639 embedded image I-640 embedded image I-641 embedded image I-642 0embedded image I-643 embedded image I-644 embedded image I-645 embedded image I-646 embedded image I-647 embedded image I-648 embedded image I-649 embedded image I-650 embedded image I-651 embedded image I-652 0embedded image I-653 embedded image I-654 embedded image I-655 embedded image I-656 embedded image I-657 embedded image I-658 embedded image I-659 embedded image I-660 embedded image I-661 embedded image I-662 0embedded image I-663 embedded image I-664 embedded image I-665 embedded image I-666 embedded image I-667 embedded image I-668 embedded image I-669 embedded image I-670 embedded image 1-671 embedded image I-672 00embedded image I-673 01embedded image I-674 02embedded image I-675 03embedded image I-676 04embedded image I-677 05embedded image I-678 06embedded image I-679 07embedded image I-680 08embedded image I-681 09embedded image I-682 0embedded image I-683 embedded image I-684 embedded image I-685 embedded image I-686 embedded image I-687 embedded image I-688 embedded image I-689 embedded image I-690 embedded image I-691 embedded image I-692 0embedded image I-693 embedded image I-694 embedded image I-695 embedded image I-696 embedded image I-697 embedded image I-698 embedded image I-699 embedded image I-700 embedded image I-701 embedded image I-702 0embedded image I-703 embedded image I-704 embedded image I-705 embedded image I-706 embedded image I-707 embedded image I-708 embedded image I-709 embedded image I-710 embedded image I-711 embedded image I-712 0embedded image I-713 embedded image I-714 embedded image I-715 embedded image I-716 embedded image I-717 embedded image I-718 embedded image I-719 embedded image I-720 embedded image I-721 embedded image I-722 0embedded image I-723 embedded image I-724 embedded image I-725 embedded image I-726 embedded image I-727 embedded image I-728 embedded image I-729 embedded image I-730 embedded image I-731 embedded image I-732 0embedded image I-733 embedded image I-734 embedded image I-735 embedded image I-736 embedded image I-737 embedded image I-738 embedded image I-739 embedded image I-740 embedded image I-741 embedded image I-742 0embedded image I-743 embedded image I-744 embedded image I-745 embedded image I-746 embedded image I-747 embedded image I-748 embedded image I-749 embedded image I-750 embedded image I-751 embedded image I-752 0embedded image I-753 embedded image I-754 embedded image I-755 embedded image I-756 embedded image I-757 embedded image I-758 embedded image I-759 embedded image I-760 embedded image I-761 embedded image I-762 0embedded image I-763 embedded image I-764 embedded image I-765 embedded image I-766 embedded image I-767 embedded image I-768 embedded image I-769 embedded image I-770 embedded image I-771 embedded image I-772 000embedded image I-773 001embedded image I-774 002embedded image I-775 003embedded image I-776 004embedded image I-777 005embedded image I-778 006embedded image I-779 007embedded image I-780 008embedded image I-781 009embedded image I-782 010embedded image I-783 011embedded image I-784 012embedded image I-785 013embedded image I-786 014embedded image I-787 015embedded image I-788 016embedded image I-789 017embedded image I-790 018embedded image I-791 019embedded image I-792 020embedded image I-793 021embedded image I-794 022embedded image I-795 023embedded image I-796 024embedded image I-797 025embedded image I-798 026embedded image I-799 027embedded image I-800 028embedded image I-801 029embedded image I-802 030embedded image I-803 031embedded image I-804 032embedded image I-805 033embedded image I-806 034embedded image I-807 035embedded image I-808 036embedded image I-809 037embedded image I-810 038embedded image I-811 039embedded image I-812 040embedded image I-813 041embedded image I-814 042embedded image I-815 043embedded image I-816 044embedded image I-817 045embedded image I-818 046embedded image I-819 047embedded image I-820 048embedded image I-821 049embedded image I-822 050embedded image I-823 051embedded image I-824 052embedded image I-825 053embedded image I-826 054embedded image I-827 055embedded image I-828 056embedded image I-829 057embedded image I-830 058embedded image I-831 059embedded image I-832 060embedded image I-833 061embedded image I-834 062embedded image I-835 063embedded image I-836 064embedded image I-837 065embedded image I-838 066embedded image I-839 067embedded image I-840 068embedded image I-841 069embedded image I-842 070embedded image I-843 071embedded image I-844 072embedded image I-845 073embedded image I-846 074embedded image I-847 075embedded image I-848 076embedded image I-849 077embedded image I-850 078embedded image I-851 079embedded image I-852 080embedded image I-853 081embedded image I-854 082embedded image I-855 083embedded image I-856 084embedded image I-857 085embedded image I-858 086embedded image I-859 087embedded image I-860 088embedded image I-861 089embedded image I-862 090embedded image I-863 091embedded image I-864 092embedded image I-865 093embedded image I-866 094embedded image I-867 095embedded image I-868 096embedded image I-869 097embedded image I-870 098embedded image I-871 099embedded image I-872 00embedded image I-873 01embedded image I-874 02embedded image I-875 03embedded image I-876 04embedded image I-877 05embedded image I-878 06embedded image I-879 07embedded image I-880 08embedded image I-881 09embedded image I-882 0embedded image I-883 embedded image I-884 embedded image I-885 embedded image I-886 embedded image I-887 embedded image I-888 embedded image I-889 embedded image I-890 embedded image I-891 embedded image I-892 0embedded image I-893 embedded image I-894 embedded image I-895 embedded image I-896 embedded image I-897 embedded image I-898 embedded image I-899 embedded image I-900 embedded image I-901 embedded image I-902 0embedded image I-903 embedded image I-904 embedded image I-905 embedded image I-906 embedded image I-907 embedded image I-908 embedded image I-909 embedded image I-910 embedded image I-911 embedded image I-912 0embedded image I-913 embedded image I-914 embedded image I-915 embedded image I-916 embedded image I-917 embedded image I-918 embedded image I-919 embedded image I-920 embedded image I-921 embedded image I-922 0embedded image I-923 embedded image I-924 embedded image I-925 embedded image I-926 embedded image I-927 embedded image I-928 embedded image I-929 embedded image I-930 embedded image I-931 embedded image I-932 0embedded image I-933 embedded image I-934 embedded image I-935 embedded image I-936 embedded image I-937 embedded image I-938 embedded image I-939 embedded image I-940 embedded image I-941 embedded image I-942 0embedded image I-943 embedded image I-944 embedded image I-945 embedded image I-946 embedded image I-947 embedded image I-948 embedded image I-949 embedded image I-950 embedded image I-951 embedded image I-952 0embedded image I-953 embedded image I-954 embedded image I-955 embedded image I-956 embedded image I-957 embedded image I-958 embedded image I-959 embedded image I-960 embedded image I-961 embedded image I-962 0embedded image I-963 embedded image I-964 embedded image I-965 embedded image I-966 embedded image I-967 embedded image I-968 embedded image I-969 embedded image I-970 embedded image I-971 embedded image I-972 00embedded image I-973 01embedded image I-974 02embedded image I-975 03embedded image I-976 04embedded image I-977 05embedded image I-978 06embedded image I-979 07embedded image I-980 08embedded image I-981 09embedded image I-982 0embedded image I-983 embedded image I-984 embedded image I-985 embedded image I-986 embedded image I-987 embedded image I-988 embedded image I-989 embedded image I-990 embedded image I-991 embedded image I-992 0embedded image I-993 embedded image I-994 embedded image I-995 embedded image I-996 embedded image I-997 embedded image I-998 embedded image I-999 embedded image I-1000 embedded image I-1001 embedded image I-1002 0embedded image I-1003 embedded image I-1004 embedded image I-1005 embedded image I-1006 embedded image I-1007 embedded image I-1008 embedded image I-1009 embedded image I-1010 embedded image I-1011 embedded image I-1012 0embedded image I-1013 embedded image I-1014 embedded image I-1015 embedded image I-1016 embedded image I-1017 embedded image I-1018 embedded image I-1019 embedded image I-1020 embedded image I-1021 embedded image I-1022 0embedded image I-1023 embedded image I-1024 embedded image I-1025 embedded image I-1026 embedded image I-1027 embedded image I-1028 embedded image I-1029 embedded image I-1030 embedded image I-1031 embedded image I-1032 0embedded image I-1033 embedded image I-1034 embedded image I-1035 embedded image I-1036 embedded image I-1037 embedded image I-1038 embedded image I-1039 embedded image I-1040 embedded image I-1041 embedded image I-1042 0embedded image I-1043 embedded image I-1044 embedded image I-1045 embedded image I-1046 embedded image I-1047 embedded image I-1048 embedded image I-1049 embedded image I-1050 embedded image I-1051 embedded image I-1052 0embedded image I-1053 embedded image I-1054 embedded image I-1055 embedded image I-1056 embedded image I-1057 embedded image I-1058 embedded image I-1059 embedded image I-1060 embedded image I-1061 embedded image I-1062 0embedded image I-1063 embedded image I-1064 embedded image I-1065 embedded image I-1066 embedded image I-1067 embedded image I-1068 embedded image I-1069 embedded image I-1070 embedded image I-1071 embedded image I-1072 00embedded image I-1073 01embedded image I-1074 02embedded image I-1075 03embedded image I-1076 04embedded image I-1077 05embedded image I-1078 06embedded image I-1079 07embedded image I-1080 08embedded image I-1081 09embedded image I-1082 0embedded image I-1083 embedded image I-1084 embedded image I-1085 embedded image I-1086 embedded image I-1087 embedded image I-1088 embedded image I-1089 embedded image I-1090 embedded image I-1091 embedded image I-1092 0embedded image I-1093 embedded image I-1094 embedded image I-1095 embedded image I-1096 embedded image I-1097 embedded image I-1098 embedded image 1-1099 embedded image I-1100 embedded image I-1101 embedded image I-1102 0embedded image I-1103 embedded image I-1104 embedded image I-1105 embedded image I-1106 embedded image I-1107 embedded image I-1108 embedded image I-1109 embedded image I-1110 embedded image I-1111 embedded image I-1112 0embedded image I-1113 embedded image I-1114 embedded image I-1115 embedded image I-1116 embedded image I-1117 embedded image I-1118 embedded image I-1119 embedded image I-1120 embedded image I-1121 embedded image I-1122 0embedded image I-1123 embedded image I-1124 embedded image I-1125 embedded image I-1126 embedded image I-1127 embedded image I-1128 embedded image I-1129 embedded image I-1130 embedded image I-1131 embedded image I-1132 0embedded image

(699) In some embodiments, the present invention provides a compound as depicted in Table A or a pharmaceutically acceptable salt thereof.

(700) The foregoing merely summarizes certain aspects of this disclosure and is not intended, nor should it be construed, as limiting the disclosure in any way.

FORMULATION AND ROUTE OF ADMINISTRATION

(701) While it may be possible to administer a compound disclosed herein alone in the uses described, the compound administered normally will be present as an active ingredient in a pharmaceutical composition. Thus, in one embodiment, provided herein is a pharmaceutical composition comprising a compound disclosed herein in combination with one or more pharmaceutically acceptable excipients, such as diluents, carriers, adjuvants and the like, and, if desired, other active ingredients. See, e.g., Remington; The Science and Practice of Pharmacy, Volume I and Volume II, twenty-second edition, edited by Loyd V. Allen Jr., Philadelphia, Pa., Pharmaceutical Press, 2012; Pharmaceutical Dosage Forms (Vol. 1-3), Liberman et al., Eds., Marcel Dekker, New York, N.Y., 1992; Handbook of Pharmaceutical Excipients (3rd Ed.), edited by Arthur H. Kibbe, American Pharmaceutical Association, Washington, 2000; Pharmaceutical Formulation; The Science and Technology of Dosage Forms (Drug Discovery), first edition, edited by GD Tovey, Royal Society of Chemistry, 2018. In one embodiment, a pharmaceutical composition comprises a therapeutically effective amount of a compound disclosed herein.

(702) The compound(s) disclosed herein may be administered by any suitable route in the form of a pharmaceutical composition adapted to such a route and in a dose effective for the treatment intended. The compounds and compositions presented herein may, for example, be administered orally, mucosally, topically, transdermally, rectally, pulmonarily, parentally, intranasally, intravascularly, intravenously, intraarterial, intraperitoneally, intrathecally, subcutaneously, sublingually, intramuscularly, intrasternally, vaginally or by infusion techniques, in dosage unit formulations containing conventional pharmaceutically acceptable excipients.

(703) The pharmaceutical composition may be in the form of, for example, a tablet, chewable tablet, minitablet, caplet, pill, bead, hard capsule, soft capsule, gelatin capsule, granule, powder, lozenge, patch, cream, gel, sachet, microneedle array, syrup, flavored syrup, juice, drop, injectable solution, emulsion, microemulsion, ointment, aerosol, aqueous suspension, or oily suspension. The pharmaceutical composition is typically made in the form of a dosage unit containing a particular amount of the active ingredient.

(704) Provided herein as Embodiment 179 is a pharmaceutical composition comprising the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, and a pharmaceutically acceptable excipient.

(705) Provided herein as Embodiment 180 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use as a medicament.

(706) Pharmaceutically Acceptable Compositions

(707) According to some embodiments, the present disclosure provides a composition comprising a compound of this disclosure or a pharmaceutically acceptable derivative thereof and a pharmaceutically acceptable carrier, adjuvant, or vehicle. The amount of compound in compositions of this disclosure is such that it is effective to measurably activate a TREM2 protein, or a mutant thereof, in a biological sample or in a patient. In certain embodiments, the amount of compound in compositions of this disclosure is such that it is effective to measurably activate a TREM2 protein, or a mutant thereof, in a biological sample or in a patient. In certain embodiments, a composition of this disclosure is formulated for administration to a patient in need of such composition. In some embodiments, a composition of this disclosure is formulated for oral administration to a patient.

(708) Compositions of the present disclosure may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term “parenteral” as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques. Preferably, the compositions are administered orally, intraperitoneally or intravenously. Sterile injectable forms of the compositions of this disclosure may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium.

(709) For this purpose, any bland fixed oil may be employed including synthetic mono- or di-glycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions. Other commonly used surfactants, such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.

(710) Pharmaceutically acceptable compositions of this disclosure may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers commonly used include lactose and corn starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried cornstarch. When aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.

(711) Alternatively, pharmaceutically acceptable compositions of this disclosure may be administered in the form of suppositories for rectal administration. These can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug. Such materials include cocoa butter, beeswax and polyethylene glycols.

(712) Pharmaceutically acceptable compositions of this disclosure may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs.

(713) Topical application for the lower intestinal tract can be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically-transdermal patches may also be used.

(714) For topical applications, provided pharmaceutically acceptable compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers. Carriers for topical administration of compounds of this disclosure include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water. Alternatively, provided pharmaceutically acceptable compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers. Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.

(715) For ophthalmic use, provided pharmaceutically acceptable compositions may be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride. Alternatively, for ophthalmic uses, the pharmaceutically acceptable compositions may be formulated in an ointment such as petrolatum.

(716) Pharmaceutically acceptable compositions of this disclosure may also be administered by nasal aerosol or inhalation. Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.

(717) Most preferably, pharmaceutically acceptable compositions of this disclosure are formulated for oral administration. Such formulations may be administered with or without food. In some embodiments, pharmaceutically acceptable compositions of this disclosure are administered without food. In other embodiments, pharmaceutically acceptable compositions of this disclosure are administered with food.

(718) The amount of compounds of the present disclosure that may be combined with the carrier materials to produce a composition in a single dosage form will vary depending upon the host treated, the particular mode of administration. Preferably, provided compositions should be formulated so that a dosage of between 0.01-100 mg/kg body weight/day of the compound can be administered to a patient receiving these compositions.

(719) It should also be understood that a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, and the judgment of the treating physician and the severity of the particular disease being treated. The amount of a compound of the present disclosure in the composition will also depend upon the particular compound in the composition.

(720) Methods of Use

(721) As discussed herein (see, section entitled “Definitions”), the compounds described herein are to be understood to include all stereoisomers, tautomers, or pharmaceutically acceptable salts of any of the foregoing or solvates of any of the foregoing. Accordingly, the scope of the methods and uses provided in the instant disclosure is to be understood to encompass also methods and uses employing all such forms.

(722) Besides being useful for human treatment, the compounds provided herein may be useful for veterinary treatment of companion animals, exotic animals and farm animals, including mammals, rodents, and the like. For example, animals including horses, dogs, and cats may be treated with compounds provided herein.

(723) Without wishing to be bound by any particular theory, the following is noted; TREM2 has been implicated in several myeloid cell processes, including phagocytosis, proliferation, survival, and regulation of inflammatory cytokine production. Ulrich and Holtzman 2016. In the last few years, TREM2 has been linked to several diseases. For instance, mutations in both TREM2 and DAP12 have been linked to the autosomal recessive disorder Nasu-Hakola Disease, which is characterized by bone cysts, muscle wasting and demyelination phenotypes. Guerreiro et al. 2013. More recently, variants in the TREM2 gene have been linked to increased risk for Alzheimer's disease (AD) and other forms of dementia including frontotemporal dementia. Jonsson et al. 2013, Guerreiro, Lohmann et al. 2013, and Jay, Miller et al. 2015. In particular, the R47H variant has been identified in genome-wide studies as being associated with increased risk for late-onset AD with an overall adjusted odds ratio (for populations of all ages) of 2.3, second only to the strong genetic association of ApoE to Alzheimer's. The R47H mutation resides on the extracellular 1 g V-set domain of the TREM2 protein and has been shown to impact lipid binding and uptake of apoptotic cells and Abeta (Wang et al. 2015; Yeh et al. 2016), suggestive of a loss-of-function linked to disease. Further, postmortem comparison of AD patients' brains with and without the R47H mutation are supportive of a novel loss-of-microglial barrier function for the carriers of the mutation, with the R47H carrier microglia putatively demonstrating a reduced ability to compact plaques and limit their spread. Yuan et al. 2016. Impairment in microgliosis has been reported in animal models of prion disease, multiple sclerosis, and stroke, suggesting that TREM2 may play an important role in supporting microgliosis in response to pathology or damage in the central nervous system. Ulrich and Holtzman 2016. In addition, knockdown of TREM2 has been shown to aggravate a-syn-induced inflammatory responses in vitro and exacerbate dopaminergic neuron loss in response to AAV-SYN in vivo (a model of Parkinson's disease), suggesting that impaired microglial TREM2 signaling exacerbates neurodegeneration by modulating microglial activation states. Guo et. al. 2019. A variety of animal models also suggest that Toll-Like Receptor (TLR) signaling is important in the pathogenesis of Rheumatoid Arthritis (RA) via persistent expression of pro-inflammatory cytokines by macrophages. Signaling through TREM2/DAP12 inhibits TLR responses by reducing MAPK (Erk1/2) activation, suggesting that TREM2 activation may act as a negative regulator of TLR driven RA pathogenesis. Huang and Pope 2009.

(724) In view of the data indicating that deficits in TREM2 activity affect macrophage and microglia function, the compounds disclosed herein are of particular use in disorders, such as those described above and in the embodiments that follow and in neurodegenerative disorders more generally.

(725) Provided herein as Embodiment 181 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating or preventing a condition associated with a loss of function of human TREM2.

(726) Provided herein as Embodiment 182 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating or preventing Parkinson's disease, rheumatoid arthritis, Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke.

(727) Provided herein as Embodiment 183 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating or preventing a condition associated with a loss of function of human TREM2.

(728) Provided herein as Embodiment 184 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating or preventing Parkinson's disease, rheumatoid arthritis, Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke.

(729) Provided herein as Embodiment 185 is a method of treating or preventing a condition associated with a loss of function of human TREM2 in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179.

(730) Provided herein as Embodiment 186 is a method of treating or preventing Parkinson's disease, rheumatoid arthritis, Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179.

(731) In some embodiments, the condition associated with a loss of function of human TREM2 is Parkinson's disease. In some embodiments, the condition associated with a loss of function of human TREM2 is rheumatoid arthritis. In some embodiments, the condition associated with a loss of function of human TREM2 is Alzheimer's disease. In some embodiments, the condition associated with a loss of function of human TREM2 is Nasu-Hakola disease. In some embodiments, the condition associated with a loss of function of human TREM2 is frontotemporal dementia. In some embodiments, the condition associated with a loss of function of human TREM2 is multiple sclerosis. In some embodiments, the condition associated with a loss of function of human TREM2 is prion disease. In some embodiments, the condition associated with a loss of function of human TREM2 is stroke.

(732) CSF1R

(733) CSF1R is a cell-surface receptor primarily for the cytokine colony stimulating factor 1 (CSF-1), also known until recently as macrophage colony-stimulating factor (M-CSF), which regulates the survival, proliferation, differentiation and function of mononuclear phagocytic cells, including microglia of the central nervous system. CSF1R is composed of a highly glycosylated extracellular ligand-binding domain, a trans-membrane domain and an intracellular tyrosine-kinase domain. Binding of CSF-1 to CSF1R results in the formation of receptor homodimers and subsequent auto-phosphorylation of several tyrosine residues in the cytoplasmic domain, notably Syk. In the brain, CSF1R is predominantly expressed in microglial cells. It has been found that microglia in CSF1R+/− patients are depleted and show increased apoptosis (Oosterhof et al., 2018).

(734) The present invention relates to the unexpected discovery that administration of a TREM2 agonist can rescue the loss of microglia in cells having mutations in CSF1R. It has been previously shown that TREM2 agonist antibody 4D9 increases ATP luminescence (a measure of cell number and activity) in a dose dependent manner when the levels of M-CSF in media are reduced to 5 ng/mL (Schlepckow et al, EMBO Mol Med., 2020) and that TREM2 agonist AL002c increases ATP luminescence when M-CSF is completely removed from the media (Wang et al, J. Exp. Med.; 2020, 217(9); e20200785). This finding suggests that TREM2 agonism can compensate for deficiency in CSF1R signaling caused by a decrease in the concentration of its ligand. In a 5×FAD murine Alzheimer's disease model of amyloid pathology, doses of a CSF1R inhibitor that almost completely eliminate microglia in the brains of wild-type animals show surviving microglia clustered around the amyloid plaques (Spangenberg et al, Nature Communications 2019). Plaque amyloid has been demonstrated in the past to be a ligand for TREM2, and it has been shown that microglial engagement with amyloid is dependent on TREM2 (Condello et al, Nat Comm., 2015). The present invention relates to the unexpected discovery that it is activation of TREM2 that rescued the microglia in the presence of the CSF1R inhibitor, and that this effect is also observed in patients suffering from loss of microglia due to CSF1R mutation. This discovery has not been previously taught or suggested in the available art.

(735) To date, no prior study has shown that TREM2 agonism can rescue the loss of microglia in cells where mutations in the CSF1R kinase domain reduce CSF1R activity, rather than the presence of a CSF1R inhibitor or a deficiency in CSF1R ligand. Furthermore, no prior study has taught or suggested that reversal of the loss of microglia due to a CSF1R mutation through TREM2 agonism can be used to treat a disease or disorder caused by and/or associated with a CSF1R mutation.

(736) Adult-onset leukoencephalopathy with axonal spheroids and pigmented glia (ALSP), previously recognized as hereditary diffuse leukoencephalopathy with axonal spheroids (HDLS) or pigmentary orthochromatic leukodystrophy (POLD), is an autosomal-dominant central nervous system disease that manifests in the form of variable behavioral, cognitive and motor function changes in patients suffering from the disease. ALSP is characterized by patchy cerebral white matter abnormalities visible by magnetic resonance imaging. However, the clinical symptoms and MRI changes are not specific to ALSP and are common for other neurological conditions, including Nasu-Hakola disease (NHD) and AD, making diagnosis and treatment of ALSP very difficult.

(737) Recent studies have discovered that ALSP is a Mendelian disorder in which patients carry a heterozygous loss of function mutation in the kinase domain of CSF1R, suggesting a reduced level of signaling on the macrophage colony-stimulating factor (M-CSF)/CSF1R axis (Rademakers et al, Nat Genet 2012; Konno et al, Neurology 2018). In one aspect, the present invention relates to the surprising discovery that activation of the TREM2 pathway can rescue the loss of microglia in CSF1R+/−ALSP patients, preventing microglia apoptosis, thereby treating the ALSP condition.

(738) Provided herein as Embodiment 187 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating or preventing a condition associated with dysfunction of Colony stimulating factor 1 receptor (CSF1R, also known as macrophage colony-stimulating factor receptor/M-CSFR, or cluster of differentiation 115/CD115).

(739) Provided herein as Embodiment 188 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating or preventing adult-onset leukoencephalopathy with axonal spheroids and pigmented glia (ALSP), hereditary diffuse leukoencephalopathy with axonal spheroids (HDLS), pigmentary orthochromatic leukodystrophy (POLD), pediatric-onset leukoencephalopathy, congenital absence of microglia, or brain abnormalities neurodegeneration and dysosteosclerosis (BANDDOS).

(740) Provided herein as Embodiment 189 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating or preventing a condition associated with dysfunction of CSF1R.

(741) Provided herein as Embodiment 190 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating or preventing adult-onset leukoencephalopathy with axonal spheroids and pigmented glia (ALSP), hereditary diffuse leukoencephalopathy with axonal spheroids (HDLS), pigmentary orthochromatic leukodystrophy (POLD), pediatric-onset leukoencephalopathy, congenital absence of microglia, or brain abnormalities neurodegeneration and dysosteosclerosis (BANDDOS).

(742) Provided herein as Embodiment 191 is a method of treating or preventing a disease or disorder associated with dysfunction of CSF1R in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179. In some embodiments, the subject is selected for treatment based on a diagnosis that includes the presence of a mutation in a CSF1R gene affecting the function of CSF1R. In some embodiments, the mutation in the CSF1R gene is a mutation that causes a decrease in CSF1R activity or a cessation of CSF1R activity. In some embodiments, the disease or disorder is caused by a heterozygous CSF1R mutation. In some embodiments, the disease or disorder is caused by a homozygous CSF1R mutation. In some embodiments, the disease or disorder is caused by a splice mutation in the csf1r gene. In some embodiments, the disease or disorder is caused by a missense mutation in the csf1r gene. In some embodiments, the disease or disorder is caused by a mutation in the catalytic kinase domain of CSF1R. In some embodiments, the disease or disorder is caused by a mutation in an immunoglobulin domain of CSF1R. In some embodiments, the disease or disorder is caused by a mutation in the ectodomain of CSF1R. In some embodiments, the disease or disorder is a disease or disorder resulting from a change (e.g. increase, decrease or cessation) in the activity of CSF1R. In some embodiments, the disease or disorder is a disease or disorder resulting from a decrease or cessation in the activity of CSF1R. CSF1R related activities that are changed in the disease or disorder include, but are not limited to; decrease or loss of microglia function; increased microglia apoptosis; decrease in Src signaling; decrease in Syk signaling; decreased microglial proliferation; decreased microglial response to cellular debris; decreased phagocytosis; and decreased release of cytokines in response to stimuli. In some embodiments, the disease or disorder is caused by a loss-of-function mutation in CSF1R. In some embodiments, the loss-of-function mutation results in a complete cessation of CSF1R function. In some embodiments, the loss-of-function mutation results in a partial loss of CSF1R function, or a decrease in CSF1R activity.

(743) Provided herein as Embodiment 192 is a method of treating or preventing adult-onset leukoencephalopathy with axonal spheroids and pigmented glia (ALSP), hereditary diffuse leukoencephalopathy with axonal spheroids (HDLS), pigmentary orthochromatic leukodystrophy (POLD), pediatric-onset leukoencephalopathy, congenital absence of microglia, or brain abnormalities neurodegeneration and dysosteosclerosis (BANDDOS) in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179. In some embodiments, the method treats or prevents ALSP, which is an encompassing and superseding name for both HDLS and POLD. In some embodiments, the disease or disorder is a homozygous mutation in CSF1R. In some embodiments, the method treats or prevents pediatric-onset leukoencephalopathy. In some embodiments, the method treats or prevents congenital absence of microglia. In some embodiments, the method treats or prevents brain abnormalities neurodegeneration and dysosteosclerosis (BANDDOS).

(744) Provided herein as Embodiment 193 is a method of treating or preventing Nasu-Hakola disease, Alzheimer's disease, frontotemporal dementia, multiple sclerosis, Guillain-Barre syndrome, amyotrophic lateral sclerosis (ALS), Parkinson's disease, traumatic brain injury, spinal cord injury, systemic lupus erythematosus, rheumatoid arthritis, prion disease, stroke, osteoporosis, osteopetrosis, osteosclerosis, skeletal dysplasia, dysosteoplasia, Pyle disease, cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy, cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy, cerebroretinal vasculopathy, or metachromatic leukodystrophy wherein any of the aforementioned diseases or disorders are present in a patient exhibiting CSF1R dysfunction, or having a mutation in a gene affecting the function of CSF1R, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179.

(745) ABCD1

(746) The ABCD1 gene provides instructions for producing the adrenoleukodystrophy protein (ALDP). ABCD1 (ALDP) maps to Xq28. ABCD1 is a member of the ATP-binding cassette (ABC) transporter superfamily. The superfamily contains membrane proteins that translocate a wide variety of substrates across extra- and intracellular membranes, including metabolic products, lipids and sterols, and drugs. ALDP is located in the membranes of cell structures called peroxisomes. Peroxisomes are small sacs within cells that process many types of molecules. ALDP brings a group of fats called very long-chain fatty acids (VLCFAs) into peroxisomes, where they are broken down. As ABCD1 is highly expressed in microglia, it is possible that microglial dysfunction and their close interaction with other cell types actively participates in neurodegenerative processes (Gong et al., Annals of Neurology. 2017; 82(5);813-827.). It has been shown that severe microglia loss and damage is an early feature in patients with cerebral form of x-linked ALD (cALD) carrying ABCD1 mutations (Bergner et al., Glia. 2019; 67; 1196-1209). It has also been shown that ABCD1-deficiency leads to an impaired plasticity of myeloid lineage cells that is reflected in incomplete establishment of anti-inflammatory responses, thus possibly contributing to the devastating rapidly progressive demyelination in cerebral adrenoleukodystrophy (Weinhor et al., BRAIN 2018; 141; 2329-2342). These findings emphasize microglia/monocytes/macrophages as crucial therapeutic targets for preventing or stopping myelin destruction in patients with X-linked adrenoleukodystrophy.

(747) The present invention relates to the unexpected discovery that administration of a TREM2 agonist can rescue the loss of microglia in cells having mutations in the ABCD1 gene. It has been previously shown that TREM2 agonist antibody 4D9 increases ATP luminescence (a measure of cell number and activity) in a dose dependent manner when the levels of M-CSF in media are reduced to 5 ng/mL (Schlepckow et al, EMBO Mol Med., 2020) and that TREM2 agonist AL002c increases ATP luminescence when M-CSF is completely removed from the media (Wang et al, J. Exp. Med.; 2020, 217(9); e20200785). This finding suggests that TREM2 agonism can compensate for deficiency in ABCD1 function leading to sustained activation, proliferation, chemotaxis of microglia, maintenance of anti-inflammatory environment and reduced astrocytosis caused by a decrease in ABCD1 and accumulation of VLCFAs. The present invention relates to the unexpected discovery that activation of TREM2 can rescue the microglia in the presence of the ABCD1 mutation and an increase in VLCFA, and that this effect may be also observed in patients suffering from loss of microglia due to ABCD1 mutation. This discovery has not been previously taught or suggested in the available art.

(748) To date, no prior study has shown that TREM2 agonism can rescue the loss of microglia in cells where mutations in the ABCD1 and a VLCFA increase is present. No prior study has taught or suggested that reversal of the loss of microglia due to an ABCD1 mutation through TREM2 agonism can be used to treat a disease or disorder caused by and/or associated with an ABCD1 mutation.

(749) Provided herein as Embodiment 194 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating or preventing a condition associated with dysfunction of ATP-binding cassette transporter 1 (ABCD1).

(750) Provided herein as Embodiment 195 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating or preventing X-linked adrenoleukodystrophy (x-ALD), Globoid cell leukodystrophy (also known as Krabbe disease), Metachromatic leukodystrophy (MLD), Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), Vanishing white matter disease (VWM), Alexander disease, fragile X-associated tremor ataxia syndrome (FXTAS), adult-onset autosomal dominant leukodystrophy (ADLD), and X-linked Charcot-Marie-Tooth disease (CMTX).

(751) Provided herein as Embodiment 196 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating or preventing a condition associated with dysfunction of ABCD1.

(752) Provided herein as Embodiment 197 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating or preventing X-linked adrenoleukodystrophy (x-ALD), Globoid cell leukodystrophy (also known as Krabbe disease), Metachromatic leukodystrophy (MLD), Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), Vanishing white matter disease (VWM), Alexander disease, fragile X-associated tremor ataxia syndrome (FXTAS), adult-onset autosomal dominant leukodystrophy (ADLD), and X-linked Charcot-Marie-Tooth disease (CMTX).

(753) Provided herein as Embodiment 198 is a method of treating or preventing a disease or disorder associated with dysfunction of ABCD1 in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179. In some embodiments, the patient is selected for treatment based on a diagnosis that includes the presence of a mutation in an ABCD1 gene affecting the function of ABCD1. In some embodiments, the mutation in the ABCD1 gene is a mutation that causes a decrease in ABCD1 activity or a cessation of ABCD1 activity. In some embodiments, the disease or disorder is caused by a heterozygous ABCD1 mutation. In some embodiments, the disease or disorder is caused by a homozygous ABCD1 mutation. In some embodiments, the disease or disorder is caused by a splice mutation in the ABCD1 gene. In some embodiments, the disease or disorder is caused by a missense mutation in the ABCD1 gene. In some embodiments, the disease or disorder is a disease or disorder resulting from a change (e.g. increase, decrease or cessation) in the activity of ABCD1. In some embodiments, the disease or disorder is a disease or disorder resulting from a decrease or cessation in the activity of ABCD1. ABCD1 related activities that are changed in the disease or disorder include, but are not limited to peroxisomal import of fatty acids and/or fatty acyl-CoAs and production of adrenoleukodystrophy protein (ALDP). In some embodiments, the disease or disorder is caused by a loss-of-function mutation in ABCD1. In some embodiments, the loss-of-function mutation results in a complete cessation of ABCD1 function. In some embodiments, the loss-of-function mutation results in a partial loss of ABCD1 function, or a decrease in ABCD1 activity. In some embodiments, the disease or disorder is caused by a homozygous mutation in ABCD1. In some embodiments, the disease or disorder is a neurodegenerative disorder. In some embodiments, the disease or disorder is a neurodegenerative disorder caused by and/or associated with an ABCD1 dysfunction. In some embodiments, the disease or disorder is an immunological disorder. In some embodiments, the disease or disorder is an immunological disorder caused by and/or associated with an ABCD1 dysfunction.

(754) Provided herein as Embodiment 199 is a method of treating or preventing X-linked adrenoleukodystrophy (x-ALD), Globoid cell leukodystrophy (also known as Krabbe disease), Metachromatic leukodystrophy (MLD), Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), Vanishing white matter disease (VWM), Alexander disease, fragile X-associated tremor ataxia syndrome (FXTAS), adult-onset autosomal dominant leukodystrophy (ADLD), and X-linked Charcot-Marie-Tooth disease (CMTX) in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179. In some embodiments, any of the aforementioned diseases are present in a patient exhibiting ABCD1 dysfunction or having a mutation in a gene affecting the function of ABCD1. In some embodiments, the method treats or prevents X-linked adrenoleukodystrophy (x-ALD). In some embodiments, the x-ALD is a cerebral form of x-linked ALD (cALD). In some embodiments, the method treats or prevents Addison disease wherein the patient has been found to have a mutation in one or more ABCD1 genes affecting ABCD1 function. In some embodiments, the method treats or prevents Addison disease, wherein the patient has a loss-of-function mutation in ABCD1.

(755) Provided herein as Embodiment 200 is a method of treating or preventing Nasu-Hakola disease, Alzheimer's disease, frontotemporal dementia, multiple sclerosis, Guillain-Barre syndrome, amyotrophic lateral sclerosis (ALS), or Parkinson's disease, wherein any of the aforementioned diseases or disorders are present in a patient exhibiting ABCD1 dysfunction, or having a mutation in a gene affecting the function of ABCD1, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179.

(756) Autism Spectrum Disorders

(757) It has been found that TREM2 deficient mice exhibit symptoms reminiscent of autism spectrum disorders (ASDs) (Filipello et al., Immunity, 2018, 48, 979-991). It has also been found that microglia depletion of the autophagy Aatg7 gene results in defective synaptic pruning and results in increased dendritic spine density, and abnormal social interaction and repetitive behaviors indicative of ASDs (Kim, et al., Molecular Psychiatry, 2017, 22, 1576-1584.). Further studies have shown that increased dendritic spin density detected in postmortem ASD brains, likely caused by defective synaptic pruning, results in circuit hypoconnectivity and behavioral defects and are a potential origin of a number of neurodevelopmental diseases (Tang, et al., Neuron, 2014, 83, 1131-1143). Without intending to be limited to any particular theory, these findings suggest that TREM2 activation can reverse microglia depletion, and therefore correct the defective synaptic pruning that is central to neurodevelopmental diseases such as ASDs. The present invention relates to the unexpected discovery that activation of TREM2, using a compound of the present invention, can rescue microglia in subjects suffering from an ASD. This discovery has not been previously taught or suggested in the available art.

(758) Provided herein as Embodiment 201 is a compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 for use in treating autism or autism spectrum disorders.

(759) Provided herein as Embodiment 202 is a use of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179 in the preparation of a medicament for treating autism or autism spectrum disorders.

(760) Provided herein as Embodiment 203 is a method of treating autism or autism spectrum disorders in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the compound according to any one of Embodiments 1-178, or a tautomer thereof, or a pharmaceutically acceptable salt of said compound or said tautomer, or the pharmaceutical composition according to Embodiment 179. In some embodiments, the method treats autism. In some embodiments, the method treats Asperger syndrome.

(761) In some embodiments, the disclosure provides a method of increasing the activity of TREM2, the method comprising contacting a compound of the present disclosure, or a pharmaceutically acceptable salt thereof with the TREM2. In some embodiments, the contacting takes place in vitro. In some embodiments, the contacting takes place in vivo. In some embodiments, the TREM2 is human TREM2.

(762) Combination Therapies

(763) Depending upon the particular condition, or disease, to be treated, additional therapeutic agents, which are normally administered to treat that condition, may be administered in combination with compounds and compositions of this disclosure. As used herein, additional therapeutic agents that are normally administered to treat a particular disease, or condition, are known as “appropriate for the disease, or condition, being treated.”

(764) In certain embodiments, a provided combination, or composition thereof, is administered in combination with another therapeutic agent.

(765) In some embodiments, the present disclosure provides a method of treating a disclosed disease or condition comprising administering to a patient in need thereof an effective amount of a compound disclosed herein or a pharmaceutically acceptable salt thereof and co-administering simultaneously or sequentially an effective amount of one or more additional therapeutic agents, such as those described herein. In some embodiments, the method includes co-administering one additional therapeutic agent. In some embodiments, the method includes co-administering two additional therapeutic agents. In some embodiments, the combination of the disclosed compound and the additional therapeutic agent or agents acts synergistically.

(766) Examples of agents the combinations of this disclosure may also be combined with include, without limitation; treatments for Parkinson's disease, rheumatoid arthritis, Alzheimer's disease, Nasu-Hakola disease, frontotemporal dementia, multiple sclerosis, prion disease, or stroke.

(767) As used herein, the term “combination,” “combined,” and related terms refers to the simultaneous or sequential administration of therapeutic agents in accordance with this disclosure. For example, a combination of the present disclosure may be administered with another therapeutic agent simultaneously or sequentially in separate unit dosage forms or together in a single unit dosage form.

(768) The amount of additional therapeutic agent present in the compositions of this disclosure will be no more than the amount that would normally be administered in a composition comprising that therapeutic agent as the only active agent. Preferably the amount of additional therapeutic agent in the presently disclosed compositions will range from about 50% to 100% of the amount normally present in a composition comprising that agent as the only therapeutically active agent.

(769) One or more other therapeutic agent may be administered separately from a compound or composition of the present disclosure, as part of a multiple dosage regimen. Alternatively, one or more other therapeutic agents may be part of a single dosage form, mixed together with a compound of this disclosure in a single composition. If administered as a multiple dosage regime, one or more other therapeutic agent and a compound or composition of the present disclosure may be administered simultaneously, sequentially or within a period of time from one another, for example within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 18, 20, 21, 22, 23, or 24 hours from one another. In some embodiments, one or more other therapeutic agent and a compound or composition of the present disclosure are administered as a multiple dosage regimen within greater than 24 hours a parts.

(770) In one embodiment, the present disclosure provides a composition comprising a provided compound or a pharmaceutically acceptable salt thereof and one or more additional therapeutic agents. The therapeutic agent may be administered together with a provided compound or a pharmaceutically acceptable salt thereof, or may be administered prior to or following administration of a provided compound or a pharmaceutically acceptable salt thereof. Suitable therapeutic agents are described in further detail below. In certain embodiments, a provided compound or a pharmaceutically acceptable salt thereof may be administered up to 5 minutes, 10 minutes, 15 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5, hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, or 18 hours before the therapeutic agent. In other embodiments, a provided compound or a pharmaceutically acceptable salt thereof may be administered up to 5 minutes, 10 minutes, 15 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5, hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, or 18 hours following the therapeutic agent.

Definitions

(771) The following definitions are provided to assist in understanding the scope of this disclosure.

(772) Unless otherwise indicated, all numbers expressing quantities of ingredients, reaction conditions, and so forth used in the specification or claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the standard deviation found in their respective testing measurements.

(773) As used herein, if any variable occurs more than one time in a chemical formula, its definition on each occurrence is independent of its definition at every other occurrence. If the chemical structure and chemical name conflict, the chemical structure is determinative of the identity of the compound.

(774) As used herein, the following definitions shall apply unless otherwise indicated. For purposes of this disclosure, the chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 101.sup.st Ed. Additionally, general principles of organic chemistry are described in “Organic Chemistry”, Thomas Sorrell, University Science Books, Sausalito; 2005, and “March's Advanced Organic Chemistry; Reactions Mechanisms and Structure”, 8.sup.th Ed., Ed.; Smith, M. B., John Wiley & Sons, New York; 2019, the entire contents of which are hereby incorporated by reference.

(775) Stereoisomers

(776) The compounds of the present disclosure may contain, for example, double bonds, one or more asymmetric carbon atoms, and bonds with a hindered rotation, and therefore, may exist as stereoisomers, such as double-bond isomers (i.e., geometric isomers (E/Z)), enantiomers, diastereomers, and atropoisomers. Accordingly, the scope of the instant disclosure is to be understood to encompass all possible stereoisomers of the illustrated compounds, including the stereoisomerically pure form (for example, geometrically pure, enantiomerically pure, diastereomerically pure, and atropoisomerically pure) and stereoisomeric mixtures (for example, mixtures of geometric isomers, enantiomers, diastereomers, and atropoisomers, or mixture of any of the foregoing) of any chemical structures disclosed herein (in whole or in part), unless the stereochemistry is specifically identified.

(777) If the stereochemistry of a structure or a portion of a structure is not indicated with, for example, bold or dashed lines, the structure or portion of the structure is to be interpreted as encompassing all stereoisomers of it. If the stereochemistry of a structure or a portion of a structure is indicated with, for example, bold or dashed lines, the structure or portion of the structure is to be interpreted as encompassing only the stereoisomer indicated. For example, (1R)-1-methyl-2-(trifluoromethyl)cyclohexane is meant to encompass (1R,2R)-1-methyl-2-(trifluoromethyl)cyclohexane and (1R,2S)-1-methyl-2-(trifluoromethyl)cyclohexane. A bond drawn with a wavy line indicates that both stereoisomers are encompassed. This is not to be confused with a wavy line drawn perpendicular to a bond which indicates the point of attachment of a group to the rest of the molecule.

(778) The term “stereoisomer” or “stereoisomerically pure” compound as used herein refers to one stereoisomer (for example, geometric isomer, enantiomer, diastereomer and atropoisomer) of a compound that is substantially free of other stereoisomers of that compound. For example, a stereoisomerically pure compound having one chiral center will be substantially free of the mirror image enantiomer of the compound and a stereoisomerically pure compound having two chiral centers will be substantially free of the other enantiomer and diastereomers of the compound. A typical stereoisomerically pure compound comprises greater than about 80% by weight of one stereoisomer of the compound and equal or less than about 20% by weight of other stereoisomers of the compound, greater than about 90% by weight of one stereoisomer of the compound and equal or less than about 10% by weight of the other stereoisomers of the compound, greater than about 95% by weight of one stereoisomer of the compound and equal or less than about 5% by weight of the other stereoisomers of the compound, or greater than about 97% by weight of one stereoisomer of the compound and equal or less than about 3% by weight of the other stereoisomers of the compound.

(779) This disclosure also encompasses the pharmaceutical compositions comprising stereoisomerically pure forms and the use of stereoisomerically pure forms of any compounds disclosed herein. Further, this disclosure also encompasses pharmaceutical compositions comprising mixtures of stereoisomers of any compounds disclosed herein and the use of said pharmaceutical compositions or mixtures of stereoisomers. These stereoisomers or mixtures thereof may be synthesized in accordance with methods well known in the art and methods disclosed herein. Mixtures of stereoisomers may be resolved using standard techniques, such as chiral columns or chiral resolving agents. See, for example, Jacques et al., Enantiomers, Racemates and Resolutions (Wiley-Interscience, New York, 1981); Wilen et al., Tetrahedron 33:2725; Eliel, Stereochemistry of Carbon Compounds (McGraw-Hill, N Y, 1962); and Wilen, Tables of Resolving Agents and Optical Resolutions, page 268 (Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, Ind., 1972).

(780) Tautomers

(781) As known by those skilled in the art, certain compounds disclosed herein may exist in one or more tautomeric forms. Because one chemical structure may only be used to represent one tautomeric form, it will be understood that for convenience, referral to a compound of a given structural formula includes other tautomers of said structural formula. For example, the following is illustrative of tautomers of the compounds of Formula I, wherein Ring A together with the 6-membered ring system to which it is fused forms a bicyclic ring system of formula

(782) ##STR01361##
and wherein R.sup.9 is H;

(783) ##STR01362##

(784) Accordingly, the scope of the instant disclosure is to be understood to encompass all tautomeric forms of the compounds disclosed herein.

(785) Isotopically-Labelled Compounds

(786) Further, the scope of the present disclosure includes all pharmaceutically acceptable isotopically-labelled compounds of the compounds disclosed herein, such as the compounds of Formula I, wherein one or more atoms are replaced by atoms having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes suitable for inclusion in the compounds disclosed herein include isotopes of hydrogen, such as .sup.2H and .sup.3H, carbon, such as .sup.11C, .sup.13C and .sup.14C, chlorine, such as .sup.36Cl, fluorine, such as .sup.18F, iodine, such as .sup.123I and .sup.125I, nitrogen, such as .sup.13N and .sup.15N, oxygen, such as .sup.15O, .sup.17O and .sup.18O, phosphorus, such as .sup.32P, and sulphur, such as .sup.35S. Certain isotopically-labelled compounds of Formula I, for example, those incorporating a radioactive isotope, are useful in drug and/or substrate tissue distribution studies. The radioactive isotopes tritium (.sup.3H) and carbon-14 (.sup.14C) are particularly useful for this purpose in view of their ease of incorporation and ready means of detection. Substitution with isotopes such as deuterium (.sup.2H or D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example, increased in vivo half-life or reduced dosage requirements, and hence may be advantageous in some circumstances. Substitution with positron emitting isotopes, such as .sup.11C, .sup.18F, .sup.15O and .sup.13N, can be useful in Positron Emission Topography (PET) studies, for example, for examining target occupancy. Isotopically-labelled compounds of the compounds disclosed herein can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying General Synthetic Schemes and Examples using an appropriate isotopically-labelled reagent in place of the non-labelled reagent previously employed.

(787) Solvates

(788) As discussed above, the compounds disclosed herein and the stereoisomers, tautomers, and isotopically-labelled forms thereof or a pharmaceutically acceptable salt of any of the foregoing may exist in solvated or unsolvated forms.

(789) The term “solvate” as used herein refers to a molecular complex comprising a compound or a pharmaceutically acceptable salt thereof as described herein and a stoichiometric or non-stoichiometric amount of one or more pharmaceutically acceptable solvent molecules. If the solvent is water, the solvate is referred to as a “hydrate.”

(790) Accordingly, the scope of the instant disclosure is to be understood to encompass all solvents of the compounds disclosed herein and the stereoisomers, tautomers and isotopically-labelled forms thereof or a pharmaceutically acceptable salt of any of the foregoing.

(791) Miscellaneous Definitions

(792) This section will define additional terms used to describe the scope of the compounds, compositions and uses disclosed herein.

(793) The terms “C.sub.1-3alkyl,” “C.sub.1-5alkyl,” and “C.sub.1-6alkyl” as used herein refer to a straight or branched chain hydrocarbon containing from 1 to 3, 1 to 5, and 1 to 6 carbon atoms, respectively. Representative examples of C.sub.1-3alkyl, C.sub.1-5alky, or C.sub.1-6alkyl include, but are not limited to, methyl, ethyl, n-propyl, iso-propyl, n-butyl, sec-butyl, iso-butyl, tert-butyl, pentyl and hexyl.

(794) The term “C.sub.2-4alkenyl” as used herein refers to a saturated hydrocarbon containing 2 to 4 carbon atoms having at least one carbon-carbon double bond. Alkenyl groups include both straight and branched moieties. Representative examples of C.sub.2-4alkenyl include, but are not limited to, 1-propenyl, 2-propenyl, 2-methyl-2-propenyl, and butenyl.

(795) The term “C.sub.3-6cycloalkyl” as used herein refers to a saturated carbocyclic molecule wherein the cyclic framework has 3 to 6 carbon atoms. Representative examples of C.sub.3-5cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl.

(796) The terms “diC.sub.1-3alkylamino” as used herein refer to —NR*R**, wherein R* and R** independently represent a C.sub.1-3alkyl as defined herein. Representative examples of diC.sub.1-3alkylamino include, but are not limited to, —N(CH.sub.3).sub.2, —N(CH.sub.2CH.sub.3).sub.2, —N(CH.sub.3)(CH.sub.2CH.sub.3), —N(CH.sub.2CH.sub.2CH.sub.3).sub.2, and —N(CH(CH.sub.3).sub.2).sub.2.

(797) The term “C.sub.1-3alkoxy” and “C.sub.1-6alkoxy” as used herein refer to —OR.sup.#, wherein R.sup.#represents a C.sub.1-3alkyl and C.sub.1-6alkyl group, respectively, as defined herein. Representative examples of C.sub.1-3alkoxy or C.sub.1-6alkoxy include, but are not limited to, methoxy, ethoxy, propoxy, iso-propoxy, and butoxy.

(798) The term “halogen” as used herein refers to —F, —CI, —Br, or —I.

(799) The term “halo” as used herein as a prefix to another term for a chemical group refers to a modification of the chemical group, wherein one or more hydrogen atoms are substituted with a halogen as defined herein. The halogen is independently selected at each occurrence. For example, the term “C.sub.1-6haloalkyl” refers to a C.sub.1-6alkyl as defined herein, wherein one or more hydrogen atoms are substituted with a halogen. Representative examples of C.sub.1-6haloalkyl include, but are not limited to, —CH.sub.2F, —CHF.sub.2, —CF.sub.3, —CHFCl, —CH.sub.2CF.sub.3, —CFHCF.sub.3, —CF.sub.2CF.sub.3, —CH(CF.sub.3).sub.2, —CF(CHF.sub.2).sub.2, and —CH(CH.sub.2F)(CF.sub.3). Further, the term “C.sub.1-6haloalkoxy” for example refers to a C.sub.1-6alkoxy as defined herein, wherein one or more hydrogen atoms are substituted with a halogen. Representative examples of C.sub.1-6haloalkoxy include, but are not limited to, —OCH.sub.2F, —OCHF.sub.2, —OCF.sub.3, —OCHFCl, —OCH.sub.2CF.sub.3, —OCFHCF.sub.3, —OCF.sub.2CF.sub.3, —OCH(CF.sub.3).sub.2, —OCF(CHF.sub.2).sub.2, and —OCH(CH.sub.2F)(CF.sub.3).

(800) The term “5-membered heteroaryl” or “6-membered heteroaryl” as used herein refers to a 5 or 6-membered carbon ring with two or three double bonds containing one ring heteroatom selected from N, S, and O and optionally one or two further ring N atoms instead of the one or more ring carbon atom(s). Representative examples of a 5-membered heteroaryl include, but are not limited to, furyl, imidazolyl, pyrazolyl, isoxazolyl, isothiazolyl, oxadiazolyl, and oxazolyl. Representative examples of a 6-membered heteroaryl include, but are not limited to, pyridyl, pyrimidyl, pyrazyl, and pyridazyl.

(801) The term “C.sub.3-6heterocycloalkyl” as used herein refers to a saturated carbocyclic molecule wherein the cyclic framework has 3 to 6 carbons and wherein one carbon atom is substituted with a heteroatom selected from N, O, and S. If the C.sub.3-6heterocycloalkyl group is a C.sub.6heterocycloalkyl, one or two carbon atoms are substituted with a heteroatom independently selected from N, O, and S. Representative examples of C.sub.3-6heterocycloalkyl include, but are not limited to, aziridinyl, azetidinyl, oxetanyl, pyrrolidinyl, piperazinyl, morpholinyl, and thiomorpholinyl.

(802) The term “C.sub.5-8spiroalkyl” as used herein refers a bicyclic ring system, wherein the two rings are connected through a single common carbon atom. Representative examples of C.sub.5-8spiroalkyl include, but are not limited to, spiro[2.2]pentanyl, spiro[3.2]hexanyl, spiro[3.3]heptanyl, spiro[3.4]octanyl, and spiro[2.5]octanyl.

(803) The term “C.sub.5-8tricycloalkyl” as used herein refers a tricyclic ring system, wherein all three cycloalkyl rings share the same two ring atoms. Representative examples of C.sub.5-8stricycloalkyl include, but are not limited to, tricyclo[1.1.1.0.sup.1,3]pentanyl,

(804) ##STR01363##
tricyclo[2.1.1.0.sup.1,4]hexanyl, tricyclo[3.1.1.0.sup.1,5]hexanyl, and tricyclo[3.2.1.0.sup.1,5]octanyl. The term “aryl” used alone or as part of a larger moiety as in “aralkyl,” “aralkoxy,” or “aryloxyalkyl,” refers to monocyclic or bicyclic ring systems having a total of 4 to 14 ring members, wherein at least one ring in the system is aromatic and wherein each ring in the system contains three to seven ring members. The term “aryl” may be used interchangeably with the term “aryl ring”. In certain embodiments of the present disclosure, “aryl” refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear one or more substituents. Also included within the scope of the term “aryl,” as it is used herein, is a group in which an aromatic ring is fused to one or more non-aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like.

(805) The terms “heteroaryl” and “heteroar-,” used alone or as part of a larger moiety, e.g., “heteroaralkyl,” or “heteroaralkoxy,” refer to groups having 5 to 10 ring atoms, preferably 5, 6, or 9 ring atoms; having 6, 10, or 14 π electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms. The term “heteroatom” in the context of “heteroaryl” particularly includes, but is not limited to, nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen. Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl. The terms “heteroaryl” and “heteroar-”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring. Nonlimiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H-quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3-b]-1,4-oxazin-3(4H)-one. A heteroaryl group may be monocyclic or bicyclic. A heteroaryl ring may include one or more oxo (═O) or thioxo (═S) substituent. The term “heteroaryl” may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted. The term “heteroaralkyl” refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted.

(806) As described herein, compounds of the present disclosure may contain “substituted” moieties. In general, the term “substituted” means that one or more hydrogens of the designated moiety are replaced with a suitable substituent. Unless otherwise indicated, an “optionally substituted” group may have a suitable substituent at one or more substitutable position of the group, and when more than one position in any given structure is substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position. Combinations of substituents envisioned by the present disclosure are preferably those that result in the formation of stable or chemically feasible compounds. The term “stable,” as used herein, refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.

(807) The term “pharmaceutically acceptable” as used herein refers to generally recognized for use in subjects, particularly in humans.

(808) The term “pharmaceutically acceptable salt” as used herein refers to a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound. Such salts include; (1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like; or formed with organic acids such as acetic acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, 3-(4-hydroxybenzoyl) benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, and the like; or (2) salts formed when an acidic proton present in the parent compound either is replaced by a metal ion, for example, an alkali metal ion, an alkaline earth ion, or an aluminum ion; or coordinates with an organic base such as ethanolamine, diethanolamine, triethanolamine, N-methylglucamine, dicyclohexylamine, and the like. Additional examples of such salts can be found in Berge et al., J. Pharm. Sci. 66(1):1-19 (1977). See also Stahl et al., Pharmaceutical Salts; Properties, Selection, and Use, 2.sup.nd Revised Edition (2011).

(809) The term “pharmaceutically acceptable excipient” as used herein refers to a broad range of ingredients that may be combined with a compound or salt disclosed herein to prepare a pharmaceutical composition or formulation. Typically, excipients include, but are not limited to, diluents, colorants, vehicles, anti-adherants, glidants, disintegrants, flavoring agents, coatings, binders, sweeteners, lubricants, sorbents, preservatives, and the like.

(810) The term “subject” as used herein refers to humans and mammals, including, but not limited to, primates, cows, sheep, goats, horses, dogs, cats, rabbits, rats, and mice. In one embodiment the subject is a human.

(811) The term “therapeutically effective amount” as used herein refers to that amount of a compound disclosed herein that will elicit the biological or medical response of a tissue, a system, or subject that is being sought by a researcher, veterinarian, medical doctor or other clinician.

(812) The present disclosure includes Examples A3 and A4, wherein a compound of the present invention is tested for TREM2 target engagement in comparison to an anti-TREM2 antibody. Exemplary anti-TREM2 antibodies include those disclosed in PCT Application Publication WO2018/195506A1, which is incorporated by reference herein in its entirety. In some embodiments, anti-TREM2 antibodies comprise a heavy chain (HC) comprising a variable region (VH) having three complementarity determining regions (CDRs) referred to herein as VH-CDR1, VH-CDR2, and VH-CDR3, and a light chain (LC) comprising a variable region (VL) having three complementarity determining regions referred to herein as VL-CDR1, VL-CDR2, and VL-CDR3. In some embodiments, the amino acid sequences of the CDRs of an anti-TREM2 antibody comprise a VH-CDR1 having the amino acid sequence SYWIG (SEQ ID NO; 1), a VH-CDR2 having the amino acid sequence IIYPGDADARYSPSFQG (SEQ ID NO:2), a VH-CDR3 having the amino acid sequence RRQGIFGDALDF (SEQ ID NO:3), a VL-CDR1 having the amino acid sequence RASQSVSSNLA (SEQ ID NO:4), a VL-CDR2 having the amino acid sequence GASTRAT (SEQ ID NO:5), and a VL-CDR3 having the amino acid sequence LQDNNFPPT (SEQ ID NO:6). In some embodiments, an anti-TREM2 antibody comprises a VH chain corresponding in sequence to SEQ ID NO:7; and a VL chain corresponding in sequence to SEQ ID NO:8. In some embodiments, an anti-TREM2 antibody is Antibody Ab-1, comprising a heavy chain amino acid sequence according to SEQ ID NO; 9, and a light chain amino acid sequence according to SEQ ID NO; 10.

(813) TABLE-US-00002 TABLE B Anti-TREM2 Antibody Sequences Sequence Description Amino Acid Sequence VH Chain EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIG SEQ ID NO: 7 WVRQMPGKGLEWMGIIYPGDADARYSPSFQGQVTI SADKSISTAYLQWSSLKASDTAMYFCARRRQGIFG DALDFWGQGTLVTVSS VL Chain EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAW SEQ ID NO: 8 FQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTE FTLTISSLQPEDFAVYYCLQDNNFPPTFGQGTKVD IK Ab-1 HC EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIG SEQ ID NO: 9 WVRQMPGKGLEWMGIIYPGDADARYSPSFQGQVTI SADKSISTAYLQWSSLKASDTAMYFCARRRQGIFG DALDFWGQGTLVTVSSAKTTPPSVYPLAPGSAAQT NSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFP AVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPAS STKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKP KDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDV EVHTAQTQPREEQFGSTFRSVSELPIMHQDWLNGK EFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIP PPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQP AENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNT FTCSVLHEGLHNHHTEKSLSHSPGK Ab-1 LC EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAW SEQ ID NO: 10 FQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTE FTLTISSLQPEDFAVYYCLQDNNFPPTFGQGTKVD IKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFY PKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN RNEC

GENERAL SYNTHETIC PROCEDURES

(814) The compounds provided herein can be synthesized according to the procedures described in this and the following sections. The synthetic methods described herein are merely exemplary, and the compounds disclosed herein may also be synthesized by alternate routes utilizing alternative synthetic strategies, as appreciated by persons of ordinary skill in the art. It should be appreciated that the general synthetic procedures and specific examples provided herein are illustrative only and should not be construed as limiting the scope of the present disclosure in any manner.

(815) Generally, the compounds of Formula I can be synthesized according to the following schemes. Any variables used in the following scheme are the variables as defined for Formula I, unless otherwise noted. All starting materials are either commercially available, for example, from Merck Sigma-Aldrich Inc. and Enamine Ltd. or known in the art and may be synthesized by employing known procedures using ordinary skill. Starting material may also be synthesized via the procedures disclosed herein. Suitable reaction conditions, such as, solvent, reaction temperature, and reagents, for the Schemes discussed in this section, may be found in the examples provided herein. As used below, Z is a leaving group, which can include but is not limited to, halogens (e.g. fluoride, chloride, bromide, iodide), sulfonates (e.g. mesylate, tosylate, benzenesulfonate, brosylate, nosylate, triflate), diazonium, and the like. As used below, in certain embodiments Y is an organometal coupling reagent group, which can include but are not limited to, boronic acids and esters, organotin and organozinc reagents.

(816) ##STR01364##

(817) As can be appreciated by the skilled artisan, the above synthetic scheme and representative examples are not intended to comprise a comprehensive list of all means by which the compounds described and claimed in this application may be synthesized. Further methods will be evident to those of ordinary skill in the art. Additionally, the various synthetic steps described above may be performed in an alternate sequence or order to give the desired compounds.

(818) Purification methods for the compounds described herein are known in the art and include, for example, crystallization, chromatography (for example, liquid and gas phase), extraction, distillation, trituration, and reverse phase HPLC.

(819) The disclosure further encompasses “intermediate” compounds, including structures produced from the synthetic procedures described, whether isolated or generated in-situ and not isolated, prior to obtaining the finally desired compound. These intermediates are included in the scope of this disclosure. Exemplary embodiments of such intermediate compounds are set forth in the Examples below.

EXAMPLES

(820) This section provides specific examples of compounds of Formula I and methods of making the same.

LIST OF ABBREVIATIONS

(821) TABLE-US-00003 aq or aq. aqueous DCM dichloromethane DMAP 4-dimethylaminopyridine DMF N,N-dimethylformamide DMSO dimethyl sulfoxide Dppf, DPPF or dppf 1,1′-bis(diphenylphosphino)ferrocene eq or eq. or equiv. equivalent ESI or ES electrospray ionization Et ethyl EtOAc or EA ethyl acetate g gram(s) h or hr hour(s) HPLC high pressure liquid chromatography iPr isopropyl iPr.sub.2NEt or DIPEA N-ethyl diisopropylamine (Hunig′s base) LC MS, LCMS, liquid chromatography mass spectroscopy LC-MS or LC/MS m/z mass divided by charge Me methyl CH.sub.3CN acetonitrile MeOH methanol mg milligrams min minutes mL milliliters MS mass spectra n-BuLi n-butyllithium NMR nuclear magnetic resonance PE Petroleum ether Ph phenyl RT or rt or r.t. room temperature RuPhos Pd G3 (2-Dicyclohexylphosphino-2′,6′-diisopropoxy-1,1′- biphenyl)[2-(2′-amino-1,1′-biphenyl)]palladium(II) methanesulfonate sat. saturated SFC supercritical fluid chromatography TEA or Et.sub.3N triethylamine THF tetrahydrofuran X antphos Pd G3 [(4,5-Bis(diphenylphosphino)-9,9-dimethylxanthene)- 2-(2′-amino-1,1′-biphenyl)]palladium(II) methanesulfonate PE Petroleum ether

(822) General Analytical and Purification Methods

(823) Provided in this section are descriptions of the general analytical and purification methods used to prepare the specific compounds provided herein.

(824) Chromatography;

(825) Unless otherwise indicated, crude product-containing residues were purified by passing the crude material or concentrate through either a Biotage brand silica gel column pre-packed with flash silica (SiO.sub.2) or reverse phase flash silica (C18) and eluting the product off the column with a solvent gradient as indicated. For example, a description of silica gel (0-40% EtOAc/hexane) means the product was obtained by elution from the column packed with silica using a solvent gradient of 0% to 40% EtOAc in hexanes. In some experiments, flash chromatography was performed on Teledyne Isco instruments using pre-packaged disposable SiO.sub.2 stationary phase columns with eluent flow rate range of 15 to 200 mL/min, UV detection (254 and 220 nm).

(826) Preparative HPLC Method;

(827) Where so indicated, the compounds described herein were purified via reverse phase HPLC using Waters Fractionlynx semi-preparative HPLC-MS system utilizing one of the following two HPLC columns; (a) Phenominex Gemini column (5 micron, C18, 150×30 mm) or (b) Waters X-select CSH column (5 micron, C18, 100×30 mm).

(828) A typical run through the instrument included; eluting at 45 mL/min with a linear gradient of 10% (v/v) to 100% MeCN (0.1% v/v formic acid) in water (0.1% formic acid) over 10 minutes; conditions can be varied to achieve optimal separations.

(829) Preparative Chiral Supercritical Fluid Chromatography (SFC) Method;

(830) Where so indicated, the compounds described herein were purified via chiral SFC using one of the two following chiral SFC columns; (a) Chiralpak IG 2×25 cm, 5 μm or (b) Chiralpak AD-H 2×15 cm, 5 μm.

(831) A typical run through the instrument included; eluting with flowrates (F) of between 30 and 120 mL/min using solvent mixtures of between 30 and 80% EtOH in supercritical CO.sub.2; conditions can be varied to achieve optimal separations.

(832) Alternatively, some CP Analytical-SFC experiments were run on SFC Method Station (Thar, Waters) with the following conditions; Column temperature; 40° C., Mobile phase; CO.sub.2/Methanol (0.2% Methanol Ammonia)=Flow; 4.0 ml/min, Back Pressure; 120 Bar, Detection wavelength; 214 nm.

(833) In other runs, some CP Preparative-SFC experiments were run on SFC-80 (Thar, Waters) with the following conditions; Column temperature; 35° C., Mobile phase (example); CO.sub.2/Methanol (0.2% Methanol Ammonia)=Flow rate; 80 g/min, Back pressure; 100 bar, Detection wavelength; 214 nm. Preparative CP Method; Acidic reversed phase MPLC; Instrument type; Reveleris™ prep MPLC; Column; Phenomenex LUNA C18(3) (150×25 mm, 10); Flow; 40 mL/min; Column temp; room temperature; Eluent A; 0.1% (v/v) Formic acid in water, Eluent B; 0.1% (v/v) Formic acid in acetonitrile; using the indicated gradient and wavelength.

(834) Proton NMR Spectra;

(835) Unless otherwise indicated, all .sup.1H NMR spectra were collected on a Bruker NMR Instrument at 300, 400 or 500 Mhz or a Varian NMR Instrument at 400 Mhz. Where so characterized, all observed protons are reported as parts-per-million (ppm) downfield from tetramethylsilane (TMS) using the internal solvent peak as reference. All NMR were collected at about 25° C.

(836) Mass Spectra (MS)

(837) Unless otherwise indicated, all mass spectral data for starting materials, intermediates and/or exemplary compounds are reported as mass/charge (m/z), having an [M+H].sup.+ molecular ion. The molecular ion reported was obtained by electrospray detection method (commonly referred to as an ESI MS) utilizing a Waters Acquity UPLC/MS system or a Gemini-NX UPLC/MS system. Compounds having an isotopic atom, such as bromine and the like, are generally reported according to the detected isotopic pattern, as appreciated by those skilled in the art.

(838) Compound Names

(839) The compounds disclosed and described herein have been named using the IUPAC naming function provided with Biovia Pipeline Pilot or ChemDraw Professional 17.0.

SPECIFIC EXAMPLES

(840) Provided in this section are the procedures to synthesize specific examples of the compounds provided herein. All starting materials are either commercially available from Sigma-Aldrich Inc., unless otherwise noted, or known in the art and may be synthesized by employing known procedures using ordinary skill.

SYNTHESIS OF EXAMPLES

Method 1

Example 1; 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(841) ##STR01365##

(842) To a solution of 2-chloro-4-(4-chloro-2-fluorophenyl)-7-methylpteridine (Intermediate 13) (0.0754 g, 0.244 mmol) and N-ethyl-N-isopropylpropan-2-amine (0.063 g, 0.085 mL, 0.488 mmol) in DMSO (0.813 mL) was added (S)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (Enamine, Monmouth Jct., N.J., USA) (0.049 g, 0.293 mmol). The reaction mixture was stirred at 100° C. for 2 h. After cooling, the mixture was partitioned between DCM and H.sub.2O. The organic phase was separated and concentrated under vacuum and the crude was purified by silica gel chromatography eluting with a gradient of 0-10% MeOH (+1% NH.sub.3) in DCM to afford 4-(4-chloro-2-fluorophenyl)-7-methyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine (0.0694 g, 0.158 mmol, 64.7% yield). .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.53 (s, 1H), 7.74 (br d, J=8.2 Hz, 2H), 7.64 (dd, J=9.8, 1.8 Hz, 1H), 7.41-7.54 (m, 2H), 4.77 (br d, J=12.6 Hz, 1H), 4.64 (br d, J=13.6 Hz, 1H), 4.54 (br d, J=8.3 Hz, 1H), 3.95-4.11 (m, 1H), 3.82 (s, 3H), 3.62-3.73 (m, 1H), 3.20-3.29 (m, 2H), 2.66 (s, 3H). m/z (ESI, +ive ion); 440.0 (M+H).sup.+.

(843) TABLE-US-00004 TABLE 1 Compounds 2 to 128 were prepared following the procedure described in Method 1, as follows: Starting Starting Ex # Structure IUPAC Name Material 1 Material 2  2 embedded image 4-(4-chloro-2- fluorophenyl)-2-((2S)- 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7- methylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13)  3 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13)  4 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pteridine (S)-2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13)  5 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-(2- (tetrahydro-3-furanyl)- 4- morpholinyl)pteridine 2- (tetrahydrofuran- 3- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13)  6 0embedded image 4-(2,4-difluorophenyl)- 7-methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpteridine (Intermediate 14)  7 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(2,4- difluorophenyl)-7- methylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpteridine (Intermediate 14)  8 embedded image 4-(2,4-difluorophenyl)- 7-methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpteridine (Intermediate 14)  9 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(2- fluoro-4- methylphenyl)-7- methylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpteridine (Intermediate 14)  10 embedded image 4-(2-fluoro-4- methylphenyl)-7- methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(2- fluoro-4- methylphenyl)- 7- methylpteridine (Intermediate 15)  11 embedded image 7-methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)-4- (trans-3- (trifluoromethyl)cyclo- butyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-7- methyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 61)  12 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7-methyl- 4-(cis-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4-(cis- 3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 62)  13 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7-methyl- 4-(trans-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 61)  14 embedded image 7-methyl-2-((2R)-2-(6- methyl-4-pyridazinyl)- 4-morpholinyl)-4-(cis- 3- (trifluoromethyl) cyclobutyl)pteridine. Absolute stereochemistry arbitrarily assigned. 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4-(cis- 3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 62)  15 embedded image 7-methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)-4-(cis-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-7- methyl-4-(cis- 3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 62)  16 0embedded image 7-methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)-4-(trans- 3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-7- methyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 61)  17 embedded image 4-(2-fluoro-4- (trifluoromethyl)phenyl)- 6,7-dimethyl-2-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(2- fluoro-4- (trifluoromethyl) phenyl)-6,7- dimethylpteridine (Intermediate 18)  18 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (3,4,5- trifluorophenyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (3,4,5- trifluorophenyl) pteridine (Intermediate 20)  19 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (6-(trifluoromethyl)-3- pyridinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(6- (trifluoromethyl) pyridin-3- yl)pteridine (Intermediate 21)  20 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (6-methyl-3- pyridinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(6- methylpyridin- 3-yl)pteridine (Intermediate 22)  21 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16)  22 embedded image 4-(4-chloro-2- fluorophenyl)-2-((2S)- 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-6,7- dimethylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16)  23 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16)  24 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pteridine. Purified by chiral SFC chromatography. Absolute stereochemistry arbitrarily assigned. 2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16)  25 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pteridine Purified by chiral SFC chromatography. Absolute stereochemistry arbitrarily assigned. 2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16)  26 0embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-(2- (tetrahydro-3-furanyl)- 4- morpholinyl)pteridine 2- (tetrahydrofuran- 3- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16)  27 embedded image 4-((1R,5S)-6,6- difluoro-3- azabicyclo[3.1.0]hexan- 3-yl)-6,7-dimethyl-2- ((2S)-2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- ((1R,5S)-6,6- difluoro-3- azabicyclo[3.1.0] hexan-3-yl)- 6,7- dimethylpteridine (Intermediate 86)  28 embedded image 4-(3-methoxy-1- azetidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(3- methoxyazetidin- 1-yl)-6,7- dimethylpteridine (Intermediate 83)  29 embedded image 4-(3-fluoro-1- azetidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(3- fluoroazetidin- 1-yl)-6,7- dimethylpteridine (Intermediate 84)  30 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (3-(trifluoromethyl)-1- azetidinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(3- (trifluoromethyl) azetidin-1- yl)pteridine (Intermediate 85)  31 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17)  32 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(2,4- difluorophenyl)-6,7- dimethylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17)  33 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S)-2- (2-methyl-4-pyridinyl)- 4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17)  34 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S)-2- ((3R)-tetrahydro-3- furanyl)-4- morpholinyl)pteridine Purified by chiral SFC Chromatography. Relative stereochemistry assigned by NMR. Absolute stereochemistry arbitrarily assigned. 2- (tetrahydrofuran- 3- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17)  35 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2R)-2- ((3R)-tetrahydro-3- furanyl)-4- morpholinyl)pteridine Purified by chiral SFC Chromatography. Relative stereochemistry assigned by NMR. Absolute stereochemistry arbitrarily assigned. 2- (tetrahydrofuran- 3- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17)  36 00embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2R)-2- ((3S)-tetrahydro-3- furanyl)-4- morpholinyl)pteridine Purified by chiral SFC Chromatography. Relative stereochemistry assigned by NMR. Absolute stereochemistry arbitrarily assigned. 2- (tetrahydrofuran- 3- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17)  37 01embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpteridine (Intermediate 19)  38 02embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(2- fluoro-4- methylphenyl)-6,7- dimethylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpteridine (Intermediate 19)  39 03embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpteridine (Intermediate 19)  40 04embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (3,3,3- trifluoropropyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (3,3,3- trifluoropropyl) pteridine (Intermediate (70)  41 05embedded image 6,7-dimethyl-2-((2S)-2- (2-methyl-4-pyridinyl)- 4-morpholinyl)-4- (3,3,3- trifluoropropyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-6,7- dimethyl-4- (3,3,3- trifluoropropyl) pteridine (Intermediate (70)  42 06embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (trans-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 59)  43 07embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (cis-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (cis-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 60)  44 08embedded image 4-(cis-3- (difluoromethyl)cyclobutyl)- 6,7-dimethyl-2- ((2S)-2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  45 09embedded image 4-(trans-3- (difluoromethyl)cyclobutyl)- 6,7-dimethyl-2- ((2S)-2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  46 0embedded image 4-(6,6- difluorospiro[3.3]heptan- 2-yl)-6,7-dimethyl-2- ((2S)-2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (6,6- difluorospiro[3.3] heptan-2-yl)- 6,7- dimethylpteridine (Intermediate (69)  47 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(cis-3- (difluoromethyl) cyclobutyl)-6,7- dimethylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  48 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(trans- 3- (difluoromethyl) cyclobutyl)-6,7- dimethylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  49 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(6,6- difluorospiro[3.3] heptan-2-yl)-6,7- dimethylpteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4- (6,6- difluorospiro[3.3] heptan-2-yl)- 6,7- dimethylpteridine (Intermediate (69)  50 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-6,7- dimethyl-4-(trans-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 59)  51 embedded image 6,7-dimethyl-2-((2S)-2- (6-methyl-4- pyridazinyl)-4- morpholinyl)-4-(trans- 3- (trifluoromethyl) cyclobutyl)pteridine 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 59)  52 embedded image 6,7-dimethyl-2-((2R)-2- (6-methyl-4- pyridazinyl)-4- morpholinyl)-4-(trans- 3- (trifluoromethyl) cyclobutyl)pteridine 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 59)  53 embedded image 4-(cis-3- (difluoromethyl)cyclobutyl)- 6,7-dimethyl-2- ((2S)-2-(2-methyl-4- pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  54 embedded image 4-(trans-3- (difluoromethyl)cyclobutyl)- 6,7-dimethyl-2- ((2S)-2-(2-methyl-4- pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  55 embedded image 6,7-dimethyl-2-((2S)-2- (2-methyl-4-pyridinyl)- 4-morpholinyl)-4- (trans-3- (trifluoromethyl) cyclobutyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoromethyl) cyclobutyl) pteridine (Intermediate 59)  56 0embedded image 4-(6,6- difluorospiro[3.3]heptan- 2-yl)-6,7-dimethyl-2- ((2S)-2-(2-methyl-4- pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(3- (difluoromethyl) cyclobutyl)- 6,7- dimethylpteridine (Intermediate 67)  57 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- ((1R,2R)-2- (trifluoromethyl) cyclopropyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- ((1S,2S)-2- (trifluoromethyl) cyclopropyl) pteridine (Intermediate 58)  58 embedded image 4-(4-chloro-2- methylphenyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- methylphenyl)- 6,7- dimethylpteridine (Intermediate 23)  59 embedded image 4-(4-fluoro-2- methylphenyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- fluoro-2- methylphenyl)- 6,7- dimethylpteridine (Intermediate 24)  60 embedded image 4-(3,4-difluorophenyl)- 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (3,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 25)  61 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (2,3,4- trifluorophenyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (2,3,4- trifluorophenyl) pteridine (Intermediate 26)  62 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (2,4,5- trifluorophenyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (2,4,5- trifluorophenyl) pteridine (Intermediate 27)  63 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (3- (trifluoromethyl)bicyclo [1.1.1]pentan-1- yl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(3- (trifluoromethyl) bicyclo[1.1.1] pentan-1- yl)pteridine (Intermediate 71)  64 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-6,7- dimethyl-4-(3- (trifluoromethyl)bicyclo [1.1.1]pentan-1- yl)pteridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-6,7- dimethyl-4-(3- (trifluoromethyl) bicyclo[1.1.1] pentan-1- yl)pteridine (Intermediate (71)  65 embedded image 6,7-dimethyl-2-((2S)-2- (2-methyl-4-pyridinyl)- 4-morpholinyl)-4-(3- (trifluoromethyl)bicyclo [1.1.1]pentan-1- yl)pteridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-6,7- dimethyl-4-(3- (trifluoromethyl) bicyclo[1.1.1] pentan-1- yl)pteridine (Intermediate (71)  66 0embedded image 4-(4,4-difluoro-1- piperidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (4,4- difluoropiperidin- 1-yl)-6,7- dimethylpteridine (Intermediate 87)  67 embedded image 4-(4,4-dimethyl-1- piperidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (4,4- dimethylpiperidin- 1-yl)-6,7- dimethylpteridine (Intermediate 88)  68 embedded image 4-(3,3-difluoro-1- piperidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (3,3- difluoropiperidin- 1-yl)-6,7- dimethylpteridine (Intermediate 89)  69 embedded image 4-((3R)-3-fluoro-1- piperidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine Purified by chiral SFC Chromatography. Absolute stereochemistry arbitrarily assigned. (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(3- fluoropiperidin- 1-yl)-6,7- dimethylpteridine (Intermediate 90)  70 embedded image 4-((3S)-3-fluoro-1- piperidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine Purified by chiral SFC Chromatography. Absolute stereochemistry arbitrarily assigned. (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(3- fluoropiperidin- 1-yl)-6,7- dimethylpteridine (Intermediate 90)  71 embedded image 4-(3,3-difluoro-1- pyrrolidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (3,3- difluoropyrrolidin- 1-yl)-6,7- dimethylpteridine (Intermediate 91)  72 embedded image 4-(3,3-dimethyl-1- pyrrolidinyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (3,3- dimethylpyrrolidin- 1-yl)-6,7- dimethylpteridine (Intermediate 92)  73 embedded image 5-(4-chloro-2- fluorophenyl)-2- methyl-7-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[3,4- b]pyrazine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methylpyrido[3, 4-b]pyrazine (Intermediate 32)  74 embedded image 5-(4-chloro-2- fluorophenyl)-3- methyl-7-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[3,4-b] pyrazine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-5-(4- chloro-2- fluorophenyl)- 3- methylpyrido[3,4-b] pyrazine (Intermediate 33)  75 embedded image 5-(4-chloro-2- fluorophenyl)-7-((2S)- 2-(1-ethyl-1H-pyrazol- 4-yl)-4-morpholinyl)-2- methylpyrido[3,4- b]pyrazine (S)-2-(1-ethyl- 1H-pyrazol-4- yl)morpholine (Intermed, Inc. Kiev, Ukraine) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methylpyrido[3,4-b] pyrazine (Intermediate 32)  76 0embedded image 5-(4-chloro-2- fluorophenyl)-7-((2S)- 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-2- methylpyrido[3,4- b]pyrazine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methylpyrido[3,4-b] pyrazine (Intermediate 32)  77 embedded image 5-(4-chloro-2- fluorophenyl)-2- methyl-7-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pyrido[3,4-b ] pyrazine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methylpyrido[3,4-b] pyrazine (Intermediate 32)  78 embedded image 5-(4-chloro-2- fluorophenyl)-7-((2S)- 2-(2-methoxy-4- pyridinyl)-4- morpholinyl)-2- methylpyrido[3,4- b]pyrazine (S)-2-(2- methoxypyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methylpyrido[3,4-b] pyrazine (Intermediate 32)  79 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[3,4- b]pyrazine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-5-(4- chloro-2- fluorophenyl)-2,3- dimethylpyrido [3,4-b]pyrazine (Intermediate 33)  80 embedded image 2,3-dimethyl-7-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-5- (trans-3- (trifluoromethyl)cyclobutyl) pyrido[3,4- b]pyrazine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-2,3- dimethyl-5- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[3,4- b]pyrazine (Intermediate 63)  81 embedded image 7-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-2,3- dimethyl-5-(trans-3- (trifluoromethyl)cyclobutyl) pyrido[3,4- b]pyrazine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 7-chloro-2,3- dimethyl-5- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[3,4- b]pyrazine (Intermediate 63)  82 embedded image 2,3-dimethyl-7-((2S)-2- (2-methyl-4-pyridinyl)- 4-morpholinyl)-5- (trans-3- (trifluoromethyl)cyclobutyl) pyrido[3,4- b]pyrazine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 7-chloro-2,3- dimethyl-5- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[3,4- b]pyrazine (Intermediate 63)  83 embedded image 4-(4-chloro-2- fluorophenyl)-2-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- fluorophenyl) pyrido[2,3- d]pyrimidine (Intermediate 36)  84 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  85 embedded image 4-(4-chloro-2- fluorophenyl)-2-((2S)- 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7- methylpyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  86 0embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(6- methyl-4-pyridazinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  87 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2R)-2-(6- methyl-4-pyridazinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  88 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  89 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2R)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  90 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37)  91 embedded image 4-(2,4-difluorophenyl)- 7-methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 38)  92 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(2,4- difluorophenyl)-7- methylpyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 38)  93 embedded image 4-(2,4-difluorophenyl)- 7-methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4- (2,4- difluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 38)  94 embedded image 4-(2-fluoro-4- methylphenyl)-7- methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(2- fluoro-4- methylphenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 39)  95 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(2- fluoro-4- methylphenyl)-7- methylpyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(2- fluoro-4- methylphenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 39)  96 0embedded image 4-(2-fluoro-4- methylphenyl)-7- methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-4-(2- fluoro-4- methylphenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 39)  97 embedded image 7-methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)-4- (trans-3- (trifluoromethyl)cyclobutyl) pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-7- methyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 64)  98 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7-methyl- 4-(trans-3- (trifluoromethyl)cyclobutyl) pyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 64)  99 embedded image 7-methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)-4-(trans- 3- (trifluoromethyl)cyclobutyl) pyrido[2,3- d]pyrimidine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-7- methyl-(4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 64) 100 embedded image 7-methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)-4- (3- (trifluoromethyl)bicyclo [1.1.1]pentan-1- yl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-7- methyl-4-(3- (trifluoromethyl) bicyclo[1.1.1] pentan-1- yl)pyrido[2,3- d]pyrimidine (Intermediate 72) 101 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7-methyl- 4-(3- (trifluoromethyl)bicyclo [1.1.1]pentan-1- yl)pyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4-(3- (trifluoromethyl) bicyclo[1.1.1] pentan-1- yl)pyrido[2,3- d]pyrimidine (Intermediate 72) 102 embedded image 7-methyl-2-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)-4-(3- (trifluoromethyl)bicyclo [1.1.1]pentan-1- yl)pyrido[2,3- d]pyrimidine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-7- methyl-4-(3- (trifluoromethyl) bicyclo[1.1.1] pentan-1- yl)pyrido[2,3- d]pyrimidine (Intermediate 72) 103 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 104 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S)-2-(6- methyl-4-pyridazinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 105 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R)-2-(6- methyl-4-pyridazinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 106 0embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pyrido 2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 107 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S)-2-(2- methyl-5-pyrimidinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(2- methylpyrimidin- 5- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 108 embedded image 4-((3,3- difluorocyclobutyl) methoxy)-6,7-dimethyl-2- ((2S)-2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- ((3,3- difluorocyclobutyl) methoxy)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 93) 109 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- ((cis-3- (trifluoromethyl)cyclobutyl) methoxy)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (((cis)-3- (trifluoromethyl) cyclobutyl) methoxy)pyrido [2,3- d]pyrimidine (Intermediate 94) 110 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (((1R,2R)-2- (trifluoromethyl) cyclopropyl)methoxy)pyrido [2,3-d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (((1R,2R)-2- (trifluoromethyl) cyclopropyl) methoxy)pyrido [2,3- d]pyrimidine (Intermediate 95) 111 embedded image 4-(((1S)-2,2- dimethylcyclopropyl) methoxy)-6,7-dimethyl- 2-((2S)-2-(1-methyl- 1H-pyrazol-4-yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) (S)-2-chloro-4- ((2,2- dimethylcyclopropyl) methoxy)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 96) 112 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (trans-3- (trifluoromethyl) cyclobutyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 65) 113 embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-6,7- dimethyl-4-(trans-3- (trifluoromethyl) cyclobutyl)pyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-6,7- dimethyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 65) 114 embedded image 6,7-dimethyl-2-((2S)-2- (6-methyl-4- pyridazinyl)-4- morpholinyl)-4-(trans- 3- (trifluoromethyl) cyclobutyl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. 2-(6- methylpyridazin- 4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-6,7- dimethyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 65) 115 embedded image 6,7-dimethyl-2-((2S)-2- (2-methyl-4-pyridinyl)- 4-morpholinyl)-4- (trans-3- (trifluoromethyl) cyclobutyl)pyrido[2,3- d]pyrimidine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 2-chloro-6,7- dimethyl-4- (trans-3- (trifluoromethyl) cyclobutyl) pyrido[2,3- d]pyrimidine (Intermediate 65) 116 0embedded image 6-chloro-4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2,6-dichloro-4- (4-chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 43) 117 embedded image 2-methyl-6-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)-4- (cis-3- (trifluoromethyl)cyclobutyl)- 2,3-dihydro-1H- pyrrolo[3,4-c]pyridin- 1-one (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 6-chloro-2- methyl-4-(3- (trifluoromethyl) cyclobutyl)- 2,3-dihydro- 1H- pyrrolo[3,4- c]pyridin-1-one (Intermediate 66) 118 embedded image 4-(4-chloro-2- fluorophenyl)-2- methyl-6-((2S)-2- methyl-4-morpholinyl)- 2,3-dihydro-1H- pyrrolo[3,4-c]pyridin- 1-one (S)-2- methylmorpholine (Enamine, Monmouth Jct., NJ, USA) 6-chloro-4-(4- chloro-2- fluorophenyl)- 2-methyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Intermediate 10) 119 embedded image 4-(4-chloro-2- fluorophenyl)-2- methyl-6-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)-2,3- dihydro-1H- pyrrolo[3,4-c]pyridin- 1-one (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 6-chloro-4-(4- chloro-2- fluorophenyl)- 2-methyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Intermediate 10) 120 embedded image 4-(4-chloro-2- fluorophenyl)-6-((2S)- 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-2-methyl- 2,3-dihydro-1H- pyrrolo[3,4-c]pyridin- 1-one (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 6-chloro-4-(4- chloro-2- fluorophenyl)- 2-methyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Intermediate 10) 121 embedded image 4-(4-chloro-2- fluorophenyl)-2-ethyl- 6-((2S)-2-(1-methyl- 1H-pyrazol-4-yl)-4- morpholinyl)-2,3- dihydro-1H- pyrrolo[3,4-c]pyridin- 1-one (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 6-chloro-4-(4- chloro-2- fluorophenyl)- 2-ethyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Intermediate 46) 122 embedded image 4-(4-chloro-2- fluorophenyl)-6-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-2-(2- propanyl)-2,3-dihydro- 1H-pyrrolo[3,4- c]pyridin-1-one (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 6-chloro-4-(4- chloro-2- fluorophenyl)- 2-isopropyl- 2,3-dihydro- 1H- pyrrolo[3,4- c]pyridin-1-one (Intermediate 47) 123 embedded image 4-(4-chloro-2- fluorophenyl)-2-((3S)- 4,4-difluoro-3-(1- methyl-1H-pyrazol-4- yl)-1-piperidinyl)-6,7- dimethylpteridine Purified by chiral SFC Chromatography. Absolute stereochemistry arbitrarily assigned. 4,4-difluoro-3- (1-methyl-1H- pyrazol-4- yl)piperidine (Intermediate 73) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 124 embedded image 4-(4-chloro-2- fluorophenyl)-2-((3R)- 4,4-difluoro-3-(1- methyl-1H-pyrazol-4- yl)-1-piperidinyl)-6,7- dimethylpteridine Purified by chiral SFC Chromatography. Absolute stereochemistry arbitrarily assigned. 4,4-difluoro-3- (1-methyl-1H- pyrazol-4- yl)piperidine (Intermediate 73) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 125 embedded image 4-(4,4-difluoro-1- cyclohexen-1-yl)-6,7- dimethyl-2-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (4,4- difluorocyclohex- 1-en-1-yl)- 6,7- dimethylpteridine (Intermediate 49) 126 0embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- ((4R)-4- (trifluoromethyl)-1- cyclohexen-1- yl)pteridine Purified by chiral SFC Chromatography. Absolute stereochemistry arbitrarily assigned. (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(4- (trifluoromethyl) cyclohex-1- en-1- yl)pteridine (Intermediate 48) 127 embedded image 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- ((4S)-4- (trifluoromethyl)-1- cyclohexen-1- yl)pteridine Purified by chiral SFC Chromatography. Absolute stereochemistry arbitrarily assigned. (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(4- (trifluoromethyl) cyclohex-1- en-1- yl)pteridine (Intermediate 48) 128 embedded image 4-(1-cyclopenten-1-yl)- 6,7-dimethyl-2-((2S)-2- (1-methyl-1H-pyrazol- 4-yl)-4- morpholinyl)pteridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (cyclopent-1- en-1-yl)-6,7- dimethylpteridine (Intermediate 51)

Method 2

Example 129; 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(1-(3-oxetanyl)-1H-pyrazol-4-yl)-4-morpholinyl)pyrido[3,4-b]pyrazine

(844) ##STR01493##

(845) To a 10 mL vial were added 7-chloro-5-(4-chloro-2-fluorophenyl)-2-methylpyrido[3,4-b]pyrazine (Intermediate 32) (0.154 g, 0.5 mmol), (S)-2-(1H-pyrazol-4-yl)morpholine (Enamine, Inc.) (0.128 g, 0.600 mmol), and diisopropylethylamine (0.323 g, 0.437 mL, 2.500 mmol), and DMSO (1.5 mL) The reaction mixture was stirred at 100° C. for 5 h, cooled to rt then partitioned between EtOAc and H.sub.2O. The organic phase was dried over Na.sub.2SO.sub.4 and concentrated under vacuum. The crude intermediate (0.106 g, 0.25 mmol) was dissolved in N, N-dimethylformamide (1 mL), 3-iodooxetane (92 mg, 0.5 mmol) and Cs.sub.2CO.sub.3 (163 mg, 0.50 mmol) were added and the reaction was stirred at 60° C. for 12 h. The mixture was cooled to rt then partitioned between EtOAc and H.sub.2O. The organic phase was dried over Na.sub.2SO.sub.4, concentrated under vacuum and the crude product was purified by reverse phase HPLC to provide 5-(4-chloro-2-fluorophenyl)-2-methyl-7-((2S)-2-(1-(3-oxetanyl)-1H-pyrazol-4-yl)-4-morpholinyl)pyrido[3,4-b]pyrazine. .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.49-8.55 (m, 1H), 7.98 (s, 1H), 7.62-7.68 (m, 2H), 7.53-7.58 (m, 1H), 7.42-7.47 (m, 1H), 7.19-7.24 (m, 1H), 5.51-5.61 (m, 1H), 4.87-4.94 (m, 4H), 4.58-4.65 (m, 1H), 4.42-4.48 (m, 1H), 4.24-4.29 (m, 1H), 4.01-4.09 (m, 1H), 3.73-3.80 (m, 1H), 3.09-3.14 (m, 1H), 3.02-3.07 (m, 1H), 2.63-2.68 (m, 3H). m/z (ESI, +ive ion); 481.0 (M+H).sup.+.

Method 3

Example 130; 4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(846) ##STR01494##

Step 1; (S)-4-(4-(4,4-dimethylcyclohex-1-en-1-yl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine

(847) To a 50-mL round bottomed flask was added 2-chloro-4-(4,4-dimethylcyclohex-1-en-1-yl)-6,7-dimethylpteridine (Intermediate 54, 270 mg, 0.892 mmol) and DIEA (0.3 mL, 1.76 mmol) in DMSO (8 mL). (S)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (164 mg, 0.98 mmol) was then added and the reaction mass continued stirred at 100° C. for 2h. The reaction mixture was quenched with H.sub.2O (15 mL), extracted with DCM (2×20 mL). The combined organic layers were washed with brine (20 mL), dried over Na.sub.2SO.sub.4, and concentrated under reduced pressure. The crude material was purified by reverse-phase preparative HPLC using a Reveleris C18 column, CH.sub.3CN/H.sub.2O, gradient 0% to 55% over 30 min to provide (S)-4-(4-(4,4-dimethylcyclohex-1-en-1-yl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (300 mg, 0.692 mmol, 65.5% yield) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d6); δ ppm 7.77 (s, 1H), 7.47 (d, J=0.8 Hz, 1H), 7.40 (s, 1H), 4.72 (d, J=12.9 Hz, 1H), 4.61 (d, J=13.3 Hz, 1H), 4.51 (dd, J=10.4, 2.7 Hz, 1H), 4.01 (d, J=10.5 Hz, 1H), 3.84 (s, 3H), 3.66 (td, J=11.5, 2.7 Hz, 1H), 3.19 (q, J=14.7, 13.6 Hz, 2H), 2.59 (d, J=11.4 Hz, 8H), 2.14 (dt, J=4.7, 2.4 Hz, 2H), 1.51 (t, J=6.5 Hz, 2H), 0.98 (s, 6H).

Step 2; 4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine and (2S)-4-(4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-7,8-dihydropteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine

(848) To a 100-mL round-bottomed flask was added (S)-4-(4-(4,4-dimethylcyclohex-1-en-1-yl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.27 g, 0.623 mmol) in EtOH (20 mL) followed by 10% Pd/C (0.265 g, 2,491 mmol) and the reaction mixture was stirred under hydrogen gas atmosphere (balloon pressure) at RT for 5 h. The mixture was filtered through celite bed and concentrated under reduced pressure to give a 1:1 mixture of desired product and over reduced byproduct ((2S)-4-(4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-7,8-dihydropteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine), which was used in the next step without purification.

Step 3; 4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(849) To a 50-mL round-bottomed flask was added a ˜1:1 mixture of 4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine and (2S)-4-(4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-7,8-dihydropteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.23 g, 0.526 mmol) in CH.sub.3CN (20 mL). Sodium hypochlorite (2.19 mL, 26.3 mmol) was added and the reaction mixture was stirred at RT for 5 min. The reaction mixture was diluted with H.sub.2O (30 mL), extracted with EtOAc (2×30 mL) and the organic extracts were dried over Na.sub.2SO.sub.4. The combined organics were concentrated and the crude material was purified by reverse-phase preparative HPLC to provide 4-(4,4-dimethylcyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine (0.103 g, 0.236 mmol, 45.0% yield) as a yellow solid. .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.57 (s, 1H), 7.46 (s, 1H), 5.02 (d, J=13.5 Hz, 1H), 4.85 (d, J=13.6 Hz, 1H), 4.62 (dd, J=10.1, 2.8 Hz, 1H), 4.11 (d, J=11.4 Hz, 1H), 3.93 (s, 3H), 3.76-3.89 (m, 2H), 3.35 (dd, J=28.4, 16.1 Hz, 2H), 2.68 (d, J=15.3 Hz, 6H), 1.91 (q, J=12.8, 11.3 Hz, 2H), 1.76 (dd, J=13.8, 3.6 Hz, 2H), 1.48 (td, J=13.2, 3.9 Hz, 4H), 1.03 (d, J=6.2 Hz, 6H). m/z (ESI, +ive ion); 436.3 (M+H).sup.+.

(850) TABLE-US-00005 TABLE 2 Compounds 131 to 145 were prepared following the procedure described in Method 3, as follows: Ex Starting Starting # Structure Name Material 1 Material 2 131 embedded image 6,7-dimethyl-2-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(cis- 4- (trifluoromethyl) cyclohexyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(4- (trifluoromethyl) cyclohex-1-en-1- yl)pteridine (Intermediate 48) 132 embedded image 6,7-dimethyl-2-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-4- (trans-4- (trifluoromethyl) cyclohexyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(4- (trifluoromethyl) cyclohex-1-en-1- yl)pteridine (Intermediate 48) 133 embedded image 4-(4,4- difluorocyclohexyl)- 6,7-dimethyl-2-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4,4- difluorocyclohex- 1-en-1-yl)-6,7- dimethylpteridine (Intermediate 49) 134 embedded image 4-cyclohexyl-6,7- dimethyl-2-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (cyclohex-1-en- 1-yl)-6,7- dimethylpteridine (Intermediate 52) 135 embedded image 6,7-dimethyl-4-(cis- 4-methylcyclohexyl)- 2-((2S)-2-(1-methyl- 1H-pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(4- methylcyclohex- 1-en-1- yl)pteridine (Intermediate 53) 136 00embedded image 6,7-dimethyl-4- (trans-4- methylcyclohexyl)-2- ((2S)-2-(1-methyl- 1H-pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4-(4- methylcyclohex- 1-en-1- yl)pteridine (Intermediate 53) 137 01embedded image 6,7-dimethyl-2-((2S)- 2-(1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-4- (spiro[2.5]octan-6- yl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-6,7- dimethyl-4- (spiro[2.5]oct-5- en-6-yl)pteridine (Intermediate 55) 138 02embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(4,4- difluorocyclohexyl)- 6,7-dimethylpteridine (S)-2-(1- cyclopropyl- 1H-pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4,4- difluorocyclohex- 1-en-1-yl)-6,7- dimethylpteridine (Intermediate 49) 139 03embedded image 4-(4,4- difluorocyclohexyl)- 6,7-dimethyl-2-((2S)- 2-(2-methyl-4- pyridinyl)-4- morpholinyl)pteridine (S)-2-(2- methylpyridin- 4- yl)morpholine (Intemied Ltd. Kiev, Ukraine) 2-chloro-4-(4,4- difluorocyclohex- 1-en-1-yl)-6,7- dimethylpteridine (Intermediate 49) 140 04embedded image 4-cyclopentyl-6,7- dimethyl-2-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pteridine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4- (cyclopent-1-en- 1-yl)-6,7- dimethylpteridine (Intermediate 51) 141 05embedded image 4-(4,4- difluorocyclohexyl)- 7-methyl-2-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-4-(4,4- difluorocyclohex- 1-en-1-yl)-7- methylpyrido[2,3- d]pyrimidine (Intermediate 57) 142 06embedded image 7-methyl-2-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(cis- 4- (trifluoromethyl) cyclohexyl)pyrido[2,3- d]pyrimidine (S)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 2-chloro-7- methyl-4-(4- (trifluoromethyl) cyclohex-1-en-1- yl)pyrido[2,3- d]pyrimidine (Intermediate 56) 143 07embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-4-(4,4- difluorocyclohexyl)- 7-methylpyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl- 1H-pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-4-(4,4- difluorocyclohex- 1-en-1-yl)-7- methylpyrido[2,3- d]pyrimidine (Intermediate 57) 144 08embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7- methyl-4-(cis-4- (trifluoromethyl) cyclohexyl)pyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl- 1H-pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4-(4- (trifluoromethyl) cyclohex-1-en-1- yl)pyrido[2,3- d]pyrimidine (Intermediate 56) 145 09embedded image 2-((2S)-2-(1- cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-7- methyl-4-(trans-4- (trifluoromethyl) cyclohexyl)pyrido[2,3- d]pyrimidine (S)-2-(1- cyclopropyl- 1H-pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 2-chloro-7- methyl-4-(4- (trifluoromethyl) cyclohex-1-en-1- yl)pyrido[2,3- d]pyrimidine (Intermediate 56)

Method 4

Example 146; 4-(3,3-difluorocyclobutyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(851) ##STR01510##

Step 1; S)-4-(6,7-dimethyl-4-(5,8-dioxaspiro[3.4]octan-2-yl)pteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine

(852) To a 20 mL vial were added crude 2-chloro-6,7-dimethyl-4-(5,8-dioxaspiro[3.4]octan-2-yl)pteridine (Intermediate 68, 1.07 g, 3.5 mmol), (S)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (Enamine, Monmouth Jct., N.J., USA) (0.736 g, 4.40 mmol) and DIPEA (1.706 g, 2,306 mL, 13.20 mmol, Sigma) in 5 mL DMF. The mixture was heated at 90° C. for 12 h. The mixture was diluted with EtOAc (200 mL) and washed 2× with brine. The organic layer was dried over MgSO.sub.4 and concentrated. The residue was purified by silica gel chromatography (0%-100% EtOAc/EtOH=3/1 blend in 10% DCM in heptane) to afford (S)-4-(6,7-dimethyl-4-(5,8-dioxaspiro[3.4]octan-2-yl)pteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (298 mg, 0.681 mmol, 15.48% yield) as a red solid. .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.58 (s, 1H), 7.47 (s, 1H), 5.0-5.1 (m, 1H), 4.8-4.9 (m, 1H), 4.62 (dd, 1H, J=2.8, 10.2 Hz), 4.4-4.5 (m, 1H), 4.1-4.1 (m, 1H), 4.0-4.1 (m, 2H), 3.9-4.0 (m, 2H), 3.9-3.9 (m, 3H), 3.9-3.9 (m, 3H), 3.8-3.8 (m, 1H), 3.3-3.4 (m, 1H), 3.2-3.3 (m, 1H), 2.8-2.9 (m, 2H), 2.7-2.8 (m, 3H), 2.7-2.7 (m, 3H), 2.6-2.7 (m, 3H)

Step 2; (S)-3-(6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pteridin-4-yl)cyclobutan-1-one

(853) To a 40 mL vial was added (S)-4-(6,7-dimethyl-4-(5,8-dioxaspiro[3.4]octan-2-yl)pteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (285 mg, 0.651 mmol, 126290-50) and THF (3257 μL). 1.5 mL 2N HCl was then added. The red suspension was stirred at 65° C. for 5 h. The reaction was quenched with NaHCO.sub.3 (sat. 4 mL) and concentrated under vacuum. The aqueous layer was extracted with DCM (20 mL×3) and separated by phase separator. The solvent was concentrated under vacuum, and the black residue (S)-3-(6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pteridin-4-yl)cyclobutan-1-one (251 mg, 0.638 mmol, 98% yield) was used directly in the next step without further purification.

Step 3; 4-(3,3-difluorocyclobutyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(854) To a 40 mL vial containing (S)-3-(6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pteridin-4-yl)cyclobutan-1-one (135 mg, 0.343 mmol) was added diethylaminosulfur trifluoride, 1.0 M solution in DCM (7205 μL, 7.21 mmol) under N.sub.2. The mixture was stirred at room temperature overnight. The reaction was cooled to 0° C., quenched with NaHCO.sub.3 and the aqueous phase was extracted with DCM (20 mL×3). The DCM extracts were combined, concentrated and purified via silica gel column (RediSep 4 g, 2%-100% EA/EtOH=3/1 in 10% DCM in Heptane) to afford 4-(3,3-difluorocyclobutyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine (22.3 mg, 0.054 mmol, 15.6% yield) as a light red solid. .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.5-7.6 (m, 1H), 7.45 (s, 1H), 5.03 (br d, 1H, J=12.8 Hz), 4.8-4.9 (m, 1H), 4.61 (dd, 1H, J=2.8, 10.2 Hz), 4.4-4.6 (m, 1H), 4.13 (br d, 1H, J=10.4 Hz), 3.93 (s, 3H), 3.81 (dt, 1H, J=2.9, 11.5 Hz), 3.38 (ddd, 1H, J=3.5, 11.3, 13.5 Hz), 3.2-3.3 (m, 1H), 3.0-3.1 (m, 4H), 2.71 (s, 3H), 2.65 (s, 3H). m/z (ESI, +ive ion); 416.0 (M+H).sup.+.

Method 5

Example 147; 1-(4-chloro-2-fluorophenyl)-6-methyl-3-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)isoquinoline

(855) ##STR01511##

(856) To a 10 mL vial were added 3-chloro-1-(4-chloro-2-fluorophenyl)-6-methylisoquinoline (Intermediate 11) (77 mg, 0.250 mmol), (2-dicyclohexylphosphino-2′,6′-diisopropoxy-1,1′-biphenyl)[2-(2′-amino-1,1′-biphenyl)]palladium(ii) methanesulfonate (20.91 mg, 0.025 mmol, Combi-Blocks Inc.), 2-dicyclohexylphosphino-2,6-di-1-propoxy-1,1-biphenyl (11.67 mg, 0.025 mmol), 2-(1-methyl-1h-pyrazol-4-yl)morpholine (41.8 mg, 0.042 mL, 0.250 mmol, Enamine), and sodium tert-butoxide (72.1 mg, 0.750 mmol). Toluene (2 mL) was added, and the reaction was stirred at 100° C. for 1 h. The reaction mixture was quenched with H.sub.2O and extracted with EtOAc. The combined organics were dried, concentrated, and purified via reverse phase chromatography to yield 1-(4-chloro-2-fluorophenyl)-6-methyl-3-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)isoquinoline. .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.55-7.58 (m, 1H), 7.48-7.53 (m, 2H), 7.44-7.48 (m, 2H), 7.29-7.33 (m, 1H), 7.28-7.29 (m, 1H), 7.25-7.28 (m, 1H), 7.07-7.11 (m, 1H), 6.78-6.83 (m, 1H), 4.70-4.75 (m, 1H), 4.30-4.35 (m, 1H), 4.12-4.17 (m, 1H), 4.05-4.12 (m, 1H), 3.93-3.98 (m, 1H), 3.90-3.93 (m, 3H), 3.09-3.17 (m, 1H), 3.00-3.07 (m, 1H), 2.47-2.51 (m, 3H). m/z (ESI, +ive ion); 437.0 (M+H).sup.+.

(857) TABLE-US-00006 TABLE 3 Compounds 148 to 154 were prepared following the procedure described in Method 5, as follows: Ex Starting Starting # Structure Name Material 1 Material 2 148 embedded image 5-(4-chloro-2- fluorophenyl)-2- methyl-7-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)- 1,6-naphthyridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2-methyl-1,6- naphthyridine (Intermediate 9) 149 embedded image 5-(4-chloro-2- fluorophenyl)-7-((2S)- 2-(2-methoxy-4- pyridinyl)-4- morpholinyl)-2- methyl-1,6- naphthyridine (S)-2-(2- methoxypyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2-methyl-1,6- naphthyridine (Intermediate 9) 150 embedded image 5-(4-chloro-2- fluorophenyl)-7-((2S)- 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4- morpholinyl)-2- methyl-1,6- naphthyridine (S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2-methyl-1,6- naphthyridine (Intermediate 9) 151 embedded image 5-(4-chloro-2- fluorophenyl)-2- methyl-7-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl)-1,6- naphthyridine (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2-methyl-1,6- naphthyridine (Intermediate 9) 152 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4-morpholinyl)- 1,6-naphthyridine (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2,3-dimethyl- 1,6- naphthyridine (Intermediate 12) 153 embedded image 5-(4-chloro-2- fluorophenyl)-2- methyl-7-((2S)-2-(1- methyl-1H-pyrazol-4- yl)-4- morpholinyl) quinazoline (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methyl- quinazoline (Intermediate 44) 154 embedded image 5-(2,4- difluorophenyl)-2- methyl-7-((2S)-2-(2- methyl-4-pyridinyl)-4- morpholinyl) quinazoline (S)-2-(2- methylpyridin- 4-yl)morpholine (Intermed Ltd. Kiev, Ukraine) 7-chloro-5- (2,4- difluorophenyl)- 2- methyl- quinazoline (Intermediate 45)

Method 6

Example 155; 4-(4-chloro-2-fluorophenyl)-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,8-naphthyridine

(858) ##STR01519##

(859) In a vial containing (S)-4-(4-chloro-1,8-naphthyridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (Intermediate 99) (0.1 g, 0.303 mmol), sodium carbonate (0.096 g, 0.910 mmol, JT Baker), (4-chloro-2-fluorophenyl)boronic acid (0.058 g, 0.334 mmol, combi-blocks), tetrakis palladium triphenylphosphine (0.018 g, 0.015 mmol) was added 1,4-dioxane (0.809 mL) and H.sub.2O (0.202 mL). The vial was flushed under N.sub.2 and the reaction mixture was stirred at 75 deg for 6 h. After cooling, the reaction mixture was worked up in DCM/H.sub.2O and the organic phase was separated (phase separator) and concentrated under vacuo. The crude was purified by column chromatography eluting with a gradient of 0-10% MeOH (+1% NH.sub.3) in DCM to afford 4-(4-chloro-2-fluorophenyl)-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)-1,8-naphthyridine (0.0134 g, 0.032 mmol, 10.43% yield). .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.76-8.80 (m, 1H), 7.74-7.77 (m, 1H), 7.67-7.73 (m, 2H), 7.55-7.59 (m, 1H), 7.47-7.53 (m, 2H), 7.41-7.44 (m, 1H), 7.21-7.24 (m, 1H), 4.60-4.67 (m, 1H), 4.47-4.56 (m, 2H), 4.01-4.07 (m, 1H), 3.81-3.83 (m, 3H), 3.68-3.75 (m, 1H), 3.14-3.20 (m, 1H), 3.06-3.12 (m, 1H). m/z (ESI, +ive ion); 424.0 (M+H).sup.+.

(860) TABLE-US-00007 TABLE 4 Compounds 156 to 164 were prepared following the procedure described in Method 6, as follows: Ex Starting Starting # Structure Name Material 1 Material 2 156 0embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-1,8- naphthyridine (4-chloro-2- fluorophenyl) boronic acid (S)-4-(4-chloro- 7-methyl-1,8- naphthyridin-2- yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Intermediate 98) 157 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)-1,8- naphthyridine (4-chloro-2- fluorophenyl) boronic acid (S)-4-(4-chloro- 6,7-dimethyl- 1,8- naphthyridin-2- yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Intermediate 97) 158 embedded image 8-(4-chloro-2- fluorophenyl)-2- methyl-6-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pyrido [2,3-b]pyrazine (4-chloro-2- fluorophenyl) boronic acid (S)-4-(8-chloro- 2- methylpyrido[2,3- b]pyrazin-6- yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Intermediate 100) 159 embedded image 8-(4-chloro-2- fluorophenyl)-3- methyl-6-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pyrido [2,3-b]pyrazine (4-chloro-2- fluorophenyl) boronic acid (S)-4-(8-chloro- 3- methylpyrido[2,3- b]pyrazin-6- yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Intermediate 101) 160 embedded image 8-(4-chloro-2- fluorophenyl)-2,3- dimethyl-6-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl)pyrido [2,3-b]pyrazine (4-chloro-2- fluorophenyl) boronic acid (S)-4-(8-chloro- 2,3- dimethylpyrido [2,3-b]pyrazin-6- yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Intermediate 102) 161 embedded image 8-(2,4- difluorophenyl)- 2,3-dimethyl-6- ((2S)-2-(1-methyl- 1H-pyrazol-4-yl)-4- morpholinyl)pyrido [2,3-b]pyrazine (4-chloro-2- fluorophenyl) boronic acid (S)-4-(8-chloro- 2,3- dimethylpyrido [2,3-b]pyrazin-6- yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Intermediate 102) 162 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S)-2- (1-methyl-1H- pyrazol-4-yl)-4- morpholinyl) quinoxaline (4-chloro-2- fluorophenyl) boronic acid (S)-4-(8-chloro- 2,3- dimethylquinoxalin- 6-yl)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Intermediate 104) 163 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S)-2- (2-methyl-4- pyridinyl)-4- morpholinyl) quinoxaline (4-chloro-2- fluorophenyl) boronic acid (S)-4-(8-chloro- 2,3- dimethylquinoxalin- 6-yl)-2-(2- methylpyridin- 4-yl)morpholine (Intermediate 103) 164 embedded image 5-(2,4- difluorophenyl)- 2,3-dimethyl-7- ((2S)-2-(1-methyl- 1H-pyrazol-4-yl)-4- morpholinyl) quinoxaline (2,4- difluorophenyl) boronic acid (S)-4-(8-chloro- 2,3- dimethylquinoxalin- 6-yl)-2-(1- methyl-1H- pyrazol-4- yl)morpholine (Intermediate 104)

Method 7

Example 165; 4-(trans-4-chlorocyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(861) ##STR01529##

Step 1; (2S)-4-(4-(4-((tert-butyldimethylsilyl)oxy)cyclohex-1-en-1-yl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine

(862) To a 50-mL round-bottomed flask was added 4-(4-((tert-butyldimethylsilyl)oxy)cyclohex-1-en-1-yl)-2-chloro-6,7-dimethylpteridine (Intermediate 50) (0.35 g, 0.864 mmol) and (S)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (Enamine, Monmouth Jct., N.J., USA) (0.159 g, 0.951 mmol) in DMSO (20 mL), and N-ethyl-N-isopropylpropan-2-amine (0.223 g, 1.728 mmol). The reaction was stirred at 100° C. for 2 h (monitored by TLC) then diluted with H.sub.2O (30 mL) and extracted with DCM (3×50 mL). The combined organic layers were washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and concentrated to give a yellow oil. The crude material was purified by silica gel chromatography (1% to 3% MeOH in DCM) to provide (2S)-4-(4-(4-((tert-butyldimethylsilyl)oxy)cyclohex-1-en-1-yl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.3 g, 0.560 mmol, 64.8% yield) as a yellow oil.

Step 2; (S)-4-(4-(4-((tert-butyldimethylsilyl)oxy)cyclohexyl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine

(863) To a 10-mL round-bottomed flask was added (2S)-4-(4-(4-((tert-butyldimethylsilyl)oxy)cyclohex-1-en-1-yl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.05 g, 0.093 mmol) in 1-butanol (1.5 mL). The reaction mass was flushed under N.sub.2 for 15 min. then to this was added palladium(II) hydroxide (0.013 g, 0.093 mmol) and the reaction was stirred at 80° C. for 4 h. The reaction mixture was filtered through celite and the filtrate diluted with H.sub.2O (3 mL) and extracted with DCM (2×5 mL). The combined organic layers were dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure to obtain (S)-4-(4-(4-((tert-butyldimethylsilyl)oxy)cyclohexyl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.030 g, 0.056 mmol, 59.8% yield) as a light yellow material that was used in the next step without further purification.

Step 3; (S)-4-(6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pteridin-4-yl)cyclohexan-1-ol

(864) To a 50-mL round-bottomed flask was added (S)-4-(4-(4-((tert-butyldimethylsilyl)-oxy)cyclohexyl)-6,7-dimethylpteridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.28 g, 0.521 mmol) in THF (5 mL). The reaction mixture was cool to 0° C. and a solution of HCl in dioxane (1.302 mL, 5.21 mmol) was added drop-wise. The reaction was allowed to warm to RT and stirred for 1.5 h (monitored by LCMS). After completion of the reaction, H.sub.2O (10 mL) was added and extracted with DCM (15 mL×2). The combined organic layers were dried over a generous amount of Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to obtain crude compound. The crude material was absorbed onto a plug of silica gel and purified by chromatography through a Redi-Sep pre-packed silica gel column (4 g), eluting with 100% EtOAc, to provide (S)-4-(6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pteridin-4-yl)cyclohexan-1-ol (0.15 g, 0.354 mmol, 68.0% yield) as a yellow oil that was used in the next step without further purification.

Step 4; 4-(trans-4-chlorocyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine

(865) To a 100-mL round-bottomed flask was added (S)-4-(6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pteridin-4-yl)cyclohexan-1-ol (0.150 g, 0.354 mmol) and perchloroethane (1.677 g, 7.08 mmol) followed by addition of tetrabutylammonium iodide (0.654 g, 1.771 mmol) and triphenylphosphine (0.464 g, 1.771 mmol) in 1,2-dichloroethane (20 mL). The reaction was stirred at 60° C. for 5 h (monitored by LCMS). After completion, the reaction mixture was allowed to cool to room temperature, poured into H.sub.2O and extracted with DCM (2×30 mL). The organic extract was washed with sat. NaCl (50×mL) and dried over Na.sub.2SO.sub.4. The solution was concentrated to give the crude material as a yellow oil. The crude material was purified by silica gel chromatography (40% of EtOAc in Petroleum ether) to provide crude product which was further purified by preparative HPLC to provide 4-(trans-4-chlorocyclohexyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pteridine (0.017 g, 0.038 mmol, 10.86% yield) (7:2 mixture of isomers) as light yellow colored solid. .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.76 (s, 1H), 7.47 (d, J=3.3 Hz, 1H), 5.79 (s, 2H), 4.59-4.80 (m, 2H), 4.51 (dt, J=10.2, 2.4 Hz, 2H), 3.19-3.24 (s, 3H), 3.91-4.10 (m, 2H), 3.78 (s, 2H), 2.54-2.73 (m, 6H), 2.15-2.7 (m, 1H), 2.17-2.38 (m, 3H), 1.71-1.98 (m, 3H). m/z (ESI, +ive ion); 442.3 (M+H).sup.+.

Method 8

Example 166; 4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pyrido[2,3-d]pyrimidine and

Example 167; 4-(2,4-difluorophenyl)-7-ethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pyrido[2,3-d]pyrimidine

(866) ##STR01530##

(867) To a 5 mL vial were added (S)-4-amino-6-(2,4-difluorophenyl)-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pyrimidine-5-carbaldehyde (Intermediate 105) (2, 0.164 g, 0.410 mmol, 125891-11-1), methyl ethyl ketone (0.410 mL) and ground KOH (0.023 g, 0.410 mmol). The reaction mixture was stirred overnight at RT. H.sub.2O was added and the aqueous phase was neutralized with HCl (1N) and extracted with DCM (phase separator). The solvent was concentrated under vacuum and the crude product purified by silica gel chromatography (0-10% MeOH (+1% NH.sub.3) in DCM) to afford;

4-(2,4-difluorophenyl)-6,7-dimethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pyrido[2,3-d]pyrimidine

(868) (0.0502 g, 0.115 mmol, 28.0% yield). .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.75 (s, 1H), 7.71 (dt, J=6.62, 8.37 Hz, 1H), 7.59 (br dd, J=0.78, 3.11 Hz, 1H), 7.50 (ddd, J=2.59, 9.47, 10.25 Hz, 1H), 7.46 (s, 1H), 7.32 (dt, J=2.08, 8.43 Hz, 1H), 4.67-4.83 (m, 1H), 4.60 (br d, J=13.49 Hz, 1H), 4.52 (br dd, J=2.47, 10.51 Hz, 1H), 3.93-4.08 (m, 1H), 3.82 (s, 3H), 3.59-3.73 (m, 1H), 3.11-3.25 (m, 2H), 2.57 (s, 3H), 2.30 (s, 3H). m/z (ESI, +ive ion); 437.0 (M+H).sup.+.

4-(2,4-difluorophenyl)-7-ethyl-2-((2S)-2-(1-methyl-1H-pyrazol-4-yl)-4-morpholinyl)pyrido[2,3-d]pyrimidine

(869) (0.0447 g, 0.102 mmol, 24.9% yield). .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.81 (dd, J=8.3, 3.2 Hz, 1H), 7.69-7.78 (m, 2H), 7.48-7.54 (m, 1H), 7.46 (s, 1H), 7.32 (td, J=8.4, 2.5 Hz, 1H), 7.19 (d, J=8.4 Hz, 1H), 4.70-4.84 (m, 1H), 4.64 (br d, J=13.9 Hz, 1H), 4.52 (dd, J=10.3, 2.3 Hz, 1H), 4.01 (br d, J=13.0 Hz, 1H), 3.82 (s, 3H), 3.60-3.72 (m, 1H), 3.13-3.27 (m, 2H), 2.88 (q, J=7.6 Hz, 2H), 1.29 (t, J=7.5 Hz, 3H). m/z (ESI, +ive ion); 437.2 (M+H).sup.+.

(870) TABLE-US-00008 TABLE 5 Compounds 168 to 169 were prepared following the procedure described in Method 8, as follows: Ex # Structure Name Starting Material 168 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S)-2- (2-methyl-4-pyridinyl)- 4- morpholinyl)pyrido[2,3- d]pyrimidine (S)-4-amino-6-(2,4- difluorophenyl)-2-(2- (2-methylpyridin-4- yl)morpholino) pyrimidine- 5-carbaldehyde (Intermediate 106) 169 embedded image 2-((2S)-2-(1- cyclopropyl-1H-pyrazol- 4-yl)-4-morpholinyl)-4- (2,4-difluorophenyl)-6,7- dimethylpyrido[2,3- d]pyrimidine (S)-4-amino-2-(2-(1- cyclopropyl-1H- pyrazol-4- yl)morpholino)-6- (2,4- difluorophenyl) pyrimidine- 5-carbaldehyde (Intermediate 107)

Method 9

Example 170; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-7-methylpteridine

(871) ##STR01533##

Step 1; 4-(4-chloro-2-fluorophenyl)-2-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-7-methylpteridine

(872) To a 50 mL round-bottomed flask was added 2-chloro-4-(4-chloro-2-fluorophenyl)-7-methylpteridine (Intermediate 13) (600 mg, 1.857 mmol) and 1-cyclopropyl-4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydro-2H-pyran-2-yl)-1H-pyrazole (Intermediate 80) (881 mg, 2.79 mmol) in dioxane; H.sub.2O (9 mL, 5:1 v/v) followed by addition of potassium carbonate (513 mg, 3.71 mmol). The reaction was flushed under N.sub.2 for 10 min. and PdCl.sub.2(dppf)-DCM adduct (227 mg, 0.279 mmol) was added and the reaction stirred at 70° C. for 3 h. The reaction was filtered through celite, the pad washed with ethyl acetate (40 mL) and the filtrate was concentrated under reduced pressure to obtain crude product. Silica gel chromatography (70% EtOAc in Hexane) followed by trituration with 2 mL DCM in 50 mL Hexane provided 4-(4-chloro-2-fluorophenyl)-2-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-7-methylpteridine (350 mg, 0.734 mmol, 39.5% yield) as off white solid. .sup.1H NMR (400 MHz, DMSO-d6) δ 7.81 (s, 2H), 7.79 (s, 1H), 7.42 (s, 3H), 3.99 (s, 1H), 2.81 (d, J=4.6 Hz, 3H), 2.69 (d, J=4.6 Hz, 3H) 1.01 (s, 3H), 0.92 (t, J=1.0 Hz, 6H). m/z (ESI, +ive ion); 477.1 (M+H).sup.+.

Step 2; 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-7-methylpteridine

(873) To a round bottomed flask (25 mL) was added 4-(4-chloro-2-fluorophenyl)-2-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-7-methylpteridine (20 mg, 0.043 mmol) and 1,1′-bis(di-1-propylphosphino)ferrocene(1,5-cyclooctadiene)rhodium(I) tetrafluoroborate (20 mg, 0.043 mmol) in THF (10 mL). The reaction mixture was stirred at 14 psi pressure and monitored by TLC (EtOAc/Pet Ether mixtures). Upon reaction completion the mixture was filtered through celite and washed with ethyl acetate (10 ml). The filtrate was concentrated under reduced pressure to obtain crude material which was purified by silica gel chromatography, and eluted with 80% EtOAc in hexane, to provide a mixture of cis and trans isomers 4-(4-chloro-2-fluorophenyl)-2-(2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-7-methylpteridine (10 mg, 0.022 mmol, 49.8% yield) as brown gum. The racemic mixture was purified by chiral SFC (Chiralpak AD-H 2×15 cm, 5 um column, 30% EtOH, F=120 mL/min) to provide the title compound (first eluting peak) 4-(4-chloro-2-fluorophenyl)-2-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-7-methylpteridine (6 mg, 0.013 mmol, 14% yield; absolute stereochemistry was arbitrarily assigned; relative stereochemistry (cis/trans) determined by NMR), as well as other (impure) isomers. .sup.1H NMR (400 MHz, DMSO-d6) δ 9.00 (s, 1H), 7.78-7.84 (m, 1H), 7.74 (s, 1H), 7.70 (d, J=9.9 Hz, 1H), 7.55 (d, J=8.3 Hz, 1H), 7.40 (s, 1H), 4.53 (d, J=9.9 Hz, 1H), 4.16-4.08 (m, 1H), 3.74-3.62 (m, 2H), 3.56-3.45 (m, 1H), 2.82 (s, 3H), 2.31 (d, J=13.2 Hz, 1H), 2.08 (d, J=13.1 Hz, 1H), 1.87-1.99 (m, 2H), 1.06-0.96 (m, 2H), 0.94-0.83 (m, 2H), m/z (ESI, +ive ion); 465.2 (M+H).sup.+.

(874) TABLE-US-00009 TABLE 6 Compounds 171 to 203 were prepared following the procedure described in Method 9, as follows: Ex Starting Starting # Structure Name Material 1 Material 2 171 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2R,4S)-2- (2-methyl-4- pyridinyl)tetrahydro- 2H-pyran-4- yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 2-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2- yl)pyridine (Intermediate 81) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13) 172 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S,4R)-2- (2-methyl-4- pyridinyl)tetrahydro- 2H-pyran-4- yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 2-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2- yl)pyridine (Intermediate 81) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13) 173 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2R,4S)-2- (2-methyl-5- pyrimidinyl)tetrahydro- 2H-pyran-4- yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 2-methyl-5- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2- yl)pyrimidine (Intermediate 82) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13) 174 embedded image 4-(4-chloro-2- fluorophenyl)-7- methyl-2-((2S,4R)-2- (2-methyl-5- pyrimidinyl)tetrahydro- 2H-pyran-4- yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 2-methyl-5- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2- yl)pyrimidine (Intermediate 82) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpteridine (Intermediate 13) 175 embedded image 4-(4,4- difluorocyclohexyl)- 6,7-dimethyl-2- ((2S,4R)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4- (4,4- difluorocyclohex- 1-en-1-yl)- 6,7- dimethylpteridine (Intermediate 49) 176 embedded image 4-(4,4- difluorocyclohexyl)- 6,7-dimethyl-2- ((2R,4S)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4- (4,4- difluorocyclohex- 1-en-1-yl)- 6,7- dimethylpteridine (Intermediate 49) 177 0embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 178 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 179 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4R)- 2-(1-methyl-1H- pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pteridine 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 180 embedded image 4-(4-chloro-2- fluorophenyl)-2- ((2S,4R)-2-(1- cyclopropyl-1H- pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)-6,7- dimethylpteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1- cyclopropyl- 4-(4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 80) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 181 embedded image 4-(4-chloro-2- fluorophenyl)-2- ((2R,4S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)-6,7- dimethylpteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1- cyclopropyl- 4-(4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 80) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpteridine (Intermediate 16) 182 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2- ((2R,4S)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpteridine (Intermediate 17) 183 embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpteridine (Intermediate 19) 184 embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2S,4R)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpteridine (Intermediate 19) 185 embedded image 8-(4-chloro-2- fluorophenyl)-3- methyl-6-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 6-chloro-8-(4- chloro-2- fluorophenyl)- 3- methylpyrido[2,3- b]pyrazine (Intermediate 28) 186 embedded image 8-(4-chloro-2- fluorophenyl)-2,3- dimethyl-6-((2S,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 6-chloro-8-(4- chloro-2- fluorophenyl)- 2,3- dimethylpyrido [2,3-b]pyrazine (Intermediate 29) 187 0embedded image 8-(4-chloro-2- fluorophenyl)-2,3- dimethyl-6-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 6-chloro-8-(4- chloro-2- fluorophenyl)- 2,3- dimethylpyrido [2,3-b]pyrazine (Intermediate 29) 188 embedded image 8-(2,4-difluorophenyl)- 2,3-dimethyl-6- ((2R,4S)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 6-chloro-8- (2,4- difluorophenyl)- 2,3- dimethylpyrido [2,3-b]pyrazine (Intermediate 30) 189 embedded image 8-(2-fluoro-4- methylphenyl)-2,3- dimethyl-6-((2S,4R)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 6-chloro-8-(2- fluoro-4- methylphenyl)- 2,3- dimethylpyrido [2,3-b]pyrazine (Intermediate 31) 190 embedded image 8-(2-fluoro-4- methylphenyl)-2,3- dimethyl-6-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 6-chloro-8-(2- fluoro-4- methylphenyl)- 2,3- dimethylpyrido [2,3-b]pyrazine (Intermediate 31) 191 embedded image 5-(4-chloro-2- fluorophenyl)-2- methyl-7-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2- methylpyrido[3,4- b]pyrazine (Intermediate 32) 192 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2,3- dimethylpyrido [3,4-b]pyrazine (Intermediate 33) 193 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S,4R)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2,3- dimethylpyrido [3,4-b]pyrazine (Intermediate 33) 194 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 7-chloro-5-(4- chloro-2- fluorophenyl)- 2,3- dimethylpyrido [3,4-b]pyrazine (Intermediate 33) 195 embedded image 5-(2,4-difluorophenyl)- 2,3-dimethyl-7- ((2R,4S)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 7-chloro-5- (2,4- difluorophenyl)- 2,3- dimethylpyrido [3,4-b]pyrazine (Intermediate 34) 196 embedded image 5-(2-fluoro-4- methylphenyl)-2,3- dimethyl-7-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 7-chloro-5-(2- fluoro-4- methylphenyl)- 2,3- dimethylpyrido [3,4-b]pyrazine (Intermediate 35) 197 0embedded image 4-(4-chloro-2- fluorophenyl)-2- ((2R,4S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)-7- methylpyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1- cyclopropyl- 4-(4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 80) 2-chloro-4-(4- chloro-2- fluorophenyl)- 7- methylpyrido[2,3- d]pyrimidine (Intermediate 37) 198 embedded image 4-(4-chloro-2- fluorophenyl)-2- ((2S,4R)-2-(1- cyclopropyl-1H- pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)-6,7- dimethylpyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1- cyclopropyl- 4-(4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 80) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 199 embedded image 4-(4-chloro-2- fluorophenyl)-2- ((2R,4S)-2-(1- cyclopropyl-1H- pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)-6,7- dimethylpyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1- cyclopropyl- 4-(4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 80) 2-chloro-4-(4- chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 200 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2- ((2S,4R)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 41) 201 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2- ((2R,4S)-2-(1-methyl- 1H-pyrazol-4- yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 41) 202 embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2S,4R)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 42) 203 embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2R,4S)-2- (1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry (cis/trans) determined by NMR. 1-methyl-4- (4-(4,4,5,5- tetramethyl- 1,3,2- dioxaborolan- 2-yl)-5,6- dihydro-2H- pyran-2-yl)- 1H-pyrazole (Intermediate 79) 2-chloro-4-(2- fluoro-4- methylphenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 42)

Method 10

Example 204; 6,7-dimethyl-2-((2R,4R)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine; and

Example 205; 6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine

(875) ##STR01567##

(876) To a 10 mL vial was added xantphos Pd G3 (1.46 mg, 0.023 mmol) and 2-chloro-6,7-dimethyl-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine (Intermediate 59) (89.6 mg, 0.283 mmol). The vial was evacuated and filled with N.sub.2 3 times. 0.2 mL THF was added followed by (2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)zinc(II) bromide (Intermediate 74, 1476 μL, 0.339 mmol). The mixture was stirred at 50° C. for 5 h, and the suspension became a brown solution. The mixture was concentrated, DCM was added, and the mixture quenched with H.sub.2O and 2N HCl. The aqueous layer was extracted with DCM, and the combined organics were concentrated. Silica gel chromatography (2%-60% EtOAc/EtOH 3/1 blend in 10% DCM in Heptane) afforded 6,7-dimethyl-2-(2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine (28 mg, 0.063 mmol, 22.17% yield) as a mixture of diastereomers. The mixture was purified by SFC (Chiralpak IG 2×25 cm, 5 μm column; 30% EtOH, F=80 mL/min) to provide 2 of 4 possible diastereomers;

(877) Peak 1; 6,7-dimethyl-2-((2R,4R)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine (3.45 mg, ee >99%). .sup.1H NMR (Chloroform-d, 400 MHz) δ 7.5-7.6 (m, 1H), 7.42 (s, 1H), 4.9-5.0 (m, 2H), 3.9-4.0 (m, 5H), 3.69 (quin, 1H, J=5.5 Hz), 3.1-3.3 (m, 1H), 2.6-2.8 (m, 11H), 2.4-2.6 (m, 1H), 2.3-2.4 (m, 1H), 2.1-2.3 (m, 1H). m/z (ESI, +ive ion); 447.0 (M+H).sup.+. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR.

(878) Peak 2; 6,7-dimethyl-2-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-4-(trans-3-(trifluoromethyl)cyclobutyl)pteridine (9.83 mg, ee >99%) .sup.1H NMR (Chloroform-d, 400 MHz) δ 7.54 (s, 1H), 7.44 (s, 1H), 4.91 (quin, 1H, J=8.1 Hz), 4.60 (dd, 1H, J=1.8, 11.4 Hz), 4.3-4.3 (m, 1H), 3.8-3.9 (m, 4H), 3.4-3.6 (m, 1H), 3.1-3.3 (m, 1H), 2.82 (s, 3H), 2.6-2.8 (m, 7H), 2.45 (br d, 1H, J=13.4 Hz), 2.1-2.3 (m, 3H). m/z (ESI, +ive ion); 447.0 (M+H).sup.+. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR.

(879) TABLE-US-00010 TABLE 7 Compounds 206 to 230 were prepared following the procedure described in Method 10, as follows: Ex Starting Starting # Structure Name Material 1 Material 2 206 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethyl- pteridine (Intermediate 16) 207 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4S)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethyl- pteridine (Intermediate 16) 208 0embedded image 4-(4-chloro-2- fluorophenyl)-2-((2R,4S)- 2-(2-methoxy-4- pyridinyl)tetrahydro-2H- pyran-4-yl)-6,7- dimethylpteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methoxypyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 76) 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethyl- pteridine (Intermediate 16) 209 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4S)-2-(2- methyl-5- pyrimidinyl)tetrahydro- 2H-pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyrimidin- 5-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 77) 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethyl- pteridine (Intermediate 16) 210 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S,4R)- 2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluoro- phenyl)-6,7- dimethyl- pteridine (Intermediate 17) 211 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2R,4S)- 2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluoro- phenyl)-6,7- dimethyl- pteridine (Intermediate 17) 212 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S,4S)-2- (2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluoro- phenyl)-6,7- dimethyl- pteridine (Intermediate 17) 213 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2R,4R)- 2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluoro- phenyl)-6,7- dimethyl- pteridine (Intermediate 17) 214 embedded image 6,7-dimethyl-2-((2S,4R)- 2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)-4-(trans-3- (trifluoromethyl)cyclobutyl) pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoro- methyl)cyclo- butyl)pteridine (Intermediate 59) 215 embedded image 6,7-dimethyl-2-((2R,4S)- 2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)-4-(trans-3- (trifluoromethyl)cyclobutyl) pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-6,7- dimethyl-4- ((trans)-3- (trifluoro- methyl)cyclo- butyl)pteridine (Intermediate 59) 216 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4S,6R)-2- methyl-6-(1-methyl-1H- pyrazol-4-yl)tetrahydro- 2H-pyran-4-yl)pteridine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-methyl-6-(1- methyl-1H- pyrazol-4- yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 78) 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethyl- pteridine (Intermediate 16) 217 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2S,4R)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 7-chloro-5- (4-chloro-2- fluorophenyl)- 2,3- dimethyl- pyrido[3,4- b]pyrazine (Intermediate 33) 218 0embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2R,4S)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 7-chloro-5- (4-chloro-2- fluorophenyl)- 2,3- dimethyl- pyrido[3,4- b]pyrazine (Intermediate 33) 219 embedded image 4-(4-chloro-2- fluorophenyl)-7-methyl-2- ((2R,4R)-2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (4-chloro-2- fluorophenyl)- 7- methylpyrido [2,3- d]pyrimidine (Intermediate 37) 220 embedded image 4-(4-chloro-2- fluorophenyl)-7-methyl-2- ((2S,4S)-2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (4-chloro-2- fluorophenyl)- 7- methylpyrido [2,3- d]pyrimidine (Intermediate 37) 221 embedded image 4-(2,4-difluorophenyl)-7- methyl-2-((2S,4S)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluoro- phenyl)-7- methylpyrido [2,3- d]pyrimidine (Intermediate 38) 222 embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2R,4S)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry7 arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2-fluoro-4- methylphenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 42) 223 embedded image 4-(2-fluoro-4- methylphenyl)-6,7- dimethyl-2-((2S,4R)-2-(2- methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2-fluoro-4- methylphenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 42) 224 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4S)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. 2-(1-methyl-1H- pyrazol-4- yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 225 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. 2-(1-methyl-1H- pyrazol-4- yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 226 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. 2-(1-methyl-1H- pyrazol-4- yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 227 embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2S,4S)-2- (2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 41) 228 0embedded image 4-(2,4-difluorophenyl)- 6,7-dimethyl-2-((2R,4R)- 2-(2-methyl-4- pyridinyl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-(2- methylpyridin- 4-yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 75) 2-chloro-4- (2,4- difluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 41) 229 embedded image 4-(4-chloro-2- fluorophenyl)-6,7- dimethyl-2-((2R,4S,6R)-2- methyl-6-(1-methyl-1H- pyrazol-4-yl)tetrahydro- 2H-pyran-4-yl)pyrido[2,3- d]pyrimidine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-methyl-6-(1- methyl-1H- pyrazol-4- yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 78) 2-chloro-4- (4-chloro-2- fluorophenyl)- 6,7- dimethylpyrido [2,3- d]pyrimidine (Intermediate 40) 230 embedded image 5-(4-chloro-2- fluorophenyl)-2,3- dimethyl-7-((2R,4S,6R)-2- methyl-6-(1-methyl-1H- pyrazol-4-yl)tetrahydro- 2H-pyran-4-yl)pyrido[3,4- d]pyrazine. Absolute stereochemistry arbitrarily assigned. Relative stereochemistry determined by NMR. (2-methyl-6-(1- methyl-1H- pyrazol-4- yl)tetrahydro- 2H-pyran-4- yl)zinc(II) bromide (Intermediate 78) 7-chloro-5- (4-chloro-2- fluorophenyl)- 2,3- dimethylpyrido [3,4- d]pyrazine (Intermediate 33)

Example 231; (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-(7-methyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridin-2-yl)morpholine

(880) ##STR01593##

(881) Into a 1 dram vial was weighed 2-chloro-7-methyl-4-(3-trifluoromethyl) bicyclo[1.1.1]pentan-1-yl)pteridine (43.4 mg, 0.138 mmol, Intermediate 108) and (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)morpholine (32.0 mg, 0.165 mmol, Intermediate 109). The vial was fitted with a stirring bar and acetonitrile (690 μL) was added followed by N,N-diisopropylethylamine (53.5 mg, 72.3 μL, 0.414 mmol, Sigma-Aldrich Corporation). The mixture was left to stir at 24° C. and was monitored over time by LCMS. After sufficient conversion was observed, the reaction was terminated and the crude product was isolated and purified as described in Method 1 to afford (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)-4-(7-methyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridin-2-yl)morpholine (22.5 mg, 0.0478 mmol, 35% yield) .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.53-8.56 (m, 1H), 7.84 (s, 1H), 7.47 (s, 1H), 4.76 (br d, J=12.53 Hz, 1H), 4.62 (br s, 1H), 4.49 (dd, J=10.35, 2.72 Hz, 1H), 3.98-4.05 (m, 1H), 3.68-3.73 (m, 1H), 3.60-3.68 (m, 1H), 3.14-3.25 (m, 1H), 2.63 (s, 3H), 2.57 (s, 6H), 1.19-1.32 (m, 1H), 0.93-1.05 (m, 5H). m/z (ESI, +ive ion); 472.0 (M+H).sup.+.

Example 232; (S)-4-(7-methyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridin-2-yl)-2-(2-methylpyridin-4-yl)morpholine

(882) ##STR01594##

(883) Into a 1 dram vial was weighed 2-chloro-7-methyl-4-(3-trifluoromethyl) bicyclo[1.1.1]pentan-1-yl)pteridine (43.4 mg, 0.138 mmol, Intermediate 108) and (S)-2-(2-methylpyridin-4-yl)morpholine (29.5 mg, 0.165 mmol, Syngene). The vial was fitted with a stirring bar and acetonitrile (690 μL) was added followed by N,N-diisopropylethylamine (53.5 mg, 72.3 μL, 0.414 mmol, Sigma-Aldrich Corporation). The mixture was left to stir at 24° C. and was monitored over time by LCMS. After sufficient conversion was observed, the reaction was terminated and the crude product was isolated and purified as described in Method 1 to afford (S)-4-(7-methyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridin-2-yl)-2-(2-methylpyridin-4-yl)morpholine (11.7 mg, 0.0256 mmol, 18.5% yield). .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.56 (s, 1H), 8.43-8.51 (m, 1H), 7.35 (s, 1H), 7.25-7.32 (m, 1H), 4.87 (br d, J=11.63 Hz, 1H), 4.61 (br dd, =10.44, 2.45 Hz, 1H), 4.15 (br dd, J=11.90, 2.27 Hz, 1H), 3.68-3.77 (m, 1H), 2.98-3.10 (m, 1H), 2.64 (s, 3H), 2.58 (s, 5H), 2.52-2.53 (m, 1H), 2.43-2.49 (m, 1H), 0.97-1.07 (m, 1H). m/z (ESI, +ive ion); 457.0 (M+H).sup.+.

Method 37

Example 309; 6,7-dimethyl-2-((2R,4S)-2-(2-methylpyridin-4-yl)tetrahydro-2H-pyran-4-yl)-4-(6-(trifluoromethyl)pyridin-3-yl)pteridine

(884) ##STR01595##

(885) A flame-dried microwave vial under argon was charged with 2-chloro-6,7-dimethyl-4-(6-(trifluoromethyl)pyridin-3-yl)pteridine (105 mg, 308 μmol), CPhos (25.8 mg, 59.0 μmol) and THF (2.70 mL). The reaction mixture was degassed for 5 min with argon then ((2S,4S)-2-(2-methylpyridin-4-yl)tetrahydro-2H-pyran-4-yl)zinc(II) bromide (1.54 mL, 384 μmol) was added dropwise. The reaction vial was sealed and immersed in a pre-heated oil bath at 60° C. The reaction was stirred overnight at 60° C. When the conversion was judged complete by LCMS, the reaction mixture was cooled down to r.t., diluted with EtOAc (5 mL) and passed through a silica pad (1 cm). The silica was rinsed with EtOAc (10 mL) followed by 10% MeOH in CH.sub.2Cl.sub.2. The volatiles were removed in vacuo and the crude material was purified by flash chromatography (Isco RediSep® column 24g, using a gradient from 50% EtOAc in CH.sub.2Cl.sub.2 to 100% EtOAc followed by 5 CV at 10% MeOH in CH.sub.2Cl.sub.2). The selected fractions were evaporated to yield the desired 6,7-dimethyl-2-((2R,4S)-2-(2-methylpyridin-4-yl)tetrahydro-2H-pyran-4-yl)-4-(6-(trifluoromethyl)pyridin-3-yl)pteridine (57.2 mg, 39%). LCMS; m/z (ESI) [M+H].sup.+ 481.20, t.sub.R=1.302 min. .sup.1H NMR Major dia. (DMSO-d.sub.6, 400 MHz); δ.sub.H 1.77 (1H, q, J=12.2 Hz), 2.06-1.93 (1H, m), 2.16 (1H, d, J=13.1 Hz), 2.44 (3H, s), 2.73 (3H, s), 2.78 (3H, s), 3.59 (1H, t, J=11.6 Hz), 3.80 (1H, t, J=11.8 Hz), 4.25 (1H, dd, J=11.3, 4.2 Hz), 4.62 (1H, d, J=11.2 Hz), 7.19 (1H, d, J=5.3 Hz), 7.27 (1H, s), 8.15 (1H, d, J=8.3 Hz), 8.37 (1H, d, J=5.3 Hz), 8.90 (1H, d, J=8.2 Hz), 9.59 (1H, s).

Method 38

Example 394; 4-(4-chloro-2,3-difluorophenyl)-7-methyl-2-((2R,4S)-2-(2-methylpyridin-4-yl)tetrahydro-2H-pyran-4-yl)pteridine

(886) ##STR01596##

(887) In a flame-dried 50 mL microwave vial, 2-chloro-4-(4-chloro-2,3-difluoro-phenyl)-7-methyl-pteridine (100 mg, 0.306 mmol), palladium acetate (6.9 mg, 0.0306 mmol), C-Phos (0.200 eq, 27 mg, 0.0611 mmol) and THF (3.5 mL) were added. The reaction mixture was degassed for 5 min under N.sub.2 and bromo-[2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]zinc bromide solution (0.17 M in THF) (1.8 mL, 0.3057 mmol) was added dropwise over 30 min. The mixture was stirred at 22° C. for 2 h. The reaction was quenched by addition of sat. NaHCO.sub.3 (20 mL) and the reaction mixture was extracted with DCM (50 mL). The aqueous layer was extracted with DCM (2×50 mL). The combined organic layer was dried over Na.sub.2SO.sub.4 and the solvent was removed in vacuo. The crude material was purified by flash chromatography (Isco RediSep® column 40 g) using EtOAc and hexanes (0-100%) then using MeOH and DCM (0-10%) to obtain a solid (100 mg) which was further purified by prep HPLC (Gemini® 5 μm NX-C18 110 Å, 100×30 mm column) using MeOH and aqueous 10 mM ammonium formate to obtain 4-(4-chloro-2,3-difluoro-phenyl)-7-methyl-2-[rac-(2R,4S)-2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]pteridine as a mixture of cis distereomers (32.3 mg, 22%) and 4-(4-chloro-2,3-difluoro-phenyl)-7-methyl-2-[rac-(2R,4R)-2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]pteridine as a mixture of trans distereomers (2.8 mg, 2%). C is isomers; ESI-MS (m/z+); 468.20 [M+H].sup.+, LC-RT; 1.307 min. .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ 8.81 (s, 1H), 8.41 (s, 1H), 7.50-7.45 (m, 1H), 7.43-7.37 (m, 1H), 7.23 (s, 1H), 7.13 (d, J=4.6 Hz, 1H), 4.55 (d, J=11.5 Hz, 1H), 4.34 (dd, J=10.6, 3.8 Hz, 1H), 3.84 (td, J=11.7, 3.2 Hz, 1H), 3.66-3.57 (m, 1H), 2.86 (s, 3H), 2.51 (s, 3H), 2.47-2.40 (m, 1H), 2.25-2.13 (m, 2H), 2.01-1.90 (m, 1H). .sup.19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm−133.01 (s), −138.66 (s). Trans isomers; .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.85 (s, 1H), 8.42 (d, J=5.5 Hz, 1H), 7.56-7.51 (m, 1H), 7.46-7.38 (m, 1H), 7.21 (s, 1H), 7.12 (d, J=4.7 Hz, 1H), 4.78 (dd, J=9.6, 2.4 Hz, 1H), 4.04-3.97 (m, 1H), 3.90 (td, J=11.3, 2.5 Hz, 1H), 3.76-3.71 (m, 1H), 2.89 (s, 3H), 2.52 (s, 3H), 2.52 (s, 2H), 2.30-2.24 (m, 1H), 2.22-2.16 (m, 1H).

Method 39

Examples 392; 7-((2R,4S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-2,3-dimethyl-5-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pyrido[3,4-b]pyrazine

(888) ##STR01597##

(889) Step 1; To a solution of 7-chloro-2,3-dimethyl-5-[3-(trifluoromethyl)-1-bicyclo[1.1.1]pentanyl]pyrido[3,4-b]pyrazine (490 mg, 1.50 mmol, Intermediate 114) and 1-cyclopropyl-4-[(6R)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-3,6-dihydro-2H-pyran-6-yl]pyrazole (520 mg, 1.64 mmol) in 1,4-dioxane (10 mL) was added cesium carbonate (1461 mg, 4.49 mmol), water (1 mL) and Pd(dppf)Cl.sub.2 (109 mg, 0.150 mmol). The mixture was then stirred at 90° C. overnight. After completion, the mixture was cooled to rt, and diluted with EtOAc. The organic layer was then washed with water then brine and dried over MgSO.sub.4, filtered through a plug of silica, and concentrated in vacuo. The residue was then purified by flash chromatography using a DCM/EtOAc gradient (20%-100%) to afford the desired material (560 mg, 75%) as a light-yellow foam. .sup.1H NMR (400 MHz, Chloroform-d); δ ppm 7.69 (1H, s), 7.53 (1H, s), 7.50 (1H, s), 7.18 (1H, s), 5.42 (1H, d, J=2.9 Hz), 4.09-4.16 (1H, m), 3.93 (1H, m), 3.54-3.60 (1H, m), 2.74 (4H, s), 2.73 (3H, s), 2.67 (1H, m), 2.62 (6H, s), 1.10-1.13 (2H, m), 0.97-1.03 (2H, m).

(890) Step 2; To a flask under argon atmosphere containing 2,3-dimethyl-7-[(6R)-6-(1-cyclopropylpyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl]-5-[3-(trifluoromethyl)-1-bicyclo[1.1.1]pentanyl]pyrido[3,4-b]pyrazine (1.00 eq, 254 mg, 0.528 mmol) in ethanol (8 mL) was added PtO.sub.2 (0.710 eq, 85 mg, 0.374 mmol). The system was purged with hydrogen and stirred overnight under 1 atm of H.sub.2. When the reaction was judged complete by LCMS and .sup.1H NMR, the mixture was diluted with EtOAc and filtered through celite and evaporated. The crude material was used in the next step without further purification.

(891) Step 3; To a flask under argon atmosphere containing 2,3-dimethyl-7-[(2R,4S)-2-(1-cyclopropylpyrazol-4-yl)tetrahydropyran-4-yl]-5-[3-(trifluoromethyl)-1-bicyclo[1.1.1]pentanyl]-1,2,3,4-tetrahydropyrido[3,4-b]pyrazine (1.00 eq, 254 mg, 0.521 mmol) in DCE (5 mL) was added MnO.sub.2 (20.1 eq, 900 mg, 10.5 mmol). The reaction was then stirred overnight at 50° C. After completion, the mixture was cooled down to r.t., diluted with EtOAc and filtered through a plug of silica and the solvent was evaporated in vacuo. The residue was purified by column chromatography using a 35%-100% DCM/EtOAc gradient to afford the desired material as a 11:1 diastereomeric mixture. Further purification by reverse phase chromatography using a Gemini® 5 um NX-C18 110 Å, 100×30 mm column and a 55%-75% methanol/water (10 mm ammonium formate) gradient gave the desired material (113 mg, 45%) as a white solid after lyophilization. .sup.1H NMR (400 MHz, Chloroform-d); S ppm 7.54 (1H, s), 7.48 (2H, s), 4.55 (1H, d, J=11.2 Hz), 4.25 (1H, d, J=11.4 Hz), 3.84-3.78 (1H, m), 3.59-3.53 (1H, m), 3.22 (1H, m), 2.74 (3H, s), 2.73 (3H, s), 2.61 (6H, s), 2.30 (1H, d, J=13.1 Hz), 2.02-1.95 (3H, m), 1.10 (2H, m), 1.04-0.97 (2H, m). LCMS; m/z (ESI) [M+H].sup.+ 484.2

Method 40

Examples 346; 4-(5-(2,4-Difluorophenyl)-2,3-dimethyl-1,6-naphthyridin-7-yl)-2-(2-methylpyridin-4-yl)morpholine

(892) ##STR01598##

(893) Step 1; A 50 mL microwave vial was charged with (2,4-difluorophenyl)boronic acid (556 mg, 3.52 mmol), 5,7-dichloro-2,3-dimethyl-1,6-naphthyridine (800 mg, 3.52 mmol), cesium carbonate (3.44 g, 10.6 mmol), 1,4-dioxane (16 mL) and water (4.8 mL). The reaction mixture was degassed with nitrogen for 10 min. Pd(dppf)Cl.sub.2.Math.CH.sub.2Cl.sub.2 (144 mg, 0.176 mmol) was added, and the mixture was heated at 40° C. for 1 h. The mixture was cooled to r.t., and diluted with DCM (50 mL) and water (10 mL). The aqueous layer was extracted with DCM (2×25 mL). The combined organic layers were washed with brine (10 mL), dried (Na.sub.2SO.sub.4) and concentrated under reduced pressure. The residue was purified by silica gel chromatography (80 g SilicaSep cartridge) using EtOAc and hexanes (30-40%) to obtain 7-chloro-5-(2,4-difluorophenyl)-2,3-dimethyl-1,6-naphthyridine (660 mg, 2.17 mmol, 62%) as a solid. ESI-MS (m/z+); 305.1 [M+H].sup.+, LC-RT; 2.09 min. .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.92 (s, 1H), 7.70 (d, J=2.7 Hz, 1H), 7.62-7.53 (m, 1H), 7.13-7.05 (m, 1H), 7.04-6.95 (m, 1H), 2.73 (s, 3H), 2.43 (s, 3H). .sup.19F NMR (376 MHz, CDCl.sub.3) δ ppm−107.43 (s), −109.37 (s).

(894) Step 2; A mixture of 7-chloro-5-(2,4-difluorophenyl)-2,3-dimethyl-1,6-naphthyridine (50 mg, 0.164 mmol), 2-(2-methyl-4-pyridyl)morpholin-4-ium chloride (36 mg, 0.169 mmol), sodium tert-butoxide (63 mg, 0.658 mmol), and Pd(amphos)Cl.sub.2 (12 mg, 0.0164 mmol) in 10 mL microwave vial was subjected to three cycles of vacuum/nitrogen fill. 1,4-Dioxane (2.5 mL) was added, and the mixture was stirred at 80° C. for 5 h. The mixture was cooled to r.t., and diluted with EtOAc (50 mL) and water (20 mL). The layers were separated, and the aqueous layer was extracted with EtOAc (2×50 mL). The combined organic layers were washed with brine (10 mL), dried over Na.sub.2SO.sub.4, and concentrated in vacuo. The residue was purified by silica gel chromatography (SilicaSep® 24 g cartridge) using MeOH and dichloromethane (20-30%) to obtain an oil which was further purified by reverse phase chromatography on ACCQ prep HPLC (Gemini 150×30 mm C18 column) using acetonitrile and water (80-90%) to obtain 4-[5-(2,4-difluorophenyl)-2,3-dimethyl-1,6-naphthyridin-7-yl]-2-(2-methyl-4-pyridyl)morpholine (19 mg, 0.0410 mmol, 25%) as a yellow solid. ESI-MS (m/z+); 447.20 [M+H]+, LC-RT; 2,313 min. .sup.1H NMR (400 MHz, CD2Cl2) δ ppm 8.45 (d, J=5.2 Hz, 1H), 7.57-7.49 (m, 2H), 7.25 (s, 1H), 7.18 (d, J=5.1 Hz, 1H), 7.12-6.98 (m, 3H), 4.64 (dd, J=10.4, 2.5 Hz, 1H), 4.46 (d, J=12.4 Hz, 1H), 4.25-4.16 (m, 2H), 3.95-3.86 (m, 1H), 3.19-3.09 (m, 1H), 2.85 (dd, J=12.7, 10.6 Hz, 1H), 2.62 (s, 3H), 2.54 (s, 3H), 2.32 (s, 3H). .sup.19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm−109.71 (s), −110.69 (s).

Method 41

Examples 389 and 390; 4-(4-chloro-3,5-difluoro-phenyl)-6,7-dimethyl-2-[(2R,4S)-2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]pteridine and 4-(4-chloro-3,5-difluoro-phenyl)-6,7-dimethyl-2-[(2R,4R)-2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]pteridine

(895) ##STR01599##

(896) Step 1; A 100 mL round-bottom flask was charged with 2,4-dichloro-6,7-dimethyl-pteridine (3.00 g, 13.1 mmol) and THF (40 mL). The solution was cooled to −10° C. and a suspension of NaSMe (1.01 g, 14.4 mmol) in water (5 mL) was added dropwise. The reaction mixture was warmed to r.t. and stirred for 17 h. The mixture was diluted with DCM (50 mL) and water (10 mL). The aqueous layer was extracted with DCM (2×10 mL). Combined organic layers were dried over Na.sub.2SO.sub.4 and concentrated in vacuo. The crude residue was purified by silica gel chromatography (80 g SilicaSep column) using EtOAc and hexanes (50-60%) to obtain 2-chloro-6,7-dimethyl-4-methylsulfanyl-pteridine (1.92 g, 7.98 mmol, 61%) as a pale yellow solid. ESI-MS (m/z+); 241.0 [M+H].sup.+, LC-RT; 2.907 min. .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 2.79 (s, 3H), 2.76 (s, 3H), 2.70 (s, 3H).

(897) Step 2; A 50 mL microwave vial was charged with a solution of 2-chloro-6,7-dimethyl-4-methylsulfanyl-pteridine (600 mg, 2.49 mmol), Pd.sub.2(dba).sub.3 (36 mg, 0.0626 mmol) and tri(2-furyl)phosphine (30 mg, 0.129 mmol) in THF (12 mL) and subjected to three cycles of vacuum/nitrogen fill. Bromo-[2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]zinc bromide solution (0.16 M in THF, 23 ml, 3.74 mmol) was then added dropwise at 25° C. and the mixture was stirred for 44 h. The mixture was diluted with DCM (100 mL) and sat. NaHCO.sub.3 (20 mL). The aqueous layer was extracted with DCM (2×50 mL). The combined organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and concentrated in vacuo. The residue was purified by silica gel chromatography (SilicaSep 40 g cartridge) using EtOAc and hexanes (0-100%) then MeOH and DCM (5-15%) to obtain an oil which was further purified by reverse phase chromatography (30 g C-18 cartridge) using acetonitrile and 0.1% aqueous formic acid to obtain 6,7-dimethyl-2-[2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]-4-methylsulfanyl-pteridine (255 mg, 0.655 mmol, 26%) as a solid. ESI-MS (m/z+); 382.10 [M+H].sup.+, LC-RT; 2.136 min. .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.41 (d, J=4.9 Hz, 1H), 7.23 (s, 1H), 7.14 (d, J=4.8 Hz, 1H), 4.56-4.49 (m, 1H), 4.37-4.28 (m, 1H), 3.85-3.77 (m, 1H), 3.48-3.38 (m, 1H), 2.74 (s, 3H), 2.72 (s, 3H), 2.66 (s, 3H), 2.52 (s, 3H), 2.43-2.36 (m, 1H), 2.17-2.09 (m, 2H), 1.95-1.84 (m, 1H).

(898) Step 3; In a flame-dried 50 mL microwave vial 6,7-dimethyl-2-[2-(2-methyl-4-pyridyl)tetrahydropyran-4-yl]-4-methylsulfanyl-pteridine (122 mg, 0.320 mmol), Pd(OAc).sub.2 (1.8 mg, 0.0080 mmol), SPhos (6.6 mg, 0.016 mmol) and THF (1 mL) were added. The reaction mixture was degassed for 5 min under N.sub.2 and chloro-(4-chloro-2,3-difluoro-phenyl)zinc chloride solution (0.089 M in THF) (5.3 mL, 0.4797 mmol) was added dropwise at 25° C. over 30 min. The mixture was stirred at 25° C. for 2 h. The reaction was quenched by addition of sat. NaHCO.sub.3 (20 mL) and the reaction mixture was extracted with DCM (50 mL). The aqueous layer was extracted with (2×50 mL). The combined organic layer was dried over Na.sub.2SO.sub.4 and the solvent was removed in vacuo. The crude material was purified by flash chromatography (Isco RediSep® column 40g) using EtOAc and hexanes (0-100%) then with MeOH and DCM (10-20%) to obtain a solid (34 mg), which was further purified by prep HPLC (Gemini® 5 μm NX-C18 110 Å, 100×30 mm) using MeOH and aqueous ammonium bicarbonate to obtain a mixture of cis isomers 4-(4-chloro-3,5-difluoro-phenyl)-6,7-dimethyl-2-[rac-(2R,4S)-2-(2-methyl-4-pyridyl) tetrahydropyran-4-yl]pteridine (14 mg, 0.0277 mmol, 9%) as one peak and a mixture of trans isomers 4-(4-chloro-3,5-difluoro-phenyl)-6,7-dimethyl-2-[rac-(2R,4R)-2-(2-methyl-4-ridyl)tetrahydropyran-4-yl]pteridine (4.5 mg, 0.00907 mmol, 3%) as another peak. Cis isomers; ESI-MS (m/z+); 482.2 [M+H].sup.+, LC-RT; 1.598 min. .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.41 (s, 2H), 8.39 (s, 1H), 7.23 (s, 1H), 7.14 (d, J=4.0 Hz, 1H), 4.56 (dd, J=11.3, 1.1 Hz, 1H), 4.39-4.32 (m, 1H), 3.90-3.79 (m, 1H), 3.64-3.51 (m, 1H), 2.81 (s, 3H), 2.79 (s, 3H), 2.52 (s, 3H), 2.48-2.40 (m, 1H), 2.24-2.13 (m, 2H), 2.01-1.88 (m, 1H). .sup.19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm−113.77 (s), −113.80 (s). trans isomers; ESI-MS (m/z+); 482.2 [M+H].sup.+, LC-RT; 1.560 min. .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.42 (d, J=5.0 Hz, 1H), 8.35 (d, J=8.2 Hz, 2H), 7.23 (s, 1H), 7.14 (d, J 4.9 Hz, 1H), 4.69-4.57 (m, 2H), 4.40-4.33 (m, 1H), 3.99-3.89 (m, 1H), 2.83 (s, 3H), 2.82 (s, 3H), 2.52 (s, 3H), 2.34-2.24 (m, 1H), 2.23-2.16 (m, 1H), 2.12-2.01 (m, 1H), 2.01-1.93 (m, 1H). .sup.19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm−113.54 (s), −113.56 (s).

Method 42

Examples 341; 2-(1-cyclopropylpyrazol-4-yl)-4-[5-(2,4-difluorophenyl)-2-methyl-pyrido[3,4-b]pyrazin-7-yl]morpholine

(899) ##STR01600##

(900) To a mixture of 7-chloro-5-(2,4-difluorophenyl)-2-methyl-pyrido[3,4-b]pyrazine (90 mg, 0.309 mmol), 2-(1-cyclopropylpyrazol-4-yl)morpholin-4-ium chloride (85 mg, 0.370 mmol), and sodium tert-butoxide (26 mg, 0.269 mmol) in toluene (2.5 mL) was added XPhos Pd G4 (19 mg, 0.022 mmol). The mixture was heated to 100° C. and stirred overnight. The reaction was cooled to r.t., and water was added. The solid was filtered over celite and rinsed with EtOAc. The product was extracted from the filtrate with EtOAc, and the combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated in vacuo. The crude material was purified by silica gel chromatography eluting with 20-100% EtOAc in hexanes to provide the title compound 2-(1-cyclopropylpyrazol-4-yl)-4-[5-(2,4-difluorophenyl)-2-methyl-pyrido[3,4-b]pyrazin-7-yl]morpholine (65 mg, 0.138 mmol, 45% yield) as an orange solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ ppm 8.51 (s, 1H), 7.85 (s, 1H), 7.66 (td, J=8.4, 6.6 Hz, 1H), 7.48 (s, 1H), 7.36 (td, J=9.8, 2.5 Hz, 1H), 7.23 (td, J=8.6, 2.6 Hz, 1H), 7.18 (s, 1H), 4.56 (dd, J=10.4, 2.7 Hz, 1H), 4.41 (d, J=13.2 Hz, 1H), 4.29-4.19 (m, 1H), 4.09-3.86 (m, 1H), 3.89-3.52 (m, 2H), 3.21-2.84 (m, 2H), 2.64 (s, 3H), 1.11-0.98 (m, 2H), 0.98-0.89 (m, 2H). LC/MS (ESI.sup.+) m/z=449.2 [M+H].sup.+

Method 44

Example 402; 8-(4-chloro-2-fluorophenyl)-6-(2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-2,3-dimethylpyrido[2,3-b]pyrazine

(901) ##STR01601##

(902) Step 1; To a solution of 6,8-dichloro-2,3-dimethylpyrido[2,3-b]pyrazine (1 g, 4.4 mmol) in dioxane (20 mL) and H.sub.2O (4 mL) was added 1-cyclopropyl-4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydro-2H-pyran-2-yl)-1H-pyrazole (1.4 g, 4.4 mmol) and K.sub.2CO.sub.3 (1.8 g, 13 mmol) and the reaction mixture was purged with nitrogen. Then Pd(dppf)Cl.sub.2.Math.DCM (0.29 g, 0.36 mmol) was added and the reaction mixture was heated at 80° C. for 5 h. The reaction mixture was then cooled to RT and monitored by LCMS. After completion, the aqueous layer was extracted with ethyl acetate (3×200 ml) and the combined organic layers were dried over anhydrous sodium sulphate and concentrated under reduced pressure to get the crude residue. The residue was purified via column chromatography on silica gel (PE:EA=1:1) to afford 8-chloro-6-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-2,3-dimethylpyrido[2,3-b]pyrazine (1.3 g, 76%) as a purple solid. LCMS; (M+H).sup.+=382.0;

(903) Step 2; To a 250 mL round-bottomed flask was added 4-chloro-2-fluoro-1-iodobenzene (2.2 g, 8.6 mmol) in THF (40 mL). The mixture was cooled to −40° C. and iPrMgCl (4.7 mL, 9.5 mmol) (2 M solution in THF) was added dropwise and stirred for 30 min at −40° C., then the reaction mixture was cooled to −78° C. ZnCl.sub.2 (4.3 mL, 8.6 mmol) (2 M solution in THF) was then added dropwise and the reaction mixture was allowed to warm to RT and 40 mL of THF was added and stirred for 10 min to give (4-chloro-2-fluorophenyl)zinc(II) iodide, which was used in the next reaction directly.

(904) Into a 250-mL 3-necked round-bottom flask purged and maintained with N.sub.2, was placed 8-chloro-6-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-2,3-dimethylpyrido[2,3-b]pyrazine (1.1 g, 2.9 mmol) and PdCl.sub.2(Atmphos).sub.2 (0.1 g, 0.14 mmol) in THF (10 mL). The reaction mixture was stirred and (4-chloro-2-fluorophenyl)zinc(II) iodide (2.2 g, 8.6 mmol) was added. The reaction mixture was stirred at room temp for 40 min and monitored by LCMS. After completion, the reaction mixture was quenched with H.sub.2O (200 ml). The aqueous layer was extracted with EA (3×200 ml) and the combined organic layers were dried over anhydrous sodium sulphate, and then concentrated under reduced pressure to get the crude residue. The residue was purified via column chromatography on silica gel (PE:EA=1:1) to afford 8-(4-chloro-2-fluorophenyl)-6-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-2,3-dimethylpyrido[2,3-b]pyrazine (900 mg, 64%) as a white solid. LCMS; (M+H).sup.+=476.0.

(905) Step 3; To a solution of 8-(4-chloro-2-fluorophenyl)-6-(6-(1-cyclopropyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl)-2,3-dimethylpyrido[2,3-b]pyrazine (400 mg, 0.84 mmol) in THF (8 mL) was added Rh(cod)dppf.BF.sub.4 (122 mg, 0.17 mmol) and the reaction mixture was purged with hydrogen for 3h at room temp. The reaction was monitored by LCMS. After completion the reaction mixture was evaporated under reduced pressure to get the crude residue. The residue was purified by silica gel chromatography (PE:EA=1:2) to afford 8-(4-chloro-2-fluorophenyl)-6-(2-(1-cyclopropyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)-2,3-dimethylpyrido[2,3-b]pyrazine (123 mg, 31%) as a white solid. LCMS; (M+H).sup.+=478.0.

(906) TABLE-US-00011 TABLE 8 Analytical Data for Examples 1-232 Ex # NMR M + H 1 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.53 (s, 1 H), 7.74 (br d, 440.0 J = 8.2 Hz, 2 H), 7.64 (dd, J = 9.8, 1.8 Hz, 1 H), 7.41-7.54 (m, 2 H), 4.77 (br d, J = 12.6 Hz, 1 H), 4.64 (br d, J = 13.6 Hz, 1 H), 4.54 (br d, J = 8.3 Hz, 1 H), 3.95-4.11 (m, 1 H), 3.82 (s, 3 H), 3.62-3.73 (m, 1 H), 3.20-3.29 (m, 2 H), 2.66 (s, 3 H) 2 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.53 (s, 1H), 7.84 (br s, 1H), 466.0 7.73 (br t, J = 7.91 Hz, 1H), 7.63 (dd, J = 1.82, 9.60 Hz, 1H), 7.41-7.53 (m, 2H), 4.77 (br d, J = 11.94 Hz, 1H), 4.65 (br d, J = 13.49 Hz, 1H), 4.41-4.60 (m, 1H), 3.90-4.12 (m, 1H), 3.57-3.78 (m, 2H), 3.16-3.35 (m, 2H), 2.65 (s, 3H), 0.98-1.07 (m, 2H), 0.90-0.97 (m, 2H) 3 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.55 (s, 1H), 8.46 (br d, 451.0 J = 4.67 Hz, 1H), 7.75 (br t, J = 7.91 Hz, 1H), 7.64 (br dd, J = 2.08, 9.86 Hz, 1H), 7.50 (br dd, J = 1.95, 8.17 Hz, 1H), 7.33 (br s, 1H), 7.21-7.30 (m, 1H), 4.81-4.95 (m, 1H), 4.73 (br d, J = 13.49 Hz, 1H), 4.64 (br dd, J = 1.82, 10.12 Hz, 1H), 4.09-4.23 (m, 1H), 3.77 (dt, J = 1.69, 11.74 Hz, 1H), 3.30-3.34 (m, 1H), 3.01-3.14 (m, 1H), 2.67 (s, 3H) (one Me singlet not observed due to overlap with solvent peak) 4 .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.80 (s, 2 H), 8.56 (s, 1 H), 7.77 (t, 452.1 J = 7.9 Hz, 1 H), 7.66 (dd, J = 9.8, 2.1 Hz, 1 H), 7.51 (d, J = 8.2 Hz, 1 H), 4.85 (d, J = 13.2 Hz, 1 H), 4.73 (d, J = 11.7 Hz, 2 H), 4.15 (d, J = 11.3 Hz, 1 H), 3.77 (t, J = 11.4 Hz, 1 H), 3.25-3.45 (m, 2 H), 2.67 (s, 3 H), 2.64 (s, 3 H) 5 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.51-8.53 (m, 1 H), 7.71- 430.0 7.76 (m, 1 H), 7.62-7.66 (m, 1 H), 7.49-7.53 (m, 1 H), 4.59-4.78 (m, 2 H), 3.94-4.04 (m, 1 H), 3.71-3.85 (m, 2 H), 3.54-3.68 (m, 3 H), 3.41-3.53 (m, 1 H), 3.16-3.24 (m, 1 H), 2.90-3.01 (m, 1 H), 2.65-2.67 (m, 3 H), 2.29-2.37 (m, 1 H), 1.89-2.05 (m, 1 H), 1.56- 1.75 (m, 1 H) 6 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.47-8.59 (m, 1 H), 7.73- 424.2 7.81 (m, 2 H), 7.38-7.52 (m, 2 H), 7.23-7.32 (m, 1 H), 4.72-4.84 (m, 1 H), 4.61-4.68 (m, 1 H), 4.50-4.57 (m, 1 H), 3.96-4.06 (m, 1 H), 3.78-3.87 (m, 3 H), 3.62-3.72 (m, 1 H), 3.19-3.30 (m, 2 H), 2.61-2.70 (m, 3 H) 7 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.50-8.56 (m, 1 H), 7.85 (br 450.0 s, 1 H), 7.74-7.81 (m, 1 H), 7.40-7.49 (m, 2 H), 7.24-7.32 (m, 1 H), 4.73-4.83 (m, 1 H), 4.62-4.68 (m, 1 H), 4.47-4.56 (m, 1 H), 3.99-4.08 (m, 1 H), 3.62-3.73 (m, 2 H), 3.21-3.29 (m, 2 H), 2.64- 2.66 (m, 3 H), 1.00-1.05 (m, 2 H), 0.91-0.96 (m, 2 H) 8 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.53-8.58 (m, 1 H), 8.42- 435.2 8.49 (m, 1 H), 7.76-7.83 (m, 1 H), 7.45 (td, J = 9.9, 2.6 Hz, 1 H), 7.23-7.36 (m, 3 H), 4.82-4.93 (m, 1 H), 4.70-4.77 (m, 1 H), 4.61- 4.67 (m, 1H), 4.12-4.23 (m, 1 H), 3.73-3.82 (m, 1 H), 3.26-3.30 (m, 1 H), 3.01-3.15 (m, 1 H), 2.66-2.67 (m, 3 H), 2.49-2.49 (m, 3 H) 9 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.49-8.55 (m, 1 H), 7.78- 446.2 7.90 (m, 1 H), 7.52-7.60 (m, 1 H), 7.43-7.51 (m, 1 H), 7.14-7.24 (m, 2 H), 4.71-4.83 (m, 1 H), 4.63-4.69 (m, 1 H), 4.49-4.56 (m, 1 H), 3.97-4.08 (m, 1 H), 3.61-3.75 (m, 2 H), 3.19-3.28 (m, 2 H), 2.64-2.66 (m, 3 H), 2.38-2.43 (m, 3 H), 1.00-1.06 (m, 2 H), 0.90- 0.97 (m, 2 H) 10 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.51-8.57 (m, 1 H), 8.42- 431.2 8.48 (m, 1 H), 7.55-7.62 (m, 1 H), 7.30-7.36 (m, 1 H), 7.23-7.28 (m, 1 H), 7.15-7.23 (m, 2 H), 4.82-4.92 (m, 1 H), 4.69-4.77 (m, 1 H), 4.59 (s, 1 H), 4.11-4.21 (m, 1 H), 3.72-3.81 (m, 1 H), 3.25- 3.30 (m, 1 H), 3.02-3.13 (m, 1 H), 2.64-2.68 (m, 3 H), 2.48-2.49 (m, 3 H), 2.42-2.44 (m, 3 H) 11 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.43-8.55 (m, 1 H), 7.70- 434.0 7.85 (m, 1 H), 7.45-7.52 (m, 1 H), 4.49-4.98 (m, 5 H), 3.98-4.12 (m, 1 H), 3.97-4.15 (m, 1 H), 4.04 (br d, J = 11.4 Hz, 1 H), 3.62- 3.74 (m, 1 H), 3.54-3.79 (m, 1 H), 3.2-3.3 (m, 2 H), 2.65-2.76 (m, 2 H), 2.59-2.65 (m, 3 H), 2.52-2.59 (m, 2 H) 12 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.49-8.53 (m, 1H), 7.82 (br 460.0 s, 1 H), 7.45 (br s, 1 H), 4.80 (br s, 1 H), 4.53-4.63 (m, 1 H), 4.52 (dd, J = 10.26, 2.45 Hz, 1 H), 4.03 (br d, J = 10.90 Hz, 1 H), 3.69-3.73 (m, 1 H), 3.64-3.69 (m, 1 H), 2.62 (s, 3 H), 2.52-2.59 (m, 3 H), 0.99-1.05 (m, 2 H), 0.93-0.99 (m, 2 H) 13 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 0.93-0.98 (m, 2 H) 0.99- 460.0 1.06 (m, 2 H) 2.51-2.58 (m, 2 H) 2.59-2.65 (m, 3 H) 2.66-2.77 (m, 2 H) 3.14-3.25 (m, 1 H) 3.64-3.74 (m, 2 H) 4.03 (br d, J = 11.63 Hz, 1 H) 4.52 (dd, J = 10.26, 2.63 Hz, 1 H) 4.63 (dt, J = 16.53, 8.45 Hz, 1 H) 4.82 (br s, 1 H) 7.48 (s, 1H) 7.85 (s, 1 H) 8.50 (s, 1 H) 14 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 9.15 (br s, 1H), 8.54 (s, 1H), 446.2 7.61 (br s, 1H), 4.77-5.19 (m, 2H), 4.74 (dd, J = 2.36, 10.17 Hz, 1H), 4.59 (quin, J = 8.72 Hz, 1H), 4.19 (br d, J = 11.08 Hz, 1H), 3.78 (dt, J = 2.63, 11.67 Hz, 1H), 3.31-3.46 (m, 2H), 3.22-3.29 (m, 1H), 2.66 (s, 3H), 2.64 (s, 3H), 2.52-2.62 (m, 4H) 15 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm δ ppm 2.48-2.52 (m, 4 H) 445.0 2.54-2.61 (m, 4 H) 2.63 (s, 4 H) 3.75 (td, J = 11.72, 2.72 Hz, 1 H) 4.17 (br d, J = 9.99 Hz, 1 H) 4.56-4.66 (m, 3 H) 4.89 (br s, 1 H) 7.20- 7.29 (m, 1 H) 7.29-7.35 (m, 1 H) 8.47 (d, J = 5.09 Hz, 1 H) 8.53 (s, 1 H) 16 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 2.51-2.59 (m, 2 H) 2.61- 445.0 2.65 (m, 3 H) 2.73 (br d, J = 10.72 Hz, 2 H) 3.05 (br s, 1 H) 3.72- 3.81 (m, 1 H) 4.17 (br d, J = 11.44 Hz, 1 H) 4.60-4.67 (m, 2 H) 4.92 (br s, 1 H) 7.27 (br d, J = 5.09 Hz, 1 H) 7.34 (s, 1 H) 8.47 (d, J = 5.09 Hz, 1 H) 8.50-8.55 (m, 1 H) 17 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.83 (t, J = 7.3 Hz, 1 H), 488.1 7.55-7.63 (m, 2 H), 7.52 (d, J = 9.4 Hz, 1 H), 7.46 (s, 1 H), 5.03 (s, 1 H), 4.85 (d, J = 13.8 Hz, 1 H), 4.62 (dd, J = 9.9, 2.7 Hz, 1 H), 4.12 (d, J = 11.6 Hz, 1 H), 3.92 (s, 3 H), 3.83 (td, J = 11.5, 2.7 Hz, 1 H), 3.40 (t, J = 12.2 Hz, 1 H), 3.31 (dd, J = 13.4, 10.3 Hz, 1 H), 2.75 (s, 3 H), 2.61 (s, 3 H) 18 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.28 (t, J = 8.1 Hz, 2 H), 456.2 7.59 (s, 1 H), 7.47 (s, 1 H), 5.04 (s, 1 H), 4.88 (d, J = 13.5 Hz, 1 H), 4.62 (dd, J = 10.3, 2.8 Hz, 1 H), 4.15 (d, J = 11.9 Hz, 1 H), 3.93 (s, 3 H), 3.83 (td, J = 11.5, 2.8 Hz, 1 H), 3.26-3.47 (m, 2 H), 2.75 (s, 3 H), 2.71 (s, 3 H) 19 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 9.73 (1H, d, J = 1.8 Hz), 471.1 8.89 (1H, dd, J = 7.8, 2.1 Hz), 7.88 (1H, dd, J = 8.2, 0.9 Hz), 7.59 (1H, s), 7.47 (1H, s), 5.07 (1H, s), 4.90 (1H, d, J = 13.5 Hz), 4.63 (1H, dd, J = 10.4, 2.8 Hz), 4.12-4.18 (1H, m), 3.94 (3H, s), 3.84 (1H, td, J = 11.5, 2.8 Hz), 3.37-3.48 (1H, m), 3.32 (1H, dd, J = 13.4, 10.3 Hz), 2.77 (3H, s), 2.69 (3H, s) 20 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 9.34 (d, J = 2.0 Hz, 1H), 417.1 8.54 (dd, J = 7.9, 2.3 Hz, 1H), 7.78 (s, 1H), 7.41-7.54 (m, 2H), 4.81 (d, J = 11.5 Hz, 1H), 4.55 (dd, J = 10.3, 2.7 Hz, 1H), 4.00-4.07 (m, 1H), 3.84 (s, 3H), 3.70 (td, J = 11.6, 2.8 Hz, 1H), 3.20 (d, J = 12.1 Hz, 3H), 2.66 (s, 3H), 2.60 (d, J = 9.0 Hz, 6H) 21 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.70-7.81 (m, 2 H), 7.64 454.0 (dd, J = 9.7, 1.9 Hz, 1 H), 7.42-7.54 (m, 2 H), 4.73 (br d, J = 13.0 Hz, 1 H), 4.61 (br d, J = 13.8 Hz, 1 H), 4.53 (dd, J = 10.3, 2.5 Hz, 1 H), 4.02 (br d, J = 11.2 Hz, 1 H), 3.82 (s, 3 H), 3.68 (td, J = 11.5, 2.6 Hz, 1 H), 3.16-3.27 (m, 2 H), 2.65 (s, 3 H), 2.51 (s, 3 H) 22 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.83 (s, 1H), 7.72 (br t, 480.2 J = 7.91 Hz, 1H), 7.63 (dd, J = 1.95, 9.73 Hz, 1H), 7.48 (dd, J = 1.82, 8.30 Hz, 1H), 7.46 (s, 1H), 4.73 (br d, J = 12.46 Hz, 1H), 4.61 (br d, J = 13.49 Hz, 1H), 4.52 (dd, J = 2.34, 10.38 Hz, 1H), 3.91-4.08 (m, 1H), 3.59-3.75 (m, 2H), 3.16-3.28 (m, 2H), 2.65 (s, 3H), 2.52 (s, 3H), 0.98-1.06 (m, 2H), 0.89-0.98 (m, 2H) 23 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.45 (d, J = 5.1 Hz, 1 H), 7.74 465.0 (t, J = 7.9 Hz, 1 H), 7.65 (dd, J = 9.7, 1.9 Hz, 1 H), 7.50 (dd, J = 8.3, 1.8 Hz, 1 H), 7.33 (s, 1 H), 7.25 (br d, J = 4.0 Hz, 1 H), 4.83 (br d, J = 12.8 Hz, 1 H), 4.69 (br d, J = 13.6 Hz, 1 H), 4.63 (dd, J = 10.5, 2.3 Hz, 1 H), 4.09-4.22 (m, 1 H), 3.76 (td, J = 11.8, 2.7 Hz, 1 H), 3.30 (s, 3 H), 3.22-3.30 (m, 1 H), 2.96-3.07 (m, 1 H), 2.66 (s, 3 H), 2.52 (s, 3 H) 24 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.80 (s, 2 H), 7.75 (t, J = 8.0 466.1 Hz, 1 H), 7.66 (dd, J = 9.8, 2.0 Hz, 1 H), 7.47-7.54 (m, 1 H), 4.81 (d, J = 13.4 Hz, 1 H), 4.70 (t, J = 10.2 Hz, 2 H), 4.15 (d, J = 11.5 Hz, 1 H), 3.76 (t, J = 11.2 Hz, 1 H), 3.18-3.27 (m, 1 H), 2.66 (d, J = 6.3 Hz, 4 H), 2.55 (s, 6 H) 25 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.80 (s, 2 H), 7.75 (t, J = 8.0 466.1 Hz, 1 H), 7.66 (dd, J = 9.8, 2.0 Hz, 1 H), 7.47-7.54 (m, 1 H), 4.81 (d, J = 13.4 Hz, 1 H), 4.70 (t, J = 10.2 Hz, 2 H), 4.15 (d, J = 11.5 Hz, 1 H), 3.76 (t, J = 11.2 Hz, 1 H), 3.18-3.27 (m, 1 H), 2.66 (d, J = 6.3 Hz, 4 H), 2.55 (s, 6 H) 26 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.72 (t, J = 7.9 Hz, 2 H), 7.64 444.0 (dd, J = 9.7, 1.9 Hz, 2 H), 7.49 (dd, J = 8.3, 1.9 Hz, 2 H), 4.70 (br d, J = 13.1 Hz, 1 H), 4.57 (br d, J = 13.2 Hz, 3 H), 3.98 (br t, J = 12.3 Hz, 2 H), 3.69-3.85 (m, 4 H), 3.50-3.68 (m, 5 H), 3.43-3.49 (m, 1 H), 3.32-3.42 (m, 2 H), 3.09-3.21 (m, 2 H), 2.86-2.96 (m, 2 H), 2.65 (s, 6 H), 2.51 (br s, 6 H), 2.32-2.38 (m, 2 H), 1.90-2.07 (m, 2 H), 1.82 (dq, J = 12.3, 7.6 Hz, 1 H), 1.55-1.67 (m, 1 H) (note: this is a racemic 1:1 mixture of diastereomers) 27 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.60-7.82 (m, 1 H), 7.28- 443.0 7.53 (m, 1 H), 4.74-4.86 (m, 1 H), 4.79 (br d, J = 12.7 Hz, 1 H), 4.64 (br d, J = 12.7 Hz, 1 H), 4.59-4.69 (m, 1 H), 4.52 (br d, J = 13.1 Hz, 1 H), 4.41-4.47 (m, 1 H), 4.43 (br d, J = 9.8 Hz, 1 H), 4.28-4.40 (m, 1 H), 4.10-4.20 (m, 1 H), 3.91-4.01 (m, 2 H), 3.76-3.86 (m, 3 H), 3.53-3.64 (m, 1 H), 3.14-3.20 (m, 2 H), 2.96-3.14 (m, 2 H), 2.75- 2.84 (m, 1 H), 2.57-2.69 (m, 1 H), 2.45-2.53 (m, 4 H) 28 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 2.38-2.49 (m, 2 H) 2.52- 411.0 2.63 (m, 1 H) 3.02 (br dd, J = 13.17, 10.45 Hz, 1 H) 3.05-3.11 (m, 1 H) 3.15-3.25 (m, 1 H) 3.58 (td, J = 11.49, 2.63 Hz, 1 H) 3.77- 3.86(m, 4 H) 3.95 (dt, J = 9.85, 1.70 Hz, 1 H) 4.34-4.39 (m, 2 H) 4.41-4.48 (m, 2 H) 4.53 (br d, J = 13.44 Hz, 1 H) 4.66 (br d, J = 13.26 Hz, 1 H) 4.89 (br s, 1 H) 7.41-7.48 (m, 1 H) 7.70-7.76 (m, 1 H) 29 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 3.44 (br dd, J = 6.90, 5.09 Hz, 399.0 1 H), 3.15-3.28 (m, 10 H), 2.61 (br s, 2 H), 2.35-2.48 (m, 3 H), 1.50 (s, 1 H), 1.35 (s, 1 H), 1.23 (br s, 1 H), 1.03-1.18 (m, 3 H), 0.85 (s, 1 H) 30 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.72 (s, 1 H), 7.44 (s, 1 H), 449.0 4.93 (br s, 1 H), 4.67 (br d, J = 13.26 Hz, 2 H), 4.54 (br d, J = 13.08 Hz, 1 H), 4.43 (br dd, J = 10.08, 2.27 Hz, 2 H), 4.19 (br s, 1 H), 3.95 (br d, J = 11.44 Hz, 1 H), 3.82 (s, 3 H), 3.79 (br dd, J = 9.26, 4.90 Hz, 1 H), 3.59 (td, J = 11.44, 2.72 Hz, 1 H), 3.25-3.14 (m, 1 H), 3.12-3.06 (m, 1 H), 3.03 (dd, J = 13.26, 10.35 Hz, 1 H), 2.53-2.51 (m, 2 H) 31 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.73-7.80 (m, 2 H), 7.47 (s, 438.2 1 H), 7.44 (td, J = 9.9, 2.5 Hz, 1 H), 7.28 (td, J = 8.4, 2.6 Hz, 1 H), 4.75 (br d, J = 13.2 Hz, 1 H), 4.62 (br d, J = 13.6 Hz, 1 H), 4.54 (dd, J = 10.4, 2.6 Hz, 1 H), 4.02 (br d, J = 10.9 Hz, 1 H), 3.83 (s, 3 H), 3.69 (td, J = 11.6, 2.7 Hz, 1 H), 3.17-3.27 (m, 2 H), 2.66 (s, 3 H), 2.53 (s, 3 H) 32 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.84 (s, 1 H), 7.71-7.81 (m, 464.2 1 H), 7.46 (s, 1 H), 7.39-7.46 (m, 1 H), 7.27 (td, J = 8.4, 2.1 Hz, 1 H), 4.74 (br d, J = 13.2 Hz, 1 H), 4.62 (br d, J = 13.1 Hz, 1 H), 4.51 (dd, J = 10.4, 2.3 Hz, 1 H), 3.96-4.05 (m, 1 H), 3.58-3.78 (m, 2 H), 3.17- 3.28 (m, 2 H), 2.65 (s, 3 H), 2.52 (s, 3 H), 0.99-1.08 (m, 2 H), 0.90- 0.97 (m, 2 H) 33 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 2.52 (s, 3H), 2.64-2.66 (m, 449.2 3H), 3.03 (br t, J = 11.68 Hz, 1H), 3.23-3.27 (m, 1H), 3.76 (td, J = 11.68, 2.72 Hz, 1H), 4.15 (br d, J = 9.34 Hz, 1H), 4.63 (dd, J = 10.25, 2.47 Hz, 1H), 4.70 (br d, J = 13.10 Hz, 1H), 4.84 (br d, J = 13.23 Hz, 1H), 7.23-7.34 (m, 3H), 7.44 (td, J = 9.86, 2.47 Hz, 1H), 7.78 (td, J = 8.34, 6.68 Hz, 1H), 8.46 (d, J = 4.93 Hz, 1H) 34 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.73-7.82 (m, 1 H), 7.44 (td, 428.0 J = 9.9, 2.3 Hz, 1 H), 7.29 (td, J = 8.4, 2.2 Hz, 1 H), 4.71 (br d, J = 13.0 Hz, 1 H), 4.59 (br d, J = 13.3 Hz, 1 H), 3.92-4.02 (m, 1 H), 3.81 (br t, J = 8.1 Hz, 1 H), 3.72-3.79 (m, 1 H), 3.64 (q, J = 7.7 Hz, 1 H), 3.49- 3.62 (m, 2 H), 3.34-3.43 (m, 1 H), 3.09-3.21 (m, 1 H), 2.91 (br dd, J = 12.8, 10.8 Hz, 1 H), 2.66 (s, 3 H), 2.52 (s, 3 H), 2.31-2.38 (m, 1 H), 1.93-2.09 (m, 1 H), 1.56-1.71 (m, 1 H) 35 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.73-7.81 (m, 1 H), 7.44 (td, 428.0 J = 9.8, 2.4 Hz, 1 H), 7.29 (td, J = 8.5, 2.1 Hz, 1 H), 4.58 (br d, J = 13.3 Hz, 2 H), 4.01 (br d, J = 10.6 Hz, 1 H), 3.81 (br t, J = 5.8 Hz, 1 H), 3.70- 3.78 (m, 1 H), 3.62-3.69 (m, 1 H), 3.57 (td, J = 11.5, 2.2 Hz, 1 H), 3.48 (br t, J = 7.2 Hz, 1 H), 3.35-3.44 (m, 1 H), 3.14-3.23 (m, 1 H), 2.94 (br dd, J = 13.0, 10.6 Hz, 1 H), 2.65 (s, 3 H), 2.52 (s, 3 H), 2.33- 2.42 (m, 1 H), 1.90-2.04 (m, 1 H), 1.78-1.88 (m, 1 H) 36 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.73-7.80 (m, 1 H), 7.44 (td, 428.0 J = 9.8, 2.2 Hz, 1 H), 7.29 (td, J = 8.5, 2.2 Hz, 1 H), 4.71 (br d, J = 13.3 Hz, 1 H), 4.59 (br d, J = 13.3 Hz, 1 H), 3.98 (br d, J = 9.8 Hz, 1 H), 3.81 (t, J = 8.1 Hz, 1 H), 3.71-3.79 (m, 1 H), 3.64 (q, J = 7.7 Hz, 1 H), 3.51-3.61 (m, 2 H), 3.35-3.39 (m, 1 H), 3.12-3.20 (m, 1 H), 2.91 (dd, J = 12.9, 10.7 Hz, 1 H), 2.65 (s, 3 H), 2.52 (s, 3 H), 2.30-2.38 (m, 1 H), 1.95-2.06 (m, 1 H), 1.58-1.67 (m, 1 H) 37 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.75 (s, 1 H), 7.56 (t, J = 7.7 434.2 Hz, 1 H), 7.46 (s, 1 H), 7.15-7.24 (m, 2 H), 4.74 (br d, J = 13.2 Hz, 1 H), 4.61 (br d, J = 13.5 Hz, 1 H), 4.53 (dd, J = 10.3, 2.5 Hz, 1 H), 4.01 (br d, J = 11.5 Hz, 1 H), 3.82 (s, 3 H), 3.68 (td, J = 11.5, 2.7 Hz, 1 H), 3.15-3.28 (m, 2 H), 2.64 (s, 3 H), 2.51 (br s, 3 H), 2.42 (s, 3 H) 38 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.84 (s, 1 H), 7.55 (t, J = 7.7 460.2 Hz, 1 H), 7.46 (s, 1 H), 7.15-7.22 (m, 2 H), 4.70-4.78 (m, 1 H), 4.62 (br d, J = 13.0 Hz, 1 H), 4.51 (dd, J = 10.4, 2.5 Hz, 1 H), 3.93- 4.05 (m, 1 H), 3.60-3.75 (m, 2 H), 3.17-3.27 (m, 2 H), 2.64 (s, 3 H), 2.51 (br s, 3 H), 2.42 (s, 3 H), 0.99-1.07 (m, 2 H), 0.90-0.97 (m, 2 H) 39 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.45 (d, J = 4.9 Hz, 1 H), 7.57 445.2 (t, J = 7.7 Hz, 1 H), 7.33 (s, 1 H), 7.25 (br d, J = 3.6 Hz, 1 H), 7.16- 7.23 (m, 2 H), 4.84 (br d, J = 13.0 Hz, 1 H), 4.70 (br d, J = 13.2 Hz, 1 H), 4.63 (dd, J = 10.3, 2.5 Hz, 1 H), 4.10-4.19 (m, 1 H), 3.76 (td, J = 11.6, 2.7 Hz, 1H), 3.23-3.29 (m, 1 H), 2.98-3.06 (m, 1 H), 2.65 (s, 3 H), 2.52 (s, 3 H), 2.43 (s, 3 H) 40 .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.57 (s, 1H), 7.46 (s, 1H), 5.00 422.2 (br d, 1H, J = 11.7 Hz), 4.83 (br d, 1H, J = 13.8 Hz), 4.59 (dd, 1H, J = 2.7, 10.3 Hz), 4.1-4.2 (m, 1H), 3.93 (s, 3H), 3.7-3.9 (m, 1H), 3.6- 3.7 (m, 2H), 3.2-3.4 (m, 2H), 2.6-2.8 (m, 8H) 41 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.53 (d, J = 5.18 Hz, 1 H), 433.2 7.29-7.34 (m, 1 H), 7.24 (d, J = 5.30 Hz, 1 H), 5.10 (br d, J = 13.06 Hz, 1 H), 4.93 (br d, J = 13.58 Hz, 1 H), 4.56 (dd, J = 10.52, 2.64 Hz, 1 H), 4.22 (dd, J = 11.66, 2.54 Hz, 1 H), 3.83 (td, J = 11.77, 2.80 Hz, 1 H), 3.58-3.67 (m, 2 H), 3.30 (ddd, J = 13.55, 11.90, 3.58 Hz, 1 H), 2.95-3.10 (m, 1 H), 2.56-2.83 (m, 11 H) 42 .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.58 (s, 1H), 7.46 (s, 1H), 5.06 448.0 (br d, 1H, J = 13.2 Hz), 4.89 (br d, 1H, J = 13.8 Hz), 4.7-4.8 (m, 1H), 4.62 (dd, 1H, J = 2.7, 10.3 Hz), 4.13 (br d, 1H, J = 11.0 Hz), 3.93 (s, 3H), 3.83 (dt, 1H, J = 2.7, 11.5 Hz), 3.3-3.5 (m, 1H), 3.2-3.3 (m, 1H), 3.0-3.2 (m, 1H), 2.6-2.7 (m, 10H) 43 .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.57 (s, 1H), 7.45 (s, 1H), 5.07 448.0 (br d, 1H, J = 13.5 Hz), 4.88 (br d, 1H, J = 12.2 Hz), 4.5-4.7 (m, 2H), 4.13 (br d, 1H, J = 10.6 Hz), 3.93 (s, 3H), 3.82 (dt, 1H, J = 2.8, 11.5 Hz), 3.3-3.4 (m, 1H), 3.2-3.3 (m, 1H), 3.11 (qd, 1H, J = 9.0, 17.7 Hz), 2.6-2.7 (m, 10H) 44 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.68-7.83 (m, 1 H), 7.28- 430.0 7.54 (m, 1 H), 5.81-6.27 (m, 1 H), 5.77-6.21 (m, 1 H), 4.61-4.86 (m, 2 H), 4.46-4.56 (m, 2 H), 3.99-4.07 (m, 1 H), 4.02 (br d, J = 11.4 Hz, 1H), 3.67 (td, J = 11.5, 2.6 Hz, 1 H), 3.57-3.63 (m, 1 H), 2.83-2.98 (m, 1 H), 2.55-2.63 (m, 6 H), 2.39-2.44 (m, 1 H), 2.42 (br t, J = 8.9 Hz, 3 H) 45 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.68-7.87 (m, 1 H), 7.28- 430.0 7.56 (m, 1 H), 6.11-6.56 (m, 1 H), 6.05-6.64 (m, 1 H), 4.46-4.87 (m, 4H), 4.03 (br d, J = 11.6 Hz, 1 H), 3.95-4.08 (m, 1 H), 3.79- 3.88 (m, 3 H), 3.61-3.62 (m, 1 H), 3.57-3.74 (m, 1 H), 2.71-2.86 (m, 1 H), 2.56-2.63 (m, 6 H), 2.40-2.47 (m, 2 H), 0.91-1.37 (m, 2 H) 46 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.74 (s, 1 H), 7.46 (s, 1 H), 456.0 4.70-4.84 (m, 1 H), 4.65 (br s, 1 H), 4.44-4.59 (m, 2 H), 4.01 (br d, J = 11.26 Hz, 1 H), 3.82 (s, 3 H), 3.60-3.71 (m, 1 H), 3.16-3.27 (m, 2 H), 2.78 (br t, J = 12.35 Hz, 2 H), 2.51-2.61 (m, 11 H) 47 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 0.92-0.99 (m, 2 H) 0.99- 456.0 1.04 (m, 2 H) 2.38-2.45 (m, 4 H) 2.58 (s, 3 H) 2.59-2.63 (m, 3 H) 2.91 (ttd, J = 13.89, 13.89, 9.37, 9.37, 4.72 Hz, 1 H) 3.20-3.25 (m, 1 H) 3.63-3.69 (m, 1 H) 3.69-3.73 (m, 1 H) 4.02 (br d, J = 11.63 Hz, 1 H) 4.46-4.54 (m, 2 H) 4.69 (br s, 1 H) 4.78 (br s, 1 H) 5.95 (br s, 1 H) 6.00-6.15 (m, 1 H) 7.46 (s, 1 H) 7.82 (s, 1 H) 48 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.80-7.98 (m, 1 H), 7.40- 456.0 7.62 (m, 1 H), 6.20-6.57 (m, 1 H), 4.54-4.92 (m, 4 H), 4.06-4.13 (m, 1 H), 3.68-3.83 (m, 2 H), 3.35-3.23 (m, 2H), 2.79-2.92 (m, 1 H), 2.58-2.70 (m, 8 H), 2.55-2.58 (m, 2 H), 0.95-1.15 (m, 4 H) 49 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.80-7.86 (m, 1 H), 7.46 (s, 482.0 1 H), 4.72-4.87 (m, 1 H), 4.67 (br s, 1 H), 4.46-4.63 (m, 2 H), 3.97- 4.06 (m, 1 H), 3.61-3.74 (m, 2 H), 3.30-3.33 (m, 1 H), 3.20-3.27 (m, 1 H), 3.17 (br d, J = 5.27 Hz, 1 H), 2.79 (br t, J = 12.53 Hz, 2 H), 2.51-2.61 (m, 10 H), 0.90-1.06 (m, 4 H) 50 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.84 (s, 1 H), 7.47 (s, 1 H), 474.0 4.79 (br s, 1 H), 4.56-4.68 (m, 2 H), 4.51 (dd, J = 10.35, 2.54 Hz, 1 H), 3.98-4.06 (m, 1 H), 3.64-3.73 (m, 2 H), 3.18-3.29 (m, 2 H), 2.65-2.77 (m, 2 H), 2.51-2.64 (m, 9 H), 0.91-1.07 (m, 4 H) 51 .sup.1H NMR (Chloroform-d, 500 MHz) δ 9.45 (br s, 1H), 8.06 (br s, 1H), 460.0 5.30 (br d, 1H, J = 12.8 Hz), 5.01 (br d, 1H, J = 13.5 Hz), 4.7-4.9 (m, 2H), 4.2-4.4 (m, 1H), 3.91 (dt, 1H, J = 2.7, 11.7 Hz), 3.44 (br t, 1H, J = 11.0 Hz), 3.1-3.2 (m, 2H), 2.9-3.0 (m, 3H), 2.7-2.8 (m, 10H) 52 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 9.46 (br s, 1 H), 8.07 (br 460.0 s, 1 H), 5.30 (br d, J = 12.85 Hz, 1 H), 5.01 (br d, J = 13.36 Hz, 1 H), 4.72-4.91 (m, 2 H), 4.31 (br dd, J = 11.74, 2.01 Hz, 1 H), 3.91 (td, J = 11.68, 2.72 Hz, 1 H), 3.44 (br t, J = 11.22 Hz, 1 H), 3.05-3.18 (m, 2 H), 2.88-2.95 (m, 3 H), 2.64-2.83 (m, 10 H) 53 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.47-8.58 (m, 1 H), 7.18- 441.0 7.41 (m, 2 H), 5.97-6.31 (m, 1 H), 5.85-6.45 (m, 1 H), 4.52-5.05 (m, 5 H), 4.00-4.30 (m, 2 H), 3.73-3.92 (m, 1 H), 3.70-3.87 (m, 1 H), 3.5-3.3 (m, 3H) 2.91-3.02 (m, 1 H), 2.62-2.70 (m, 6 H), 2.54- 2.58 (m, 3 H) 54 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.44-8.61 (m, 1 H), 8.51 (d, 441.0 J = 5.1 Hz, 1 H), 7.37-7.39 (m, 1 H), 7.38 (s, 1 H), 7.28-7.33 (m, 1 H), 7.31 (br d, J = 4.9 Hz, 1 H), 6.22-6.53 (m, 1 H), 6.20-6.51 (m, 1 H), 4.59-5.02 (m, 4 H), 4.17-4.27 (m, 1 H), 4.21 (br d, J = 11.4 Hz, 1 H), 3.74-3.84 (m, 1 H), 3.45-3.25 (m, 3H), 3.02-3.14 (m, 1 H), 2.83-2.94 (m, 1 H), 2.65 (d, J = 20.0 Hz, 6 H), 2.55 (s, 3 H) 55 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.67 (br d, J = 5.27 Hz, 1 H), 459.0 7.72 (br s, 1 H), 7.65 (br s, 1 H), 4.96 (br s, 1 H), 4.80 (br d, J = 10.17 Hz, 2 H), 4.59-4.70 (m, 1 H), 4.20 (br d, J = 11.08 Hz, 1 H), 3.76- 3.84 (m, 1 H), 3.36-3.54 (m, 1 H), 3.23-3.34 (m, 2 H), 2.54-2.72 (m, 15 H) 56 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.46 (d, J = 5.09 Hz, 1 H), 467.0 7.32 (s, 1 H), 7.25 (br d, J = 4.90 Hz, 1 H), 4.88 (br s, 1 H), 4.75 (br s, 1 H), 4.58-4.70 (m, 1 H), 4.49-4.57 (m, 1 H), 4.16 (br d, J = 11.26 Hz, 1 H), 3.71-3.79 (m, 1 H), 3.20-3.35 (m, 1 H), 3.00 (br s, 1 H), 2.79 (br t, J = 12.53 Hz, 2 H), 2.53-2.63 (m, 12 H), 2.47-2.51 (m, 2 H) 57 .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.56 (s, 1H), 7.45 (s, 1H), 4.5- 434.0 4.7 (m, 1H), 4.10 (td, 1H, J = 1.6, 11.6 Hz), 3.9-4.0 (m, 4H), 3.7-3.9 (m, 2H), 3.2-3.3 (m, 2H), 2.73 (s, 3H), 2.70 (s, 3H), 2.4-2.6 (m, 1H), 1.5-1.7 (m, 3H) 58 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.55 (s, 1 H), 7.42-7.48 (m, 450.0 2 H), 7.28-7.38 (m, 2 H), 5.03 (s, 1 H), 4.85 (d, J = 13.5 Hz, 1 H), 4.60 (dd, J = 10.6, 2.8 Hz, 1 H), 4.10 (ddd, J = 11.7, 3.7, 1.8 Hz, 1 H), 3.91 (s, 3 H), 3.81 (td, J = 11.6, 2.8 Hz, 1 H), 3.30-3.42 (m, 1 H), 3.26 (dd, J = 13.4, 10.4 Hz, 1 H), 2.72 (s, 3 H), 2.58 (s, 3 H), 2.27 (s, 3 H) 59 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.57 (1H, s), 7.51 (1H, 434.2 dd, J = 8.4, 6.0 Hz), 7.45 (1H, s), 7.01-7.09 (2H, m), 5.05 (1H, s), 4.86 (1H, d, J = 13.3 Hz), 4.61 (1H, d, J = 10.0 Hz), 4.07-4.15 (1H, m), 3.92 (3H, s), 3.82 (1H, t, J = 11.2 Hz), 3.37 (1H, t, J = 12.1 Hz), 3.27 (1H, dd, J = 13.4, 10.3 Hz), 2.74 (3H, s), 2.60 (3H, s), 2.31 (3H, s) 60 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.37-8.50 (m, 1 H), 8.27 (s, 438.2 1 H), 7.78 (s, 1 H), 7.64 (dt, J = 10.6, 8.5 Hz, 1 H), 7.49 (d, J = 0.8 Hz, 1 H), 4.70-4.81 (m, 2 H), 4.54 (dd, J = 10.4, 2.7 Hz, 1 H), 4.10 (d, J = 9.94 Hz, 1 H), 3.84 (s, 3 H), 3.69 (td, J = 11.6, 2.8 Hz, 1 H), 3.17- 3.25 (m, 2 H), 2.66 (s, 3 H), 2.61 (s, 3 H) 61 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.57 (s, 1 H), 7.47 (d, 456.2 J = 10.9 Hz, 2 H), 7.08-7.19 (m, 1 H), 5.02 (s, 1 H), 4.85 (d, J = 13.6 Hz, 1 H), 4.62 (dd, J = 10.3, 2.8 Hz, 1 H), 4.08-4.17 (m, 1 H), 3.92 (s, 3 H), 3.82 (td, J = 11.5, 2.8 Hz, 1 H), 3.33-3.44 (m, 1 H), 3.30 (dd, J = 13.4, 10.3 Hz, 1 H), 2.74 (s, 3 H), 2.62 (s, 3 H) 62 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.58-7.64 (m, 1 H), 7.57 456.2 (s, 1 H), 7.46 (s, 1 H), 7.11 (td, J = 9.7, 6.4 Hz, 1 H), 5.02 (bs, 1 H), 4.85 (d, J = 13.5 Hz, 1 H), 4.62 (d, J = 10.2 Hz, 1 H), 4.12 (d, J = 11.6 Hz, 1 H), 3.92 (s, 3 H), 3.82 (td, J = 11.5, 2.8 Hz, 1 H), 3.20-3.39 (m, 2 H), 2.74 (s, 3 H), 2.62 (s, 3 H) 63 .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.56 (s, 1H), 7.45 (s, 1H), 4.99 460.0 (br d, 1H, J = 13.2 Hz), 4.7-4.9 (m, 1H), 4.59 (dd, 1H, J = 2.8, 10.2 Hz), 4.1-4.1 (m, 1H), 3.93 (s, 3H), 3.79 (dt, 1H, J = 2.9, 11.5 Hz), 3.2-3.4 (m, 2H), 2.70 (s, 3H), 2.65 (s, 3H), 2.6-2.6 (m, 6H) 64 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.80-7.86 (m, 1 H), 7.46 (s, 486.0 1 H), 4.72 (br d, J = 12.72 Hz, 1 H), 4.61 (br s, 1 H), 4.48 (dd, J = 10.35, 2.54 Hz, 1 H), 3.96-4.04 (m, 1 H), 3.60-3.73 (m, 2 H), 3.12-3.28 (m, 2 H), 2.60 (d, J = 4.00 Hz, 6 H), 2.57 (s, 6 H), 0.90- 1.07 (m, 4 H) 65 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.46 (d, J = 5.09 Hz, 1 H), 471.0 7.32 (s, 1 H), 7.24 (br d, J = 4.90 Hz, 1 H), 4.83 (br d, J = 12.72 Hz, 1 H), 4.70 (br s, 1 H), 4.59 (dd, J = 10.35, 2.36 Hz, 1 H), 4.14 (br dd, J = 11.54, 2.45 Hz, 1 H), 3.73 (td, J = 11.67, 2.63 Hz, 1 H), 3.20-3.27 (m, 1 H), 2.92-3.03 (m, 1 H), 2.56-2.65 (m, 11 H), 2.44-2.54 (m, 3 H) 66 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.57 (s, 1 H), 7.46 (s, 1 444.1 H), 5.00 (s, 1 H), 4.83 (d, J = 13.4 Hz, 1 H), 4.60 (dd, J = 10.2, 2.8 Hz, 1 H), 4.08 (dd, J = 26.1, 9.5 Hz, 2 H), 3.93 (s, 3 H), 3.80 (td, J = 11.4, 2.8 Hz, 1 H), 3.33 (dd, J = 29.6, 17.4 Hz, 2 H), 2.71 (s, 3 H), 2.67 (s, 3 H), 2.21-2.34 (m, 2 H), 1.92-2.12 (m, 6 H) 67 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.67 (s, 1 H), 7.53 (s, 1 437.3 H), 4.75 (d, J = 13.4 Hz, 1 H), 4.57 (ddd, J = 18.7, 11.9, 2.6 Hz, 2 H), 4.33 (s, 4 H), 4.02 (ddd, J = 11.4, 3.4, 1.9 Hz, 1 H), 3.90 (s, 3 H), 3.72 (td, J = 11.3, 2.8 Hz, 1 H), 3.10-3.26 (m, 2 H), 2.56 (d, J = 10.9 Hz, 6 H), 1.49-1.56 (m, 4 H), 1.06 (s, 6 H) 68 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 1.79-1.89 (m, 2 H) 2.08- 445.0 2.18 (m, 2 H) 2.52 (s, 3 H) 2.53 (s, 3H) 3.07 (br t, J = 11.53 Hz, 1 H) 3.10-3.18 (m, 1 H) 3.61 (td, J = 11.49, 2.82 Hz, 1 H) 3.82 (s, 3 H) 3.93-4.00 (m, 1 H) 4.15 (br s, 2 H) 4.43-4.55 (m, 2 H) 4.61 (br d, J = 11.26 Hz, 1 H) 4.77 (br s, 2 H) 7.44 (s, 1 H) 7.72 (s, 1 H) 69 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.72 (s, 1 H) 7.44 (s, 1 H) 427.0 4.87 (br s, 1 H) 4.79 (br s, 1 H) 4.61 (br d, J = 11.08 Hz, 1 H) 4.49 (br d, J = 12.72 Hz, 2 H) 4.45 (br dd, J = 10.17, 2.54 Hz, 1 H) 4.13 (br d, J = 17.62 Hz, 1 H) 3.88-3.99 (m, 1 H) 3.82 (s, 3 H) 3.56-3.66 (m, 1 H) 3.17 (d, J = 5.09 Hz, 1 H) 3.08-3.14 (m, 1 H) 3.03-3.08 (m, 1 H) 2.51-2.54 (m, 3 H) 2.37-2.48 (m, 1 H) 1.97 (br d, J = 11.44 Hz, 1 H) 1.90 (br dd, J = 9.08, 5.81 Hz, 3 H) 1.58-1.66 (m, 1 H) 1.19-1.30 (m, 1 H) 70 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.72 (s, 1 H), 7.44 (s, 1 H), 427.0 4.76-4.91 (m, 1 H), 4.62 (br d, J = 11.63 Hz, 1 H), 4.41-4.56 (m, 4 H), 4.04-4.21 (m, 1 H), 3.91-4.00 (m, 1 H), 3.60 (td, J = 11.44, 2.72 Hz, 1 H), 3.24-3.34 (m, 4 H), 3.02-3.24 (m, 4 H), 2.51-2.54 (m, 3 H), 1.97 (br d, J = 10.54 Hz, 1 H), 1.85-1.93 (m, 3 H), 1.57-1.64 (m, 1 H) 71 .sup.1H NMR (400 MHz, Methanol-d4) δ ppm 7.69 (d, J = 3.5 Hz, 1 H), 431.1 7.55 (d, J = 3.3 Hz, 1 H), 4.82 (d, J = 13.8 Hz, 3 H), 4.55-4.70 (m, 4 H), 4.04 (d, J = 11.9 Hz, 2 H), 3.91 (d, J = 3.1 Hz, 3 H), 3.74 (td, J = 11.5, 3.0 Hz, 1 H), 3.14-3.29 (m, 3 H), 2.60 (d, J = 4.8 Hz, 6 H) 72 .sup.1H NMR (400 MHz, Methanol-d4) δ ppm 7.68 (s, 1 H), 7.53-7.55 423.3 (m, 1 H), 4.80 (t, J = 10.9 Hz, 1 H), 4.65 (d, J = 13.7 Hz, 1 H), 4.55 (dd, J = 10.2, 2.8 Hz, 1 H), 4.39 (t, J = 7.1 Hz, 1 H), 4.08 (s, 1 H), 4.00- 4.05 (m, 1 H), 3.91 (s, 3 H), 3.84 (t, J = 7.2 Hz, 1 H), 3.73 (td, J = 11.4, 2.8 Hz, 1 H), 3.53 (s, 1 H), 3.11-3.26 (m, 2 H), 2.56 (d, J = 5.9 Hz, 6 H), 1.89 (t, J = 7.1 Hz, 1 H), 1.77 (t, J = 7.2 Hz, 1 H), 1.18 (d, J = 5.6 Hz, 6 H) 73 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.51-8.55 (m, 1 H), 7.73- 439.0 7.77 (m, 1 H), 7.62-7.67 (m, 1 H), 7.54-7.58 (m, 1 H), 7.47-7.49 (m, 1 H), 7.42-7.46 (m, 1 H), 7.17-7.21 (m, 1 H), 4.56-4.62 (m, 1 H), 4.40-4.45 (m, 1 H), 4.22-4.27 (m, 1 H), 4.01-4.08 (m, 1 H), 3.81-3.85 (m, 3 H), 3.72-3.79 (m, 1 H), 3.07-3.14 (m, 1 H), 3.01- 3.06 (m, 1 H), 2.64-2.67 (m, 3 H) 74 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.82-8.88 (m, 1 H), 7.74- 439.0 7.77 (m, 1 H), 7.62-7.68 (m, 1 H), 7.53-7.59 (m, 1 H), 7.46-7.51 (m, 1 H), 7.42-7.46 (m, 1 H), 7.22-7.28 (m, 1 H), 4.56-4.62 (m, 1 H), 4.36-4.44 (m, 1 H), 4.19-4.26 (m, 1 H), 4.01-4.08 (m, 1 H), 3.80-3.86 (m, 3 H), 3.73-3.78 (m, 1 H), 3.05-3.12 (m, 1 H), 2.98- 3.05 (m, 1 H), 2.53-2.57 (m, 3 H) 75 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.51-8.53 (m, 1 H), 7.78- 453.0 7.81 (m, 1 H), 7.62-7.66 (m, 1 H), 7.54-7.58 (m, 1 H), 7.48-7.51 (m, 1 H), 7.42-7.47 (m, 1 H), 7.18-7.21 (m, 1 H), 4.55-4.62 (m, 1 H), 4.41-4.46 (m, 1 H), 4.23-4.30 (m, 1 H), 4.08-4.15 (m, 2 H), 4.01-4.06 (m, 1 H), 3.72-3.78 (m, 1 H), 3.07-3.14 (m, 1 H), 3.00- 3.06 (m, 1 H), 2.64-2.67 (m, 3 H), 1.35-1.40 (m, 3 H) 76 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.49-8.54 (m, 1 H), 7.79- 465.0 7.87 (m, 1 H), 7.61-7.66 (m, 1 H), 7.54-7.58 (m, 1 H), 7.47-7.49 (m, 1 H), 7.43-7.46 (m, 1 H), 7.17-7.24 (m, 1 H), 4.54-4.59 (m, 1 H), 4.38-4.46 (m, 1 H), 4.23-4.30 (m, 1 H), 4.01-4.06 (m, 1 H), 3.72-3.77 (m, 1 H), 3.65-3.71 (m, 1 H), 3.07-3.14 (m, 1 H), 3.01- 3.06 (m, 1 H), 2.64-2.68 (m, 3 H), 1.00-1.05 (m, 2 H), 0.92-0.97 (m, 2 H) 77 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.52-8.54 (m, 1 H), 8.42- 450.0 8.47 (m, 1 H), 7.63-7.68 (m, 1 H), 7.55-7.59 (m, 1 H), 7.44-7.47 (m, 1 H), 7.37-7.40 (m, 1 H), 7.28-7.31 (m, 1 H), 7.25-7.28 (m, 1 H), 4.65-4.70 (m, 1 H), 4.50-4.55 (m, 1 H), 4.34-4.39 (m, 1 H), 4.14-4.20 (m, 1 H), 3.79-3.85 (m, 1 H), 3.09-3.16 (m, 1 H), 2.86- 2.92 (m, 1 H), 2.64-2.68 (m, 3 H), 2.49-2.50 (m, 3 H) 78 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.44-8.49 (m, 1 H), 8.17- 466.0 8.21 (m, 1 H), 7.57-7.62 (m, 1 H), 7.30-7.33 (m, 1 H), 7.25-7.28 (m, 1 H), 6.98-7.00 (m, 1 H), 6.95-6.98 (m, 1 H), 6.85-6.90 (m, 1 H), 4.62-4.68 (m, 1 H), 4.52-4.60 (m, 1 H), 4.21-4.29 (m, 2 H), 3.96-3.99 (m, 3 H), 3.89-3.96 (m, 1 H), 3.18-3.29 (m, 1 H), 2.97 (dd, J = 13.0, 10.4 Hz, 1 H), 2.71-2.74 (m, 3 H) 79 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.73-7.76 (m, 1 H), 7.61- 453.0 7.66 (m, 1 H), 7.54-7.58 (m, 1 H), 7.47-7.50 (m, 1 H), 7.41-7.45 (m, 1H), 7.17-7.20 (m, 1 H), 4.56-4.61 (m, 1 H), 4.37-4.42 (m, 1 H), 4.19-4.24 (m, 1 H), 4.01-4.07 (m, 1 H), 3.81-3.85 (m, 3 H), 3.73-3.78 (m, 1 H), 3.04-3.10 (m, 1 H), 2.96-3.02 (m, 1 H), 2.64- 2.67 (m, 3 H), 2.52-2.54 (m, 3 H) 80 .sup.1H NMR (500 MHz, Chloroform-d) δ 7.58 (s, 1H), 7.47 (s, 1H), 6.85 447.2 (br s, 1H), 4.84 (quin, J = 8.17 Hz, 1H), 4.72 (dd, J = 2.85, 10.25 Hz, 1H), 4.45 (br d, J = 12.59 Hz, 1H), 4.26 (br d, J = 13.23 Hz, 1H), 4.15- 4.20 (m, 1H), 3.90-3.96 (m, 4H), 3.22 (dt, J = 3.63, 12.13 Hz, 1H), 3.04-3.18 (m, 2H), 2.68-2.76 (m, 7H), 2.67 (s, 3H) 81 .sup.1H NMR (500 MHz, Chloroform-d) δ 7.56 (s, 1H), 7.56 (s, 1H), 6.81 473.2 (s, 1H), 4.84 (quin, J = 8.17 Hz, 1H), 4.71 (dd, J = 2.66, 10.32 Hz, 1H), 4.43 (br d, J = 12.59 Hz, 1H), 4.26 (br d, J = 12.72 Hz, 1H), 4.13-4.21 (m, 1H), 3.93 (dt, J = 2.85, 11.48 Hz, 1H), 3.62 (tt, J = 3.71, 7.31 Hz, 1H), 3.17-3.24 (m, 1H), 3.13 (dd, J = 10.38, 12.72 Hz, 2H), 2.70-2.74 (m, 2H), 2.68 (s, 3H), 2.66 (s, 3H), 1.28 (s, 2H), 1.13-1.18 (m, 2H), 1.02-1.07 (m, 2H) 82 .sup.1H NMR (500 MHz, Chloroform-d) δ 8.56 (d, J = 5.19 Hz, 1H), 7.33 458.0 (br s, 1H), 7.25 (br dd, J = 3.96, 5.13 Hz, 1H), 6.83 (s, 1H), 4.80-4.90 (m, 1H), 4.67-4.74 (m, 1H), 4.53 (br d, J = 12.20 Hz, 1H), 4.34 (br d, J = 13.36 Hz, 1H), 4.25-4.30 (m, 1H), 3.98 (dt, J = 2.79, 11.71 Hz, 1H), 3.22 (dt, J = 3.50, 12.26 Hz, 1H), 3.09-3.17 (m, 1H), 2.95 (dd, J = 10.51, 12.72 Hz, 1H), 2.63-2.76 (m, 13H) 83 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.94-8.98 (m, 1 H), 7.91- 425.0 7.95 (m, 1 H), 7.69-7.77 (m, 3 H), 7.51-7.56 (m, 1 H), 7.44-7.48 (m, 1 H), 7.25-7.29 (m, 1 H), 4.73-4.81 (m, 1 H), 4.61-4.67 (m, 1 H), 4.54 (br dd, J = 10.4, 2.3 Hz, 1 H), 3.98-4.07 (m, 1 H), 3.77- 3.84 (m, 3 H), 3.63-3.72 (m, 1 H), 3.18-3.27 (m, 2 H) 84 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.80 (dd, J = 3.11, 8.30 Hz, 439.0 1H), 7.75 (br s, 1H), 7.70 (dd, J = 1.56, 10.12 Hz, 1H), 7.69 (t, J = 7.79 Hz, 1H), 7.53 (dd, J = 1.82, 8.30 Hz, 1H), 7.46 (br s, 1H), 7.17 (d, J = 8.30 Hz, 1H), 4.66-4.84 (m, 1H), 4.57-4.66 (m, 1H), 4.52 (br dd, J = 2.08, 10.38 Hz, 1H), 3.94-4.08 (m, 1H), 3.82 (s, 3H), 3.60-3.72 (m, 1H), 3.14-3.27 (m, 2H), 2.60 (s, 3H) 85 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.76 (dd, J = 8.3, 3.8 Hz, 1 465.1 H), 7.50-7.58 (m, 3 H), 7.37 (d, J = 8.0 Hz, 1 H), 7.34 (d, J = 8.0 Hz, 1H), 7.04 (d, J = 8.0 Hz, 1 H), 5.12 (bs, 1 H), 4.83-4.91 (m, 1 H), 4.58 (d, J = 10.4 Hz, 1 H), 4.10 (dd, J = 11.6, 1.7 Hz, 1 H), 3.81 (td, J = 11.5, 2.8 Hz, 1 H), 3.55-3.65 (m, 1 H), 3.22-3.44 (m, 2 H), 2.75 (s, 3 H), 0.99-1.20 (m, 4 H) 86 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 9.17 (s, 1H), 7.83 (dd, 451.2 J = 3.37, 8.30 Hz, 1H), 7.67-7.79 (m, 2H), 7.63 (s, 1H), 7.54 (dd, J = 2.08, 8.30 Hz, 1H), 7.20 (d, J = 8.30 Hz, 1H), 4.80-4.97 (m, 1H), 4.60-4.80 (m, 2H), 4.08-4.27 (m, 1H), 3.77 (dt, J = 2.60, 11.68 Hz, 1H), 3.24-3.29 (m, 1H), 3.11 (br dd, J = 10.38, 13.23 Hz, 1H), 2.66 (s, 3H), 2.62 (s, 3H) 87 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 9.17 (s, 1H), 7.83 (dd, 451.2 J = 3.37, 8.30 Hz, 1H), 7.67-7.78 (m, 2H), 7.63 (s, 1H), 7.54 (dd, J = 1.82, 8.30 Hz, 1H), 7.20 (d, J = 8.30 Hz, 1H), 4.81-4.96 (m, 1H), 4.61-4.79 (m, 2H), 4.09-4.22 (m, 1H), 3.77 (dt, J = 2.60, 11.55 Hz, 1H), 3.23-3.29 (m, 1H), 3.11 (br dd, J = 10.64, 12.72 Hz, 1H), 2.66 (s, 3H), 2.62 (s, 3H) 88 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.78 (s, 1 H), 8.03-8.09 (m, 450.1 1 H), 7.91 (s, 1 H), 7.82 (s, 1 H), 7.71-7.78 (m, 2 H), 7.58 (dd, J = 8.3, 2.0 Hz, 1 H), 7.32 (d, J = 8.5 Hz, 1 H), 4.98 (d, J = 13.3 Hz, 1 H), 4.91 (d, J = 10.2 Hz, 1 H), 4.76 (d, J = 13.4 Hz, 1 H), 4.23 (d, J = 11.6 Hz, 1 H), 3.80-3.86 (m, 1 H), 3.33 (t, J = 12.4 Hz, 1 H), 3.11 (t, J = 11.8 Hz, 1 H), 2.70 (d, J = 10.8 Hz, 6 H) 89 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.80 (s, 2H), 7.84 (dd, J = 451.1 8.3, 3.4 Hz, 1H), 7.68-7.76 (m, 2H), 7.54 (dd, J = 8.3, 2.1 Hz, 1H), 7.20 (d, J = 8.3 Hz, 1H), 4.83 (d, J = 13.4 Hz, 1H), 4.66-4.74 (m, 1H), 4.14 (d, J = 11.6 Hz, 1H), 3.69-3.80 (m, 1H), 3.17-3.32 (m, 3H), 2.63 (d, J = 10.3 Hz, 6H) 90 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.80 (s, 2H), 7.84 (dd, J = 451.1 8.3, 3.4 Hz, 1H), 7.68-7.76 (m, 2H), 7.54 (dd, J = 8.3, 2.1 Hz, 1H), 7.20 (d, J = 8.3 Hz, 1H), 4.83 (d, J = 13.4 Hz, 1H), 4.66-4.74 (m, 1H), 4.14 (d, J = 11.6 Hz, 1H), 3.69-3.80 (m, 1H), 3.17-3.32 (m, 3H), 2.63 (d, J = 10.3 Hz, 6H) 91 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.79 (dd, J = 3.37, 8.30 Hz, 423.2 1H), 7.67-7.77 (m, 2H), 7.50 (dt, J = 2.47, 9.93 Hz, 1H), 7.46 (s, 1H), 7.32 (dt, J = 2.47, 8.37 Hz, 1H), 7.17 (d, J = 8.30 Hz, 1H), 4.76 (br d, J = 13.49 Hz, 1H), 4.63 (br d, J = 13.49 Hz, 1H), 4.53 (br dd, J = 2.47, 10.25 Hz, 1H), 3.94-4.07 (m, 1H), 3.82 (s, 3H), 3.67 (dt, J = 2.34, 11.42 Hz, 1H), 3.12-3.27 (m, 2H), 2.61 (s, 3H) 92 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.83 (s, 1H), 7.80 (dd, 449.2 J = 3.37, 8.30 Hz, 1H), 7.67-7.76 (m, 1H), 7.50 (dt, J = 2.34, 9.86 Hz, 1H), 7.46 (s, 1H), 7.32 (dt, J = 2.34, 8.43 Hz, 1H), 7.17 (d, J = 8.30 Hz, 1H), 4.75 (br d, J = 12.72 Hz, 1H), 4.63 (br d, J = 13.49 Hz, 1H), 4.51 (br dd, J = 2.21, 10.25 Hz, 1H), 3.94-4.06 (m, 1H), 3.58-3.76 (m, 2H), 3.16-3.26 (m, 2H), 2.61 (s, 3H), 0.99-1.06 (m, 2H), 0.90-0.96 (m, 2H) 93 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.46 (br d, J = 4.93 Hz, 1H), 434.2 7.81 (dd, J = 3.37, 8.30 Hz, 1H), 7.74 (dt, J = 6.62, 8.50 Hz, 1H), 7.51 (ddd, J = 2.47, 9.47, 10.38 Hz, 1H), 7.29-7.37 (m, 2H), 7.26 (br d, J = 4.15 Hz, 1H), 7.19 (d, J = 8.30 Hz, 1H), 4.86 (br d, J = 12.46 Hz, 1H), 4.71 (br d, J = 13.49 Hz, 1H), 4.62 (br dd, J = 2.60, 10.38 Hz, 1H), 4.08-4.19 (m, 1H), 3.75 (dt, J = 2.34, 11.68 Hz, 1H), 3.21-3.28 (m, 1H), 3.02 (br t, J = 11.68 Hz, 1H), 2.62 (s, 3H), (one Me singlet not observed because of overlap with solvent peak) 94 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 77.70-7.81 (m, 2H), 7.52 (br 419.0 t, J = 7.63, 1H), 7.46 (br s, 1H), 7.21-7.30 (m, 2H), 7.15 (d, J = 8.36, 1H), 4.76 (br d, J = 13.81, 1H), 4.53 (br d, J = 12.90, 1H), 4.52 (br d, J = 9.99, 1H), 4.01 (br d, J = 11.26, 1H), 3.82 (s, 3H), 3.63-3.75 (m, 1H), 3.15-3.24 (m, 2H), 2.60 (s, 3H), 2.43 (s, 3H) 95 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.83 (s, 1H), 7.77 (dd, 445.2 J = 3.37, 8.30 Hz, 1H), 7.52 (t, J = 7.79 Hz, 1H), 7.46 (s, 1H), 7.27 (d, J = 11.42 Hz, 1H), 7.24 (d, J = 7.79 Hz, 1H), 7.16 (d, J = 8.30 Hz, 1H), 4.76 (br d, J = 13.75 Hz, 1H), 4.64 (br d, J = 13.75 Hz, 1H), 4.51 (br dd, J = 2.47, 10.51 Hz, 1H), 4.00 (br d, J = 11.16 Hz, 1H), 3.60-3.73 (m, 2H), 3.13-3.26 (m, 2H), 2.60 (s, 3H), 2.44 (s, 3H), 0.97-1.08 (m, 2H), 0.90-0.97 (m, 2H) 96 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.46 (br d, J = 4.93 Hz, 1H), 430.2 7.79 (dd, J = 3.63, 8.30 Hz, 1H), 7.53 (t, J = 7.79 Hz, 1H), 7.33 (br s, 1H), 7.22-7.32 (m, 3H), 7.18 (d, J = 8.30 Hz, 1H), 4.80-4.96 (m, 1H), 4.72 (br d, J = 13.75 Hz, 1H), 4.62 (dd, J = 2.08, 10.12 Hz, 1H), 4.07- 4.21 (m, 1H), 3.75 (dt, J = 2.72, 11.74 Hz, 1H), 3.19-3.27 (m, 1H), 3.01 (br t, J = 11.68 Hz, 1H), 2.61 (s, 3H), 2.44 (s, 3H) (one Me singlet not observed, likely overlap with solvent peak) 97 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.88 (d, J = 8.30 Hz, 1H), 433.3 7.55 (s, 1H), 7.44 (s, 1H), 7.02 (d, J = 8.30 Hz, 1H), 5.07 (br s, 1H), 4.90 (br d, J = 13.62 Hz, 1H), 4.58 (dd, J = 2.72, 10.25 Hz, 1H), 4.21- 4.32 (m, 1H), 4.10 (br d, J = 10.90 Hz, 1H), 3.90 (s, 3H), 3.79 (dt, J = 2.72, 11.55 Hz, 1H), 3.34 (ddd, J = 3.50, 11.42, 13.49 Hz, 1H), 3.25 (br t, J = 10.77 Hz, 1H), 2.94-3.11 (m, 1H), 2.72-2.83 (m, 2H), 2.68 (s, 3H), 2.58-2.66 (m, 2H) 98 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.91 (br d, J = 8.04 Hz, 459.0 1H), 7.55 (br d, J = 5.19 Hz, 2H), 7.04 (br d, J = 8.17 Hz, 1H), 4.98- 5.19 (m, 1H), 4.92 (br d, J = 13.36 Hz, 1H), 4.58 (br d, J = 9.08 Hz, 1H), 4.28 (quin, J = 8.17 Hz, 1H), 4.08-4.19 (m, 1H), 3.81 (br t, J = 11.03 Hz, 1H), 3.60 (tt, J = 3.42, 6.96 Hz, 1H), 3.31-3.43 (m, 1H), 3.14-3.31 (m, 1H), 2.95-3.12 (m, 1H), 2.75-2.88 (m, 2H), 2.71 (br s, 3H), 2.58-2.70 (m, 2H), 1.09-1.16 (m, 2H), 0.98-1.06 (m, 2H) 99 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.52 (br d, J = 5.06 Hz, 444.2 1H), 7.91 (d, J = 8.17 Hz, 1H), 7.30 (s, 1H), 7.22 (br s, 1H), 7.06 (d, J = 8.17 Hz, 1H), 5.20 (br d, J = 8.43 Hz, 1H), 5.02 (br d, J = 13.36 Hz, 1H), 4.57 (br d, J = 10.12 Hz, 1H), 4.29 (quin, J = 8.08 Hz, 1H), 4.22 (br d, J = 11.42 Hz, 1H), 3.85 (br t, J = 10.77 Hz, 1H), 3.32 (dt, J = 2.60, 11.42 Hz, 1H), 2.95-3.16 (m, 2H), 2.73-2.86 (m, 2H), 2.71 (s, 3H), 2.64-2.70 (m, 2H), 2.61 (s, 3H) 100 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.47 (d, J = 8.17 Hz, 1 H), 445.2 7.74 (s, 1 H), 7.46 (s, 1 H), 7.15 (d, J = 8.36 Hz, 1 H), 4.76 (br d, J = 12.35 Hz, 1 H), 4.62 (br s, 1 H), 4.49 (dd, J = 10.26, 2.45 Hz, 1 H), 4.00 (br d, J = 11.63 Hz, 1 H), 3.64 (td, J = 11.44, 2.54 Hz, 1 H), 3.08- 3.28 (m, 5 H), 2.56-2.61 (m, 8 H) 101 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.38 (d, J = 4.90 Hz, 1 H), 471.2 8.22-8.30 (m, 1 H), 7.16-7.29 (m, 1 H), 6.65-6.75 (m, 1 H), 4.84- 4.92 (m, 1H), 4.27-4.37 (m, 1 H), 4.16-4.25 (m, 1 H), 3.85-4.03 (m, 1 H), 3.65-3.78 (m, 1 H), 3.55 (br d, J = 10.54 Hz, 1 H), 3.40- 3.50 (m, 2 H), 3.13-3.31 (m, 3 H), 2.68-2.89 (m, 2 H), 2.19-2.32 (m, 1 H), 1.75-2.03 (m, 5 H), 1.33-1.43 (m, 2 H), 0.91-0.96 (m, 2 H) 102 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.44-8.52 (m, 2 H), 7.32 (s, 456.2 1 H), 7.25 (br d, J = 4.72 Hz, 1 H), 7.17 (d, J = 8.36 Hz, 1 H), 4.86 (br d, J = 12.90 Hz, 1 H), 4.71 (br s, 1 H), 4.55-4.61 (m, 1 H), 4.14 (br dd, J = 11.53, 2.27 Hz, 1 H), 3.72 (td, J = 11.67, 2.63 Hz, 1 H), 3.15- 3.30 (m, 4 H), 2.97 (br s, 1 H), 2.56-2.63 (m, 9 H) 103 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.75 (s, 1 H), 7.63-7.72 (m, 453.0 2 H), 7.60 (d, J = 2.3 Hz, 1 H), 7.52 (dd, J = 8.2, 1.9 Hz, 1 H), 7.46 (s, 1 H), 4.73 (br d, J = 12.3 Hz, 1 H), 4.60 (br d, J = 13.4 Hz, 1 H), 4.52 (dd, J = 10.4, 2.6 Hz, 1 H), 4.00 (br d, J = 11.3 Hz, 1 H), 3.82 (s, 3 H), 3.67 (td, J = 11.5, 2.7 Hz, 1 H), 3.11-3.26 (m, 2 H), 2.57 (s, 3 H), 2.29 (s, 3 H) 104 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 9.17 (s, 1H), 7.65-7.75 (m, 465.2 2H), 7.62-7.64 (m, 2H), 7.54 (dd, J = 1.82, 8.30 Hz, 1H), 4.86 (br d, J = 13.23 Hz, 1H), 4.73 (dd, J = 2.60, 10.64 Hz, 1H), 4.68 (br d, J = 13.23 Hz, 1H), 4.10-4.21 (m, 1H), 3.77 (dt, J = 2.60, 11.68 Hz, 1H), 3.21-3.27 (m, 1H), 3.07 (dd, J = 10.64, 12.98 Hz, 1H), 2.66 (s, 3H), 2.59 (s, 3H), 2.31 (s, 3H) 105 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 9.16 (s, 1H), 7.66-7.73 (m, 465.2 2H), 7.62-7.64 (m, 2H), 7.53 (dd, J = 1.82, 8.30 Hz, 1H), 4.86 (br d, J = 12.72 Hz, 1H), 4.73 (dd, J = 2.47, 10.51 Hz, 1H), 4.68 (br d, J = 13.49 Hz, 1H), 4.08-4.22 (m, 1H), 3.77 (dt, J = 2.72, 11.61 Hz, 1H), 3.19-3.28 (m, 1H), 3.07 (dd, J = 10.64, 12.98 Hz, 1H), 2.66 (s, 3H), 2.59 (s, 3H), 2.31 (s, 3H) 106 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.79 (s, 2 H), 7.61-7.74 (m, 465.1 3 H), 7.53 (d, J = 8.0 Hz, 1 H), 4.80 (d, J = 13.2 Hz, 1 H), 4.69 (t, J = 11.4 Hz, 2 H), 4.14 (d, J = 11.7 Hz, 1 H), 3.75 (dd, J = 12.6, 9.8 Hz, 1 H), 3.17-3.28 (m, 2 H), 2.64 (s, 3 H), 2.59 (s, 3 H), 2.31 (s, 3 H) 107 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.79 (s, 2 H), 7.61-7.74 (m, 465.1 3 H), 7.53 (d, J = 8.0 Hz, 1 H), 4.80 (d, J = 13.2 Hz, 1 H), 4.69 (t, J = 11.4 Hz, 2 H), 4.14 (d, J = 11.7 Hz, 1 H), 3.75 (dd, J = 12.6, 9.8 Hz, 1 H), 3.17-3.28 (m, 2 H), 2.64 (s, 3 H), 2.59 (s, 3 H), 2.31 (s, 3 H) 108 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.93 (s, 1H), 7.73 (s, 1H), 445.2 7.46 (s, 1H), 4.67 (br d, J = 12.17 Hz, 1H), 4.51-4.59 (m, 3H), 4.47 (dd, J = 2.54, 10.35 Hz, 1H), 3.95-4.01 (m, 1H), 3.82 (s, 3H), 3.63 (dt, J = 2.63, 11.49 Hz, 1H), 3.07-3.20 (m, 2H), 2.65-2.82 (m, 3H), 2.53- 2.64 (m, 2H), 2.51 (s, 3H), 2.31 (s, 3H) 109 2.17:1 mixture of trans and cis cyclobutane isomers. 477.2 Major isomer: .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.96 (s, 1H), 7.74 (s, 1H), 7.46 (s, 1H), 4.68 (br d, J = 12.53 Hz, 1H), 4.45-4.60 (m, 1H), 4.53 (br d, J = 6.72 Hz, 2H) 4.45-4.47 (m, 1H), 3.93-4.01 (m, 1H), 3.82 (s, 3H), 3.59-3.66 (m, 1H), 3.21-3.28 (m, 1H), 3.07-3.20 (m, 2H), 2.78-2.91 (m, 1H), 2.51 (s, 3H), 2.32 (s, 3H), 2.16-2.30 (m, 3H), 2.04-2.11 (m, 1H) Minor isomer: .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.92 (s, 1H), 7.73 (s, 1H), 7.45 (s, 1H), 4.68 (br d, J = 12.53 Hz, 1H), 4.45-4.60 (m, 1H), 4.45- 4.47 (m, 1H), 4.44 (d, J = 5.45 Hz, 2H), 3.93-4.01 (m, 1H), 3.82 (s, 3H), 3.59-3.66 (m, 1H), 3.07-3.20 (m, 3H), 2.78-2.84 (m, 1H), 2.51 (s, 3H), 2.31 (s, 3H), 2.16-2.30 (m, 4H). 110 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.93 (s, 1H), 7.73 (s, 1H), 463.2 7.45 (s, 1H), 4.67 (br d, J = 12.17 Hz, 1H), 4.55 (br d, J = 13.08 Hz, 1H), 4.43-4.52 (m, 2H), 4.33-4.43 (m, 1H), 3.92-4.03 (m, 1H), 3.82 (s, 3H), 3.62 (dt, J = 2.54, 11.44 Hz, 1H), 3.02-3.21 (m, 2H), 2.51 (s, 3H), 2.32 (s, 3H), 2.02-2.12 (m, 1H), 1.73-1.83 (m, 1H), 1.01-1.09 (m, 2H) 111 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.92 (s, 1H), 7.73 (s, 1H), 423.3 7.45 (s, 1H), 4.61-4.73 (m, 2H), 4.55 (br d, J = 13.26 Hz, 1H), 4.47 (dd, J = 2.45, 10.26 Hz, 1H), 4.27-4.38 (m, 1H), 3.98 (br d, J = 11.63 Hz, 1H), 3.82 (s, 3H), 3.62 (dt, J = 2.18, 11.44 Hz, 1H), 3.06-3.19 (m, 2H), 2.51 (s, 3H), 2.33 (s, 3H), 1.11-1.20 (m, 4H), 1.08 (d, J = 1.09 Hz, 3H), 0.58 (dd, J = 4.18, 8.54 Hz, 1H), 0.34-0.42 (m, 1H) 112 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.97 (s, 1 H), 7.75 (s, 1 H), 447.0 7.47 (s, 1 H), 4.80 (br d, J = 11.63 Hz, 1 H), 4.68 (br s, 1 H), 4.51 (dd, J = 10.35, 2.54 Hz, 1 H), 4.31-4.40 (m, 1 H), 3.98-4.06 (m, 1 H), 3.83 (s, 3 H), 3.67 (td, J = 11.49, 2.63 Hz, 1 H), 3.09-3.28 (m, 3 H), 2.65-2.77 (m, 2 H), 2.59-2.65 (m, 2 H), 2.51-2.54 (m, 3 H), 2.34 (s, 3 H) 113 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.97 (s, 1 H), 7.84 (s, 1 H), 473.0 7.47 (s, 1 H), 4.79 (br d, J = 12.35 Hz, 1 H), 4.69 (br s, 1 H), 4.50 (dd, J = 10.35, 2.54 Hz, 1 H), 4.35 (quin, J = 8.22 Hz, 1 H), 3.98-4.05 (m, 1 H), 3.62-3.74 (m, 2 H), 3.13-3.24 (m, 2 H), 2.65-2.76 (m, 2 H), 2.58-2.65 (m, 2H), 2.51-2.54 (m, 3 H), 2.34 (s, 3 H), 0.90-1.08 (m, 4 H) 114 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 9.16-9.20 (m, 1 H), 8.01 (s, 459.0 1 H), 7.64 (s, 1 H), 4.94 (br d, J = 11.81 Hz, 1 H), 4.77 (br s, 1 H), 4.72 (dd, J = 10.26, 2.63 Hz, 1 H), 4.29-4.43 (m, 1 H), 4.17 (br dd, J = 11.63, 2.00 Hz, 1 H), 3.77 (td, J = 11.63, 2.54 Hz, 1 H), 3.13-3.29 (m, 2 H), 3.07 (br s, 1 H), 2.68-2.77 (m, 2 H), 2.57-2.68 (m, 5 H), 2.51-2.55 (m, 3 H), 2.33-2.39 (m, 3 H) 115 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.46 (d, J = 4.90 Hz, 1 H), 458.0 7.99 (s, 1 H), 7.33 (s, 1 H), 7.26 (br d, J = 4.90 Hz, 1 H), 4.90 (br d, J = 11.63 Hz, 1 H), 4.78 (br s, 1 H), 4.60 (dd, J = 10.45, 2.45 Hz, 1 H), 4.29-4.41 (m, 1 H), 4.16 (br dd, J = 11.44, 2.36 Hz, 1 H), 3.75 (td, J = 11.63, 2.54 Hz, 1 H), 3.18-3.27 (m, 2 H), 2.87-3.06 (m, 1 H), 2.52-2.75 (m, 7 H), 2.50 (s, 3 H), 2.32-2.39 (m, 3 H) 116 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.91 (d, J = 2.91 Hz, 1 H), 472.8 7.74 (br s, 1 H), 7.67-7.73 (m, 2 H), 7.53 (br d, J = 7.99 Hz, 1 H), 7.45 (br s, 1 H), 4.75 (br s, 1 H), 4.62 (br d, J = 13.08 Hz, 1 H), 4.52 (br d, J = 9.81 Hz, 1 H), 3.85-4.03 (m, 1 H), 3.62-3.78 (m, 1 H), 3.19-3.31 (m, 4 H), 2.68 (s, 3 H) 117 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.56 (s, 1H), 7.45 (s, 1H), 436.0 6.94 (s, 1H), 4.66 (dd, J = 2.72, 10.25 Hz, 1H), 4.39-4.44 (m, 1H), 4.31 (s, 2H), 4.15-4.21 (m, 1H), 4.12 (ddd, J = 1.82, 3.44, 11.61 Hz, 1H), 3.93 (s, 3H), 3.86 (dt, J = 2.72, 11.48 Hz, 1H), 3.55 (quin, J = 8.66 Hz, 1H), 3.20 (s, 3H), 3.12-3.20 (m, 1H), 3.08 (dd, J = 10.25, 12.85 Hz, 1H), 2.95-3.04 (m, 1H), 2.64-2.74 (m, 2H), 2.41-2.52 (m, 2H) 118 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.70 (t, J = 8.2 Hz, 1 H), 7.62 376.1 (dd, J = 10.5, 2.1 Hz, 1 H), 7.45 (d, J = 8.4 Hz, 1 H), 7.13 (s, 1 H), 4.39 (s, 2 H), 4.14-4.28 (m, 2 H), 3.92 (d, J = 11.5 Hz, 1 H), 3.52- 3.64 (m, 2 H), 3.06 (s, 3 H), 2.82-2.91 (m, 1 H), 2.54-2.61 (m, 1 H), 1.17 (d, J = 6.2 Hz, 3 H) 119 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.67 (t, J = 7.8 Hz, 1 H), 442.1 7.51 (s, 1 H), 7.40 (s, 1 H), 7.30-7.35 (m, 1 H), 7.26-7.30 (m, 1 H), 5.00 (d, J = 14.7 Hz, 2 H), 3.91 (s, 3 H), 3.62 (t, J = 12.2 Hz, 2 H), 3.19-3.34 (m, 1 H), 2.74 (s, 3 H), 2.62 (s, 3 H), 2.21-2.39 (m, 1 H), 2.09 (dt, J = 29.8, 12.8 Hz, 1 H) 120 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.8-7.9 (m, 1H), 7.7-7.7 (m, 468.0 1H), 7.6-7.6 (m, 1H), 7.4-7.5 (m, 1H), 7.43 (dd, 1H, J = 2.0, 8.4 Hz), 7.2-7.2 (m, 1H), 4.5-4.6 (m, 1H), 4.40 (s, 2H), 4.35 (br d, 1H, J = 12.7 Hz), 4.21 (br d, 1H, J = 12.2 Hz), 4.0-4.0 (m, 1H), 3.6-3.7 (m, 2H), 3 3.0-3.1 (s, 3H), 3.00 (dt, 1H, J = 2.9, 12.4 Hz), 2.9-3.0 (m, 1H), 0.9- 1.0 (m, 4H) 121 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.74 (s, 1 H), 7.70 (d, J = 8.2 456.1 Hz, 1 H), 7.62 (dd, J = 10.5, 2.1 Hz, 1 H), 7.47 (s, 1 H), 7.44 (dd, J = 8.3, 2.1 Hz, 1 H), 7.20 (s, 1 H), 4.54 (d, J = 10.4 Hz, 1 H), 4.42 (s, 2 H), 4.35 (d, J = 12.8 Hz, 1 H), 4.20 (d, J = 12.8 Hz, 1 H), 4.00 (d, J = 7.6 Hz, 1 H), 3.81 (s, 3 H), 3.42-3.79 (m, 3 H), 2.87-3.06 (m, 2 H), 1.15 (t, J = 7.2 Hz, 3 H) 122 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.70-7.76 (m, 2 H), 7.62 (d, 470.1 J = 10.4 Hz, 1 H), 7.46 (s, 1 H), 7.42-7.45 (m, 1 H), 7.20 (s, 1 H), 4.54 (d, J = 10.4 Hz, 1 H), 4.40-4.47 (m, 1 H), 4.33-4.38 (m, 3 H), 4.19 (d, J = 12.8 Hz, 1 H), 3.96-4.06 (m, 1 H), 3.82 (s, 3 H), 3.67- 3.75 (m, 1 H), 2.86-3.06 (m, 2 H), 1.21 (d, J = 6.7 Hz, 6 H) 123 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.67 (t, J = 7.8 Hz, 1 H), 488.1 7.51 (s, 1 H), 7.40 (s, 1 H), 7.30-7.35 (m, 1 H), 7.26-7.30 (m, 1 H), 5.00 (d, J = 14.7 Hz, 2 H), 3.91 (s, 3 H), 3.62 (t, J = 12.2 Hz, 2 H), 3.19-3.34 (m, 1 H), 2.74 (s, 3 H), 2.62 (s, 3 H), 2.21-2.39 (m, 1 H), 2.09 (dt, J = 29.8, 12.8 Hz, 1 H) 124 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.67 (t, J = 7.8 Hz, 1 H), 488.1 7.51 (s, 1 H), 7.40 (s, 1 H), 7.30-7.35 (m, 1 H), 7.26-7.30 (m, 1 H), 5.00 (d, J = 14.7 Hz, 2 H), 3.91 (s, 3 H), 3.62 (t, J = 12.2 Hz, 2 H), 3.19-3.34 (m, 1 H), 2.74 (s, 3 H), 2.62 (s, 3 H), 2.21-2.39 (m, 1 H), 2.09 (dt, J = 29.8, 12.8 Hz, 1 H) 125 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.57 (d, J = 0.8 Hz, 1 H), 442.2 7.46 (s, 1 H), 7.42 (s, 1 H), 4.99 (d, J = 12.8 Hz, 1 H), 4.82 (d, J = 13.5 Hz, 1 H), 4.60 (dd, J = 10.3, 2.8 Hz, 1 H), 4.11 (ddd, J = 11.6, 3.6, 1.8 Hz, 1 H), 3.93 (s, 3 H), 3.80 (td, J = 11.5, 2.8 Hz, 1 H), 3.22-3.40 (m, 2 H), 3.02 (s, 2 H), 2.86-2.98 (m, 2 H), 2.71 (s, 3 H), 2.25 (tt, J = 13.7, 6.7 Hz, 2H) 126 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.75 (s, 1 H), 7.46 (s, 1 H), 474.8 7.43 (br s, 1 H), 4.72 (br d, J = 12.9 Hz, 1 H), 4.60 (br d, J = 12.4 Hz, 1 H), 4.50 (br dd, J = 10.2, 1.8 Hz, 1 H), 4.01 (br d, J = 10.5 Hz, 1 H), 3.83 (s, 3 H), 3.57-3.73 (m, 1 H), 3.12-3.25 (m, 2 H), 2.81 (br s, 1 H), 2.70 (br d, J = 15.4 Hz, 2 H), 2.61-2.64 (m, 1 H), 2.60 (s, 3 H), 2.58 (s, 3 H), 2.31-2.42 (m, 1 H), 2.11 (br d, J = 10.5 Hz, 1 H), 1.59 (qd, J = 12.0, 5.3 Hz, 1 H) 127 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.75 (s, 1 H), 7.46 (s, 1 H), 474.0 7.42 (br s, 1 H), 4.72 (br d, J = 12.9 Hz, 1 H), 4.60 (br d, J = 11.6 Hz, 1 H), 4.50 (br dd, J = 10.3, 2.1 Hz, 1 H), 4.01 (br d, J = 10.5 Hz, 1 H), 3.83 (s, 3 H), 3.60-3.69 (m, 1 H), 3.13-3.25 (m, 2 H), 2.84 (br d, J = 16.9 Hz, 1 H), 2.65-2.76 (m, 2 H), 2.61-2.64 (m, 1 H), 2.60 (s, 3 H), 2.58 (s, 3 H), 2.31-2.43 (m, 1 H), 2.11 (br d, J = 10.4 Hz, 1 H), 1.60 (qd, J = 12.1, 5.2 Hz, 1 H) 128 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.86 (td, J = 2.8, 1.4 Hz, 1 H), 392.2 7.76 (s, 1 H), 7.47 (d, J = 0.8 Hz, 1 H), 4.73 (d, J = 12.9 Hz, 1 H), 4.61 (d, J = 13.6 Hz, 1 H), 4.50 (dd, J = 10.4, 2.7 Hz, 1 H), 3.83 (s, 3 H), 3.65 (td, J = 11.5, 2.8 Hz, 1 H), 3.18 (dt, J = 23.0, 11.4 Hz, 2 H), 2.91 (s, 2 H), 2.53-2.73 (m, 9 H), 1.92 (p, J = 7.6 Hz, 2 H) 129 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.49-8.55 (m, 1 H), 7.98 (s, 481.0 1 H), 7.62-7.68 (m, 2 H), 7.53-7.58 (m, 1 H), 7.42-7.47 (m, 1 H), 7.19-7.24 (m, 1 H), 5.51-5.61 (m, 1 H), 4.87-4.94 (m, 4 H), 4.58- 4.65 (m, 1 H), 4.42-4.48 (m, 1 H), 4.24-4.29 (m, 1 H), 4.01-4.09 (m, 1 H), 3.73-3.80 (m, 1 H), 3.09-3.14 (m, 1 H), 3.02-3.07 (m, 1 H), 2.63-2.68 (m, 3 H) 130 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.57 (s, 1H), 7.46 (s, 1H), 436.3 5.02 (d, J = 13.5 Hz, 1H), 4.85 (d, J = 13.6 Hz, 1H), 4.62 (dd, J = 10.1, 2.8 Hz, 1H), 4.11 (d, J = 11.4 Hz, 1H), 3.93 (s, 3H), 3.76-3.89 (m, 2H), 3.35 (dd, J = 28.4, 16.1 Hz, 2H), 2.68 (d, J = 15.3 Hz, 6H), 1.91 (q, J = 12.8, 11.3 Hz, 2H), 1.76 (dd, J = 13.8, 3.6 Hz, 2H), 1.48 (td, J = 13.2, 3.9 Hz, 4H), 1.03 (d, J = 6.2 Hz, 6H) 131 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.76 (s, 1 H), 7.48 (d, J = 0.8 476.3 Hz, 1 H), 4.76 (d, J = 13.5 Hz, 1 H), 4.63 (d, J = 13.5 Hz, 1 H), 4.50 (dt, J = 10.3, 2.6 Hz, 2 H), 4.01 (ddd, J = 11.5, 3.6, 1.7 Hz, 1 H), 3.90 (ddd, J = 11.5, 3.6, 1.7 Hz, 2 H), 3.83 (td, J = 11.5, 2.5 Hz, 2 H), 3.2 (dt, J = 21.8, 12.2 Hz, 3 H), 2.60 (d, J = 10.9 Hz, 6 H), 2.02-1.96 (m, 4 H), 1.76-1.67 (q, J = 13.3 Hz, 2 H), 1.50-1.45 (qd, J = 12.1, 5.3 Hz, 2 H) 132 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.72 (s, 1 H), 7.42 (d, J = 0.8 476.3 Hz, 1 H), 4.72 (d, J = 13.5 Hz, 1 H), 4.61 (d, J = 13.5 Hz, 1 H), 4.50 (dt, J = 10.3, 2.6 Hz, 1 H), 4.01 (ddd, J = 11.5, 3.6, 1.7 Hz, 1 H), 3.83 (s, 3 H), 3.66 (td, J = 11.5, 2.5 Hz, 1 H), 3.19 (dt, J = 21.8, 12.2 Hz, 3 H), 2.82 (s, 1 H), 2.70 (s, 2 H), 2.60 (d, J = 10.9 Hz, 6 H), 2.36-2.48 (m, 2 H), 2.12 (d, J = 13.3 Hz, 2 H), 1.60 (qd, J = 12.1, 5.3 Hz, 2 H) 133 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.57 (s, 1 H), 7.46 (s, 1 444.1 H), 5.00 (s, 1 H), 4.83 (d, J = 13.4 Hz, 1 H), 4.60 (dd, J = 10.2, 2.8 Hz, 1 H), 4.08 (dd, J = 26.1, 9.5 Hz, 2 H), 3.93 (s, 3 H), 3.80 (td, J = 11.4, 2.8 Hz, 1 H), 3.33 (dd, J = 29.6, 17.4 Hz, 2 H), 2.71 (s, 3 H), 2.67 (s, 3 H), 2.21-2.34 (m, 2 H), 1.92-2.12 (m, 6 H) 134 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.58 (s, 1H), 7.47 (s, 1H), 408.2 5.02 (d, J = 13.5 Hz, 1H), 4.85 (d, J = 13.6 Hz, 1H), 4.61 (dd, J = 10.2, 2.8 Hz, 1H), 4.10 (d, J = 11.5 Hz, 1H), 3.93 (s, 4H), 3.81 (td, J = 11.4, 2.8 Hz, 1H), 3.33 (dd, J = 28.6, 16.1 Hz, 2H), 2.68 (d, J = 13.4 Hz, 6H), 2.03 (s, 1H), 1.87 (dt, J = 28.9, 13.0 Hz, 4H), 1.65- 1.73 (m, 2H), 1.53 (t, J = 12.7 Hz, 2H), 1.36 (t, J = 12.6 Hz, 1H) 135 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.57 (d, J = 0.7 Hz, 1H), 422.3 7.46 (s, 1H), 5.03 (d, J = 13.6 Hz, 1H), 4.85 (d, J = 13.6 Hz, 1H), 4.62 (dd, J = 10.1, 2.8 Hz, 1H), 4.11 (d, J = 11.4 Hz, 1H), 4.01 (dq, J = 9.6, 5.5, 4.7 Hz, 1H), 3.93 (s, 3H), 3.82 (td, J = 11.4, 2.8 Hz, 1H), 3.35 (dd, J = 29.3, 16.7 Hz, 2H), 2.68 (d, J = 15.3 Hz, 6H), 1.90- 2.05 (m, 3H), 1.70-1.81 (m, 4H), 1.60-1.63 (m, 2H), 1.06 (d, J = 7.0 Hz, 3H) 136 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.58 (s, 1H), 7.46 (s, 1H), 422.3 5.01 (d, J = 13.6 Hz, 1H), 4.84 (d, J = 13.5 Hz, 1H), 4.60 (dd, J = 10.2, 2.8 Hz, 1H), 4.06-4.15 (m, 1H), 3.77-3.96 (m, 5H), 3.33 (dd, J = 28.7, 15.4 Hz, 2H), 2.68 (d, J = 14.3 Hz, 6H), 1.81-1.99 (m, 4H), 1.69-1.78 (m, 2H), 1.52 (s, 1H), 1.23 (qd, J = 12.8, 3.4 Hz, 2H), 0.99 (d, J = 6.5 Hz, 3H) 137 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.58 (s, 1H), 7.47 (s, 1H), 434.3 5.03 (d, J = 13.5 Hz, 1H), 4.86 (d, J = 13.7 Hz, 1H), 4.60-4.68 (m, 1H), 4.11 (d, J = 11.6 Hz, 1H), 3.93 (s, 4H), 3.82 (td, J = 11.4, 2.8 Hz, 1H), 3.35 (dd, J = 28.0, 15.9 Hz, 2H), 2.69 (d, J = 12.9 Hz, 6H), 2.05 (td, J = 12.9, 3.9 Hz, 2H), 1.88 (q, J = 12.6 Hz, 4H), 1.02 (d, J = 13.1 Hz, 2H), 0.28-0.44 (m, 4H) 138 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.85 (s, 1 H), 7.47 (s, 1 H), 470.3 4.67-4.74 (m, 1 H), 4.61 (s, 1 H), 4.50 (dd, J = 10.3, 2.7 Hz, 1 H), 4.01 (d, J = 11.1 Hz, 2 H), 3.71 (qd, J = 7.8, 3.4 Hz, 1 H), 3.64 (dd, J = 11.5, 2.8 Hz, 1 H), 3.20 (dd, J = 11.4, 3.2 Hz, 2 H), 2.63 (s, 3 H), 2.61 (s, 3 H), 2.13 (d, J = 14.9 Hz, 3 H), 1.99 (d, J = 12.5 Hz, 3 H), 1.90 (t, J = 11.4 Hz, 2 H), 1.00-1.08 (m, 2 H), 0.92-1.00 (m, 2 H) 139 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.54 (d, J = 5.2 Hz, 1 H), 7.32 455.1 (s, 1 H), 7.26 (s, 1 H), 5.11 (s, 1 H), 4.92 (d, J = 14.0 Hz, 1 H), 4.57 (dd, J = 10.5, 2.8 Hz, 1 H), 4.21 (d, J = 11.6 Hz, 1 H), 4.00-4.11 (m, 1 H), 3.83 (td, J = 11.7, 2.8 Hz, 1 H), 3.30 (t, J = 12.3 Hz, 1 H), 3.02 (s, 1 H), 2.72 (s, 3 H), 2.74-2.62 (m, 1 H), 2.67 (s, 3 H), 2.63 (s, 3 H), 2.27 (d, J = 15.3 Hz, 2 H), 2.05 (s, 5 H) 140 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.76 (s, 1 H), 7.47 (s, 1 H), 394.3 4.73 (d, J = 12.7 Hz, 1 H), 4.62 (s, 1 H), 4.51 (dd, J = 10.4, 2.7 Hz, 1 H), 4.29 (p, J = 7.9 Hz, 1 H), 4.01 (ddd, J = 11.4, 3.5, 1.7 Hz, 1 H), 3.83 (s, 3 H), 3.66 (td, J = 11.5, 2.8 Hz, 1 H), 3.22 (ddd, J = 13.3, 11.4, 3.5 Hz, 1 H), 2.53-2.67 (m, 6 H), 2.46 (q, J = 1.8 Hz, 1 H), 2.04 (ddd, J = 13.4, 8.0, 4.4 Hz, 2 H), 1.78-1.90 (m, 6 H) 141 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 8.11 (dd, J = 13.7, 8.3 Hz, 1 429.1 H), 7.57 (s, 1 H), 7.46 (s, 1 H), 7.06 (dd, J = 13.5, 8.3 Hz, 1 H), 5.05 (s, 1 H), 4.86 (d, J = 13.4 Hz, 1 H), 4.59 (dd, J = 10.2, 2.8 Hz, 1 H), 4.11 (d, J = 11.5 Hz, 1 H), 3.93 (d, J = 1.5 Hz, 3 H), 3.80 (td, J = 11.5, 2.8 Hz, 1 H), 3.34 (ddd, J = 48.1, 24.4, 11.5 Hz, 3 H), 2.87 (d, J = 11.3 Hz, 1 H), 2.73 (s, 3 H), 2.29 (dd, J = 20.2, 12.7 Hz, 2 H), 2.03 (tt, J = 43.6, 13.4 Hz, 5 H) 142 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.08 (d, J = 8.2 Hz, 1 H), 461.2 7.56 (s, 1 H), 7.44 (s, 1 H), 7.05 (d, J = 8.3 Hz, 1 H), 4.83 (s, 1 H), 4.57-4.62 (m, 1 H), 4.11 (d, J = 11.7 Hz, 1 H), 3.92 (d, J = 1.2 Hz, 3 H), 3.80 (t, J = 11.3 Hz, 2 H), 3.68 (d, J = 5.4 Hz, 1 H), 3.37 (d, J = 10.4 Hz, 2 H), 3.26 (s, 2 H), 2.71 (d, J = 1.2 Hz, 3 H), 2.28 (s, 1 H), 2.14 (m, 3 H), 1.87 (m, 3 H) 143 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.46 (d, J = 8.4 Hz, 1 H), 7.85 455.2 (s, 1 H), 7.47 (s, 1 H), 7.20 (d, J = 8.4 Hz, 1 H), 4.73 (d, J = 13.2 Hz, 1 H), 4.63 (bs, 1 H), 4.49 (d, J = 10.3 Hz, 1 H), 4.01 (d, J = 11.5 Hz, 1 H), 3.61-3.79 (m, 3 H), 3.14-3.26 (m, 2 H), 2.58 (s, 3 H), 2.10- 2.21 (m, 4 H), 1.80-1.99 (m, 4 H), 1.01-1.06 (m, 2 H), 0.99-1.06 (m, 2 H) 144 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.10 (d, J = 8.4 Hz, 1 H), 487.1 7.57 (s, 1 H), 7.55 (s, 1 H), 7.07 (d, J = 8.4 Hz, 1 H), 5.02 (bs, 1 H), 4.87 (d, J = 13.5 Hz, 1 H), 4.57 (d, J = 10.4 Hz, 1 H), 4.10 (d, J = 11.7 Hz, 1 H), 3.79 (td, J = 11.5, 2.9 Hz, 1 H), 3.60-3.65 (m, 1H), 3.16- 3.40 (m, 3 H), 2.71 (s, 3 H), 1.98-2.24 (m, 5 H), 1.82 (q, J = 13.0 Hz, 2 H), 1.65-1.80 (m, 2 H), 1.10-1.19 (m, 2 H), 1.01-1.07 (m, 2 H) 145 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.08 (d, J = 8.4 Hz, 1 H), 7.55 487.1 (s, 1 H), 7.52 (s, 1 H), 7.05 (d, J = 8.3 Hz, 1 H), 4.85 (bs, 1 H), 4.57 (d, J = 10.3 Hz, 1 H), 4.11 (d, J = 11.6 Hz, 1 H), 3.80 (td, J = 11.5, 2.8 Hz, 1 H), 3.68 (t, J = 5.0 Hz, 1 H), 3.52-3.63 (m, 1 H), 3.34 (t, J = 12.1 Hz, 1 H), 3.16-3.30 (m, 2 H), 2.71 (s, 3 H), 2.13-2.22 (m, 1 H), 2.01-2.11 (m, 4 H), 1.78-1.96 (m, 4 H), 1.10-1.19 (m, 2 H), 1.01-1.07 (m, 2 H) 146 .sup.1H NMR (Chloroform-d, 500 MHz) δ 7.5-7.6 (m, 1H), 7.45 (s, 1H), 416.0 5.03 (br d, 1H, J = 12.8 Hz), 4.8-4.9 (m, 1H), 4.61 (dd, 1H, J = 2.8, 10.2 Hz), 4.4-4.6 (m, 1H), 4.13 (br d, 1H, J = 10.4 Hz), 3.93 (s, 3H), 3.81 (dt, 1H, J = 2.9, 11.5 Hz), 3.38 (ddd, 1H, J = 3.5, 11.3, 13.5 Hz), 3.2-3.3 (m, 1H), 3.0-3.1 (m, 4H), 2.71 (s, 3H), 2.65 (s, 3H) 147 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.55-7.58 (m, 1 H), 7.48- 437.0 7.53 (m, 2 H), 7.44-7.48 (m, 2 H), 7.29-7.33 (m, 1 H), 7.28-7.29 (m, 1 H), 7.25-7.28 (m, 1 H), 7.07-7.11 (m, 1 H), 6.78-6.83 (m, 1 H), 4.70-4.75 (m, 1 H), 4.30-4.35 (m, 1 H), 4.12-4.17 (m, 1 H), 4.05-4.12 (m, 1 H), 3.93-3.98 (m, 1 H), 3.90-3.93 (m, 3 H), 3.09- 3.17 (m, 1 H), 3.00-3.07 (m, 1 H), 2.47-2.51 (m, 3 H) 148 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.73-7.79 (m, 2 H), 7.59- 438.0 7.67 (m, 2 H), 7.47-7.51 (m, 2 H), 7.13-7.18 (m, 2 H), 4.55-4.61 (m, 1 H), 4.38 (br d, J = 12.2 Hz, 1 H), 4.14-4.22 (m, 1 H), 3.99- 4.07 (m, 1 H), 3.79-3.84 (m, 3 H), 3.71-3.78 (m, 1 H), 3.01-3.08 (m, 1 H), 2.93-3.00 (m, 1 H), 2.59-2.65 (m, 3 H) 149 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.15-8.18 (m, 1 H), 7.75- 465.0 7.80 (m, 1 H), 7.60-7.67 (m, 2 H), 7.48-7.52 (m, 1 H), 7.19-7.23 (m, 1 H), 7.14-7.18 (m, 1 H), 7.08-7.12 (m, 1 H), 6.88-6.93 (m, 1 H), 4.64-4.70 (m, 1 H), 4.46-4.51 (m, 1 H), 4.25-4.31 (m, 1 H), 4.13-4.19 (m, 1 H), 3.86-3.88 (m, 3 H), 3.79-3.84 (m, 1 H), 3.04- 3.11 (m, 1 H), 2.80-2.86 (m, 1 H), 2.60-2.63 (m, 3 H) 150 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.83-7.88 (m, 1 H), 7.73- 464.0 7.80 (m, 1 H), 7.58-7.67 (m, 2 H), 7.44-7.52 (m, 2 H), 7.13-7.21 (m, 2 H), 4.53-4.59 (m, 1 H), 4.32-4.40 (m, 1 H), 4.18-4.25 (m, 1 H), 3.98-4.08 (m, 1 H), 3.71-3.77 (m, 1 H), 3.66-3.71 (m, 1 H), 2.99-3.08 (m, 1 H), 2.94-2.99 (m, 1 H), 2.59-2.64 (m, 3 H), 0.99- 1.05 (m, 2 H), 0.92-0.97 (m, 2 H) 151 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.43-8.46 (m, 1 H), 7.77 449.0 (dd, J = 8.4, 2.9 Hz, 1 H), 7.61-7.68 (m, 2 H), 7.48 (s, 1 H), 7.36- 7.40 (m, 1 H), 7.28-7.31 (m, 1 H), 7.21-7.24 (m, 1 H), 7.15-7.18 (m, 1 H), 4.65-4.68 (m, 1 H), 4.46-4.51 (m, 1 H), 4.27-4.33 (m, 1 H), 4.13-4.19 (m, 1 H), 3.78-3.85 (m, 1 H), 3.04-3.11 (m, 1 H), 2.79-2.87 (m, 1 H), 2.60-2.64 (m, 3 H), 2.47-2.50 (m, 3 H) 152 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.73-7.77 (m, 1 H), 7.62- 452.0 7.65 (m, 1 H), 7.57-7.61 (m, 1 H), 7.54-7.56 (m, 1 H), 7.46-7.49 (m, 2 H), 7.13-7.16 (m, 1 H), 4.55-4.60 (m, 1 H), 4.33-4.38 (m, 1 H), 4.13-4.18 (m, 1 H), 4.00-4.05 (m, 1 H), 3.81-3.83 (m, 3 H), 3.72-3.78 (m, 1 H), 2.99-3.05 (m, 1 H), 2.92-2.97 (m, 1 H), 2.58- 2.61 (m, 3 H), 2.30-2.34 (m, 3 H) 153 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.69 (d, J = 2.7 Hz, 1H), 7.76 438.1 (s, 1H), 7.66 (dd, J = 9.8, 2.0 Hz, 1H), 7.59 (t, J = 8.2 Hz, 1H), 7.46- 7.55 (m, 3H), 7.21 (d, J = 2.4 Hz, 1H), 4.61 (dd, J = 10.4, 2.6 Hz, 1H), 4.15 (dd, J = 12.6, 2.7 Hz, 1H), 4.01-4.08 (m, 1H), 3.93 (d, J = 12.6 Hz, 1H), 3.82 (s, 4H), 3.04 (td, J = 12.1, 3.6 Hz, 1H), 2.95 (dd, J = 12.6, 10.5 Hz, 1H), 2.67 (s, 3H) 154 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.68 (d, J = 2.7 Hz, 1H), 8.44 433.2 (d, J = 5.1 Hz, 1H), 7.62 (td, J = 8.6, 6.6 Hz, 1H), 7.56 (d, J = 2.5 Hz, 1H), 7.48 (td, J = 9.8, 2.6 Hz, 1H), 7.40 (s, 1H), 7.26-7.36 (m, 2H), 7.24 (d, J = 2.3 Hz, 1H), 4.69 (dd, J = 10.5, 2.7 Hz, 1H), 4.28 (d, J = 12.4 Hz, 1H), 4.13-4.22 (m, 1H), 4.00 (d, J = 12.7 Hz, 1H), 3.85 (td, J = 11.7, 2.7 Hz, 1H), 3.07 (td, J = 12.2, 3.6 Hz, 1H), 2.80 (dd, J = 12.5, 10.6 Hz, 1H), 2.67 (s, 3H), 2.49 (s, 3H) 155 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.76-8.80 (m, 1 H), 7.74- 424.0 7.77 (m, 1 H), 7.67-7.73 (m, 2 H), 7.55-7.59 (m, 1 H), 7.47-7.53 (m, 2 H), 7.41-7.44 (m, 1 H), 7.21-7.24 (m, 1 H), 4.60-4.67 (m, 1 H), 4.47-4.56 (m, 2 H), 4.01-4.07 (m, 1 H), 3.81-3.83 (m, 3 H), 3.68-3.75 (m, 1 H), 3.14-3.20 (m, 1 H), 3.06-3.12 (m, 1 H) 156 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.75-7.76 (m, 1 H), 7.65- 438.0 7.68 (m, 1 H), 7.58-7.60 (m, 1 H), 7.54-7.57 (m, 1 H), 7.48-7.51 (m, 2 H), 7.32-7.34 (m, 1 H), 7.11-7.14 (m, 1 H), 4.58-4.64 (m, 1 H), 4.54 (dd, J = 10.5, 2.5 Hz, 1 H), 4.45-4.50 (m, 1 H), 4.02-4.05 (m, 1 H), 3.82-3.84 (m, 3 H), 3.69-3.74 (m, 1 H), 3.12-3.17 (m, 1 H), 3.06-3.11 (m, 1 H), 2.57-2.59 (m, 3 H) 157 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.74 (s, 1H), 7.65 (dd, 452.2 J = 1.91, 9.63 Hz, 1H), 7.53 (t, J = 8.17 Hz, 1H), 7.49 (dd, J = 2.00, 8.27 Hz, 1H), 7.47 (s, 1H), 7.40 (br s, 1H), 7.28 (s, 1H), 4.49-4.60 (m, 2H), 4.42 (br d, J = 12.90 Hz, 1H), 3.98-4.05 (m, 1H), 3.82 (s, 3H), 3.70 (dt, J = 2.54, 11.44 Hz, 1H), 3.07-3.14 (m, 1H), 3.04 (dd, J = 10.31, 12.67 Hz, 1H), 2.54 (s, 3H), 2.27 (s, 3H) 158 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.43-8.47 (m, 1 H), 7.74- 439.0 7.76 (m, 1 H), 7.55-7.61 (m, 3 H), 7.47-7.50 (m, 1 H), 7.43-7.46 (m, 1 H), 4.61-4.67 (m, 1 H), 4.48-4.56 (m, 2 H), 4.01-4.06 (m, 1 H), 3.80-3.84 (m, 3 H), 3.67-3.73 (m, 1 H), 3.16-3.23 (m, 1 H), 3.10-3.16 (m, 1 H), 2.60-2.62 (m, 3 H) 159 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.72 (s, 1 H), 7.75 (s, 1 H), 439.0 7.64 (s, 1 H), 7.54-7.61 (m, 2 H), 7.48 (s, 1 H), 7.45 (dd, J = 8.2, 1.9 Hz, 1 H), 4.61 (br d, J = 12.2 Hz, 1 H), 4.55 (dd, J = 10.4, 2.6 Hz, 1 H), 4.50 (br d, J = 13.8 Hz, 1 H), 3.97-4.11 (m, 1 H), 3.82 (s, 3 H), 3.71 (td, J = 11.6, 2.7 Hz, 1 H), 3.07-3.22 (m, 2 H), 2.51 (s, 3 H) 160 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.75 (s, 1H), 7.58 (dd, J = 9.6, 453.0 2.08 Hz, 1H), 7.57 (t, J = 8.04 Hz, 1H), 7.52 (s, 1H), 7.48 (s, 1H), 7.44 (dd, J = 2.08, 8.30 Hz, 1H), 4.59 (br d, J = 13.23 Hz, 1H), 4.54 (dd, J = 2.59, 10.38 Hz, 1H), 4.47 (br d, J = 14.01 Hz, 1H), 3.99-4.08 (m, 1H), 3.82 (s, 3H), 3.70 (dt, J = 2.72, 11.61 Hz, 1H), 3.12-3.19 (m, 1H), 3.09 (br dd, J = 10.38, 12.98 Hz, 1H), 2.60 (s, 3H), 2.48 (s, 4H) 161 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.75 (s, 1 H), 7.54-7.62 (m, 437.2 2 H), 7.52 (s, 1 H), 7.48 (s, 1 H), 7.44 (dd, J = 8.2, 1.9 Hz, 1 H), 4.56- 4.63 (m, 1 H), 4.54 (dd, J = 10.3, 2.7 Hz, 1 H), 4.40-4.51 (m, 1 H), 4.00-4.06 (m, 1 H), 3.82 (s, 3 H), 3.70 (td, J = 11.5, 2.6 Hz, 1 H), 3.05-3.19 (m, 2 H), 2.60 (s, 3 H), 2.48 (s, 3 H) 162 .sup.1H NMR (400 MHz, Methanol-d4) δ ppm 7.71 (s, 1H), 7.58 (d, J = 452.1 2.3 Hz, 2H), 7.45-7.51 (m, 1H), 7.29-7.35 (m, 3H), 4.77 (dd, J = 10.2, 2.7 Hz, 1H), 4.14 (ddd, J = 11.5, 3.4, 1.8 Hz, 1H), 3.88-4.00 (m, 5H), 3.74-3.81 (m, 1H), 3.09 (td, J = 11.7, 3.5 Hz, 1H), 3.00 (dd, J = 12.2, 10.3 Hz, 1H), 2.70 (s, 3H), 2.59 (s, 3H) 163 .sup.1H NMR (400 MHz, Methanol-d4) δ ppm 7.68 (s, 1 H), 7.61 (d, J = 463.1 2.2 Hz, 1 H), 7.55 (s, 1 H), 6.64 (s, 1 H), 6.45 (b s, 1 H), 4.63 (dd, J = 10.3, 2.7 Hz, 1 H), 4.50 (dd, J = 10.3, 2.7 Hz, 1 H), 4.39 (d, J = 13.0 Hz, 1 H), 4.22 (d, J = 13.0 Hz, 1 H), 3.95 (s, 3 H), 3.89 (s, 3 H), 3.80 (td, J = 11.6, 2.9 Hz, 1 H), 3.48 (s, 3 H), 3.05-3.22 (m, 2 H), 2.60 (s, 3 H) 164 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.77 (s, 1H), 7.61 (d, J = 2.8 436.1 Hz, 1H), 7.49-7.57 (m, 2H), 7.31-7.38 (m, 2H), 7.17-7.23 (m, 1H), 4.63 (dd, J = 10.3, 2.6 Hz, 1H), 4.04 (t, J = 11.5 Hz, 2H), 3.82 (s, 5H), 2.90-2.99 (m, 1H), 2.85 (dd, J = 12.2, 10.4 Hz, 1H), 2.62 (s, 3H), 2.51 (s, 3H) 165 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.76 (s, 1H), 7.47 (d, J = 3.3 442.3 Hz, 1H), 5.79 (s, 2H), 4.59-4.80 (m, 2H), 4.51 (dt, J = 10.2, 2.4 Hz, 2H), 3.19-3.24 (s, 3H), 3.91-4.10 (m, 2H), 3.78 (s, 2H), 2.54- 2.73 (m, 6H), 2.15-2.7 (m, 1H), 2.17-2.38 (m, 3H), 1.71-1.98 (m, 3H) 166 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.75 (s, 1H), 7.71 (dt, J = 6.62, 437.0 8.37 Hz, 1H), 7.59 (br dd, J = 0.78, 3.11 Hz, 1H), 7.50 (ddd, J = 2.59, 9.47, 10.25 Hz, 1H), 7.46 (s, 1H), 7.32 (dt, J = 2.08, 8.43 Hz, 1H), 4.67-4.83 (m, 1H), 4.60 (br d, J = 13.49 Hz, 1H), 4.52 (br dd, J = 2.47, 10.51 Hz, 1H), 3.93-4.08 (m, 1H), 3.82 (s, 3H), 3.59-3.73 (m, 1H), 3.11-3.25 (m, 2H), 2.57 (s, 3H), 2.30 (s, 3H) 167 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.81 (dd, J = 8.3, 3.2 Hz, 1 H), 437.2 7.69-7.78 (m, 2 H), 7.48-7.54 (m, 1 H), 7.46 (s, 1 H), 7.32 (td, J = 8.4, 2.5 Hz, 1 H), 7.19 (d, J = 8.4 Hz, 1 H), 4.70-4.84 (m, 1 H), 4.64 (br d, J = 13.9 Hz, 1 H), 4.52 (dd, J = 10.3, 2.3 Hz, 1 H), 4.01 (br d, J = 13.0 Hz, 1 H), 3.82 (s, 3 H), 3.60-3.72 (m, 1 H), 3.13-3.27 (m, 2 H), 2.88 (q, J = 7.6 Hz, 2 H), 1.29 (t, J = 7.5 Hz, 3 H) 168 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.45 (d, J = 5.19 Hz, 1H), 448.2 7.72 (td, J = 8.43, 6.62 Hz, 1H), 7.60 (d, J = 2.47 Hz, 1H), 7.51 (td, J = 9.86, 2.47 Hz, 1H), 7.37-7.29 (m, 2H), 7.25 (br d, J = 4.93 Hz, 1H), 4.83 (br d, J = 12.20 Hz, 1H), 4.71-4.59 (m, 2H), 4.14 (br d, J = 11.16 Hz, 1H), 3.78-3.71 (m, 1H), 3.26-3.19 (m, 1H), 2.98 (br t, J = 12.07 Hz, 1H), 2.58 (s, 3H), 2.45 (s, 3H), 2.30 (s, 3H) 169 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.83 (s, 1H), 7.70 (dt, J = 6.62, 463.0 8.37 Hz, 1H), 7.59 (dd, J = 0.78, 3.63 Hz, 1H), 7.50 (dt, J = 2.34, 9.86 Hz, 1H), 7.46 (s, 1H), 7.32 (dt, J = 2.21, 8.37 Hz, 1H), 4.66-4.79 (m, 1H), 4.60 (br d, J = 13.75 Hz, 1H), 4.50 (dd, J = 2.47, 10.25 Hz, 1H), 3.93-4.05 (m, 1H), 3.59-3.74 (m, 2H), 3.10-3.25 (m, 2H), 2.57 (s, 3H), 2.29 (s, 3H), 0.97-1.06 (m, 2H), 0.88-0.97 (m, 2H) 170 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.00 (s, 1 H), 7.78-7.84 (m, 465.2 1 H), 7.74 (s, 1 H), 7.70 (d, J = 9.9 Hz, 1 H), 7.55 (d, J = 8.3 Hz, 1 H), 7.40 (s, 1 H), 4.53 (d, J = 9.9 Hz, 1 H), 4.16-4.08 (m, 1 H), 3.74- 3.62 (m, 2 H), 3.56-3.45 (m, 1 H), 2.82 (s, 3 H), 2.31 (d, J = 13.2 Hz, 1 H), 2.08 (d, J = 13.1 Hz, 1 H), 1.87-1.99 (m, 2 H), 1.06-0.96 (m, 2 H), 0.94-0.83 (m, 2 H) 171 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.84 (s, 1 H), 8.47 (d, 450.0 J = 5.2 Hz, 1 H), 7.70 (t, J = 7.8 Hz, 1 H), 7.38 (dd, J = 8.3, 1.7 Hz, 1 H), 7.32 (dd, J = 9.5, 1.8 Hz, 1 H), 7.25 (s, 1 H), 7.14 (br d, J = 4.8 Hz, 1 H), 4.51-4.66 (m, 1 H), 4.33-4.49 (m, 1 H), 3.79-3.91 (m, 1 H), 3.65 (ddd, J = 15.8, 11.9, 3.8 Hz, 1 H), 2.91 (s, 3 H), 2.57 (s, 3 H), 2.48 (br d, J = 13.2 Hz, 1 H), 2.22-2.32 (m, 2 H), 2.04-2.14 (m, 1 H) 172 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.84 (s, 1 H), 8.48 (d, 450.6 J = 5.2 Hz, 1 H), 7.67-7.74 (m, 1 H), 7.39 (dd, J = 8.2, 1.6 Hz, 1 H), 7.33 (dd, J = 9.5, 1.9 Hz, 1 H), 7.27-7.28 (m, 1 H), 7.18 (br d, J = 4.7 Hz, 1 H), 4.58 (dd, J = 11.4, 1.8 Hz, 1 H), 4.33-4.47 (m, 1 H), 3.83- 3.89 (m, 1 H), 3.56-3.72 (m, 1 H), 2.91 (s, 3 H), 2.60 (s, 3 H), 2.49 (br dd, J = 13.3, 1.9 Hz, 1 H), 2.25-2.32 (m, 2 H), 2.03-2.17 (m, 1 H) 173 .sup.1H NMR (600 MHz, DMSO-d6) δ 8.98 (s, 1H), 8.71 (s, 1H), 7.77 (t, 451.2 J = 7.90 Hz, 1H), 7.66 (dd, J = 1.73, 9.72 Hz, 1H), 7.52 (dd, J = 1.73, 8.27 Hz, 1H), 4.70 (br d, J = 11.44 Hz, 1H), 4.24 (br dd, J = 4.18, 10.90 Hz, 1H), 4.10 (q, J = 5.21 Hz, 2H), 3.75-3.85 (m, 1H), 3.59 (tdd, J = 3.95, 8.08, 11.99 Hz, 1H), 2.80 (s, 3H), 2.60 (s, 3H), 2.40 (br dd, J = 1.36, 12.99 Hz, 1H), 2.15 (br d, J = 13.44 Hz, 1H), 2.02 (dq, J = 4.54, 12.53 Hz, 1H), 1.89 (q, J = 11.99 Hz, 1H) 174 .sup.1H NMR (600 MHz, DMSO-d6) δ 8.98 (s, 1H), 8.70-8.71 (m, 1H), 451.2 7.78 (t, J = 7.99 Hz, 1H), 7.66 (dd, J = 1.73, 9.72 Hz, 1H), 7.52 (dd, J = 1.82, 8.17 Hz, 1H), 4.70 (br d, J = 11.26 Hz, 1H), 4.25 (br dd, J = 4.18, 10.90 Hz, 1H), 3.77-3.84 (m, 1H), 3.59 (tt, J = 3.63, 11.90 Hz, 1H), 2.80 (s, 3H), 2.60 (s, 3H), 2.41 (br d, J = 12.90 Hz, 1H), 2.15 (br d, J = 13.26 Hz, 1H), 2.02 (dq, J = 4.45, 12.62 Hz, 1H), 1.89 (q, J = 11.93 Hz, 1H), 1.12 (br t, J = 7.08 Hz, 1H) 175 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.54 (s, 1 H), 7.44 (s, 1 443.3 H), 4.59 (d, J = 11.4 Hz, 1 H), 4.28 (d, J = 11.2 Hz, 1 H), 4.18 (t, J = 11.7 Hz, 1 H), 3.90 (s, 3 H), 3.79-3.86 (m, 1 H), 3.41-3.52 (m, 1 H), 2.84 (s, 3 H), 2.80 (s, 3 H), 2.42 (d, J = 13.5 Hz, 1 H), 2.32 (d, J = 8.2 Hz, 2 H), 2.96-2.23 (m, 9 H) 176 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.54 (s, 1 H), 7.44 (s, 1 443.2 H), 4.59 (d, J = 11.4 Hz, 1 H), 4.28 (d, J = 11.2 Hz, 1 H), 4.18 (t, J = 11.7 Hz, 1 H), 3.92 (s, 3 H), 3.77-3.89 (m, 1 H), 3.41-3.52 (m, 1 H), 2.84 (s, 3 H), 2.80 (s, 3 H), 2.42 (d, J = 13.5 Hz, 1 H), 2.32 (d, J = 8.2 Hz, 2 H), 1.99-2.20 (m, 9 H) 177 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 1.83-2.02 (m, 2 H) 2.04- 453.0 2.15 (m, 1 H) 2.26-2.36 (m, 1 H)2.64-2.72 (m, 3 H) 2.74-2.85 (m, 3 H) 3.44-3.56 (m, 1 H) 3.69-3.77 (m, 1 H) 3.77-3.82 (m, 3 H)4.02-4.18 (m, 1 H) 4.49-4.60 (m, 1 H) 7.34-7.42 (m, 1 H) 7.48- 7.57 (m, 1 H) 7.64-7.71 (m, 2 H) 7.73-7.81 (m, 1 H) 178 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 1.88-1.98 (m, 2 H) 2.07 (br 453.0 d, J = 13.26 Hz, 1 H) 2.31 (br d, J = 12.99 Hz, 1 H) 2.66 (s, 3 H) 2.78 (s, 3 H) 3.45-3.51 (m, 1 H) 3.66-3.76 (m, 1 H) 3.78 (s, 3 H) 4.08- 4.13 (m, 1 H) 4.53 (dd, J = 11.40, 1.86 Hz, 1 H) 7.38 (s, 1 H) 7.52 (dd, J = 8.27, 2.00 Hz, 1 H) 7.65 (s, 1 H) 7.67 (dd, J = 9.81, 1.91 Hz, 1 H) 7.77 (t, J = 7.95 Hz, 1 H) 179 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.70-7.76 (m, 1 H), 7.52 453.0 (s, 1 H), 7.40 (s, 1 H), 7.37 (dd, J = 8.3, 1.6 Hz, 1 H), 7.32 (dd, J = 9.5, 1.9 Hz, 1 H), 4.93 (dd, J = 7.7, 3.6 Hz, 1 H), 3.93-4.02 (m, 2 H), 3.91 (s, 3 H), 3.69-3.79 (m, 1 H), 2.88 (s, 3 H), 2.77-2.82 (m, 1 H), 2.76 (s, 3 H), 2.43-2.54 (m, 1 H), 2.32-2.42 (m, 1 H), 2.14-2.26 (m, 1 H) 180 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.79 (d, J = 7.9 Hz, 1H), 7.75 479.1 (d, J = 7.2 Hz, 1H), 7.69 (dd, J = 9.8, 2.0 Hz, 1H), 7.54 (dd, J = 8.3, 2.0 Hz, 1H), 7.39 (s, 1H), 4.52 (dd, J = 11.4, 2.1 Hz, 1H), 4.11 (dd, J = 11.1, 4.2 Hz, 1H), 3.71-3.77 (m, 1H), 3.62-3.71 (m, 1H), 3.43- 3.53 (m, 1H), 2.79 (s, 3H), 2.67 (s, 3H), 2.30 (s, 2H), 1.24 (s, 2H), 0.97-1.04 (m, 2H), 0.92 (td, J = 7.3, 5.1 Hz, 2H) 181 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.79 (d, J = 7.9 Hz, 1H), 7.75 479.1 (d, J = 7.2 Hz, 1H), 7.69 (dd, J = 9.8, 2.0 Hz, 1H), 7.54 (dd, J = 8.3, 2.0 Hz, 1H), 7.39 (s, 1H), 4.52 (dd, J = 11.4, 2.1 Hz, 1H), 4.11 (dd, J = 11.1, 4.2 Hz, 1H), 3.71-3.77 (m, 1H), 3.62-3.71 (m, 1H), 3.43- 3.53 (m, 1H), 2.79 (s, 3H), 2.67 (s, 3H), 2.30 (s, 2H), 1.24 (s, 2H), 0.97-1.04 (m, 2H), 0.92 (td, J = 7.3, 5.1 Hz, 2H) 182 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.77-7.88 (m, 1 H), 7.66 (s, 437.0 1 H), 7.49 (td, J = 9.9, 2.5 Hz, 1 H), 7.39 (s, 1 H), 7.33 (td, J = 8.5, 2.5 Hz, 1 H), 4.49-4.57 (m, 1 H), 4.11 (dd, J = 11.0, 4.3 Hz, 1 H), 3.79 (s, 3 H), 3.71 (d, J = 12.0 Hz, 1 H), 3.48 (t, J = 12.0 Hz, 1 H), 2.78 (s, 3 H), 2.66 (s, 3 H), 2.30 (s, 1 H), 2.07 (d, J = 13.1 Hz, 1 H), 1.88-1.99 (m, 2 H) 183 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.67 (s, 1 H), 7.62 (q, J = 7.8 433.0 Hz, 1 H), 7.39 (d, J = 0.8 Hz, 1 H), 7.20-7.28 (m, 2 H), 4.53 (dd, J = 11.3, 2.1 Hz, 1 H), 4.11 (d, J = 12.6 Hz, 1 H), 3.79 (s, 3 H), 3.68- 3.76 (m, 1 H), 3.42-3.54 (m, 1 H), 2.78 (s, 3 H), 2.66 (s, 3 H), 2.45 (s, 3 H), 2.25-2.33 (m, 1H), 2.07 (d, J = 13.5 Hz, 1 H), 1.87-1.99 (m, 2 H) 184 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.67 (s, 1 H), 7.62 (q, J = 7.8 433.0 Hz, 1 H), 7.39 (d, J = 0.8 Hz, 1 H), 7.20-7.28 (m, 2 H), 4.53 (dd, J = 11.3, 2.1 Hz, 1 H), 4.11 (d, J = 12.6 Hz, 1 H), 3.79 (s, 3 H), 3.68- 3.76 (m, 1 H), 3.42-3.54 (m, 1 H), 2.78 (s, 3 H), 2.66 (s, 3 H), 2.45 (s, 3 H), 2.25-2.33 (m, 1H), 2.07 (d, J = 13.5 Hz, 1 H), 1.87-1.99 (m, 2 H) 185 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.78 (s, 1 H), 7.61 (s, 1 438.2 H), 7.47-7.53 (m, 2 H), 7.42 (s, 1 H), 7.29-7.35 (m, 2 H), 4.59 (dd, J = 11.3, 2.1 Hz, 1 H), 4.29 (ddd, J = 11.5, 4.5, 1.4 Hz, 1 H), 3.89 (s, 3 H), 3.82 (td, J = 11.9, 2.2 Hz, 1 H), 3.43 (tt, J = 12.1, 3.7 Hz, 1 H), 2.87 (s, 3 H), 2.35 (ddt, J = 13.2, 3.7, 2.0, 2.0 Hz, 1 H), 2.15-2.27 (m, 2 H), 2.04-2.12 (m, 1 H) 186 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.83 (s, 1 H), 7.72 (s, 1 H), 452.0 7.61-7.67 (m, 2 H), 7.48 (dd, J = 8.3, 1.9 Hz, 1 H), 7.42 (s, 1 H), 4.95 (t, J = 4.7 Hz, 1 H), 3.83 (s, 3 H), 3.71-3.81 (m, 2 H), 3.47-3.57 (m, 1 H), 2.74 (s, 3 H), 2.62 (s, 3 H), 2.38-2.44 (m, 1 H), 2.25 (dt, J = 13.6, 4.9 Hz, 1 H), 2.12 (ddt, J = 17.2, 7.9, 3.8, 3.8 Hz, 1 H), 1.94- 2.03 (m, 1 H) 187 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 7.79 (s, 1 H), 7.67 (s, 1 H), 452.2 7.60-7.66 (m, 2 H), 7.48 (dd, J = 8.3, 1.8 Hz, 1 H), 7.40 (s, 1 H), 4.51 (dd, J = 11.2, 1.9 Hz, 1 H), 4.08-4.15 (m, 1 H), 3.80 (s, 3 H), 3.71 (td, J = 11.6, 2.8 Hz, 1 H), 3.40 (tt, J = 11.6, 4.0 Hz, 1 H), 2.73 (s, 3 H), 2.62 (s, 3 H), 2.23 (dt, J = 13.0, 1.7 Hz, 1 H), 1.87-2.02 (m, 3 H) 188 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.78 (s, 1 H), 7.63-7.70 (m, 436.0 2 H), 7.45 (ddd, J = 10.3, 9.4, 2.6 Hz, 1 H), 7.40 (d, J = 0.8 Hz, 1 H), 7.25-7.31 (m, 1 H), 4.51 (dd, J = 11.3, 2.1 Hz, 1 H), 4.11 (ddd, J = 11.3, 4.3, 1.9 Hz, 1 H), 3.79 (s, 3 H), 3.71 (td, J = 11.4, 3.2 Hz, 1 H), 3.36-3.46 (m, 1 H), 2.73 (s, 3 H), 2.61 (s, 3 H), 2.22 (ddt, J = 13.0, 3.8, 1.9 Hz, 1 H), 1.94-2.01 (m, 3 H) 189 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.73 (s, 1 H), 7.67 (s, 1 H), 432.1 7.46 (t, J = 7.7 Hz, 1 H), 7.40 (s, 1 H), 7.16-7.24 (m, 2 H), 4.50 (dd, J = 11.3, 2.1 Hz, 1 H), 4.11 (dt, J = 11.4, 2.8 Hz, 1 H), 3.79 (s, 3 H), 3.70 (td, J = 11.3, 3.4 Hz, 1 H), 3.36-3.46 (m, 1 H), 2.72 (s, 3 H), 2.60 (s, 3 H), 2.43 (s, 3 H), 2.21 (d, J = 13.1 Hz, 1 H), 1.88-2.02 (m, 3 H) 190 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.73 (s, 1 H), 7.67 (s, 1 H), 432.1 7.46 (t, J = 7.7 Hz, 1 H), 7.40 (s, 1 H), 7.16-7.24 (m, 2 H), 4.50 (dd, J = 11.3, 2.1 Hz, 1 H), 4.11 (dt, J = 11.4, 2.8 Hz, 1 H), 3.79 (s, 3 H), 3.70 (td, J = 11.3, 3.4 Hz, 1 H), 3.36-3.46 (m, 1 H), 2.72 (s, 3 H), 2.60 (s, 3 H), 2.43 (s, 3 H), 2.21 (d, J = 13.1 Hz, 1 H), 1.88-2.02 (m, 3 H) 191 .sup.1H NMR (500 MHz, DMSO-d6) δ ppm 8.89 (s, 1 H), 7.88 (s, 1 H), 438.0 7.69 (t, J = 8.0 Hz, 1 H), 7.66 (s, 1 H), 7.60 (dd, J = 9.7, 2.1 Hz, 1 H), 7.48 (dd, J = 8.3, 2.1 Hz, 1 H), 7.39 (s, 1 H), 4.52 (dd, J = 11.2, 1.9 Hz, 1 H), 4.04-4.16 (m, 1 H), 3.79 (s, 3 H), 3.72 (td, J = 11.6, 2.8 Hz, 1 H), 3.32-3.41 (m, 1 H), 2.77 (s, 3 H), 2.23 (dt, J = 13.0, 1.6 Hz, 1 H), 1.84-2.01 (m, 3 H) 192 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.84 (s, 1 H), 7.63-7.69 (m, 452.0 2 H), 7.59 (dd, J = 9.7, 1.9 Hz, 1 H), 7.47 (dd, J = 8.2, 1.9 Hz, 1 H), 7.39 (s, 1 H), 4.51 (dd, J = 11.3, 1.5 Hz, 1 H), 4.06-4.13 (m, 1 H), 3.79 (s, 3 H), 3.71 (td, J = 11.7, 2.3 Hz, 1 H), 3.32-3.38 (m, 1 H), 2.74 (s, 3 H), 2.63 (s, 3 H), 2.21 (br dd, J = 12.9, 1.3 Hz, 1 H), 1.84- 2.01 (m, 3 H) 193 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.84 (s, 1 H), 7.63-7.70 (m, 452.0 2 H), 7.59 (dd, J = 9.5, 1.2 Hz, 1 H), 7.47 (dd, J = 8.4, 1.3 Hz, 1 H), 7.39 (s, 1 H), 4.51 (br d, J = 11.1 Hz, 1 H), 4.10 (br dd, J = 11.1, 3.5 Hz, 1 H), 3.79 (s, 3 H), 3.67-3.74 (m, 1 H), 3.32-3.37 (m, 1 H), 2.74 (s, 3 H), 2.63 (s, 3 H), 2.22 (br dd, J = 13.1, 0.7 Hz, 1 H), 1.83- 2.00 (m, 3 H) 194 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 7.92 (s, 1 H), 7.66-7.71 (m, 452.0 2 H), 7.60 (dd, J = 9.7, 1.9 Hz, 1 H), 7.48 (dd, J = 8.2, 1.8 Hz, 1 H), 7.40 (s, 1 H), 4.82-5.01 (m, 1 H), 3.83 (s, 3 H), 3.74 (t, J = 5.4 Hz, 2 H), 3.42-3.50 (m, 1 H), 2.74 (s, 3 H), 2.63 (s, 3 H), 2.38-2.44 (m, 1 H), 2.20-2.30 (m, 1 H), 2.02-2.14 (m, 1 H), 1.90-2.01 (m, 1 H) 195 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.83 (s, 1H), 7.68-7.73 (m, 436.0 1H), 7.66 (s, 1H), 7.37-7.44 (m, 2H), 7.22-7.30 (m, 1H), 4.51 (dd, J = 11.2, 2.1 Hz, 1H), 4.10 (ddd, J = 11.4, 4.4, 1.8 Hz, 1H), 3.78 (s, 3H), 3.71 (td, J = 11.4, 3.0 Hz, 1H), 3.30 (s, 1H), 2.73 (s, 3H), 2.62 (s, 3H), 2.21 (ddt, J = 13.0, 4.0, 1.9 Hz, 1H), 1.86-1.97 (m, 3H) 196 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.71 (s, 1H), 7.57 (t, J = 432.0 7.6 Hz, 1H), 7.52 (s, 1H), 7.41 (s, 1H), 7.15 (d, J = 7.9 Hz, 1H), 7.05 (d, J = 10.8 Hz, 1H), 4.60 (dd, J = 11.3, 2.1 Hz, 1H), 4.26-4.32 (m, 1H), 3.90 (s, 3H), 3.84 (td, J = 11.7, 2.7 Hz, 1H), 3.38 (ddt, J = 11.8, 7.5, 3.8 Hz, 1H), 2.78 (s, 3H), 2.70 (s, 3H), 2.48 (s, 3H), 2.39-2.46 (m, 1H), 1.98-2.13 (m, 3H) 197 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.14 (dd, J = 8.5, 3.5 Hz, 1 464.1 H), 7.70-7.79 (m, 3 H), 7.55-7.63 (m, 2 H), 7.39 (s, 1 H), 4.51 (dd, J = 11.4, 2.1 Hz, 1 H), 4.05-4.16 (m, 1 H), 3.62-3.77 (m, 2 H), 3.45 (tt, J = 11.9, 3.8 Hz, 1 H), 2.76 (s, 3 H), 2.26-2.37 (m, 1 H), 2.06 (d, J = 13.1 Hz, 1 H), 1.85-2.02 (m, 2 H), 0.98-1.05 (m, 2 H), 0.88-0.97 (m, 2 H) 198 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.93 (s, 1 H), 7.70-7.77 (m, 478.1 3 H), 7.57 (d, J = 8.3 Hz, 1 H), 7.39 (s, 1 H), 4.51 (d, J = 11.4 Hz, 1 H), 4.07-4.16 (m, 1 H), 3.62-3.77 (m, 2 H), 3.35-3.50 (m, 1 H), 2.71 (s, 3 H), 2.44 (s, 3 H), 2.29 (d, J = 13.0 Hz, 1 H), 2.01-2.12 (m, 1 H), 1.90-2.00 (m, 2 H), 0.98-1.05 (m, 2 H), 0.89-0.98 (m, 2 H) 199 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.93 (s, 1 H), 7.70-7.78 (m, 478.1 3 H), 7.57 (d, J = 8.3 Hz, 1 H), 7.39 (s, 1 H), 4.50 (d, J = 11.4 Hz, 1 H), 4.06-4.18 (m, 1 H), 3.62-3.79 (m, 2 H), 3.35-3.50 (m, 1 H), 2.71 (s, 3 H), 2.44 (s, 3 H), 2.29 (d, J = 13.6 Hz, 1 H), 2.01-2.12 (m, 1 H), 1.90-1.98 (m, 2 H), 0.82-1.03 (m, 4 H) 200 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.78 (dd, J = 4.1, 1.1 Hz, 1 436.0 H), 7.65 (td, J = 8.3, 6.4 Hz, 1 H), 7.52 (d, J = 0.8 Hz, 1 H), 7.43 (s, 1 H), 7.15 (tdd, J = 8.5, 2.4, 0.9 Hz, 1 H), 7.06 (ddd, J = 10.0, 8.8, 2.4 Hz, 1H), 4.55-4.63 (m, 1 H), 4.28 (ddd, J = 11.5, 4.4, 1.9 Hz, 1 H), 3.78- 3.91 (m, 4 H), 3.53 (ddt, J = 11.7, 7.7, 3.9 Hz, 1 H), 2.82 (s, 3 H), 2.41-2.50 (m, 4 H), 2.15-2.32 (m, 3 H) 201 H NMR (400 MHz, chloroform-d) δ ppm 7.78 (dd, J = 4.1, 1.1 Hz, 1 436.0 H), 7.65 (td, J = 8.3, 6.4 Hz, 1 H), 7.52 (d, J = 0.8 Hz, 1 H), 7.43 (s, 1 H), 7.15 (tdd, J = 8.5, 2.4, 0.9 Hz, 1 H), 7.06 (ddd, J = 10.0, 8.8, 2.4 Hz, 1 H), 4.55-4.63 (m, 1 H), 4.28 (ddd, J = 11.5, 4.4, 1.9 Hz, 1 H), 3.78- 3.91 (m, 4 H), 3.53 (ddt, J = 11.7, 7.7, 3.9 Hz, 1 H), 2.82 (s, 3 H), 2.41-2.50 (m, 4 H), 2.15-2.32 (m, 3 H) 202 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.87 (s, 1 H), 7.66 (s, 1 H), 432.1 7.57 (t, J = 7.7 Hz, 1 H), 7.39 (s, 1 H), 7.23-7.32 (m, 2 H), 4.52 (d, J = 11.5 Hz, 1 H), 4.06-4.18 (m, 1 H), 3.79 (s, 3 H), 3.70-3.76 (m, 1 H), 3.32-3.39 (m, 1 H), 2.70 (s, 3 H), 2.46 (s, 3 H), 2.42 (s, 3 H), 2.25-2.33 (m, 1 H), 1.80-2.10 (m, 3 H) 203 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.86 (s, 1 H), 7.66 (s, 1 H), 432.1 7.57 (t, J = 7.7 Hz, 1 H), 7.39 (s, 1 H), 7.22-7.29 (m, 2 H), 4.52 (d, J = 11.5 Hz, 1 H), 4.05-4.18 (m, 1 H), 3.79 (s, 3 H), 3.68-3.76 (m, 1 H), 3.34-3.44 (m, 1 H), 2.70 (s, 3 H), 2.46 (s, 3 H), 2.42 (s, 3 H), 2.23-2.36 (m, 1 H), 2.01-2.11 (m, 1 H), 1.90-1.99 (m, 2 H) 204 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.52-7.57 (m, 1 H), 7.42 447.0 (s, 1 H), 4.88-4.98 (m, 1 H), 3.88-3.99 (m, 4 H), 3.69 (quin, J = 5.52 Hz, 1 H), 3.06-3.27 (m, 1 H), 2.72-2.84 (m, 9 H), 2.43-2.57 (m, 1 H), 2.30-2.43 (m, 1 H), 2.13-2.26 (m, 1 H), 1.86 (br s, 4 H) 205 .sup.1H NMR (Chloroform-d, 400 MHz) δ 7.54 (s, 1H), 7.44 (s, 1H), 4.91 447.0 (quin, 1H, J = 8.1 Hz), 4.60 (dd, 1H, J = 1.8, 11.4 Hz), 4.3-4.3 (m, 1H), 3.8-3.9 (m, 4H), 3.4-3.6 (m, 1H), 3.1-3.3 (m, 1H), 2.82 (s, 3H), 2.6- 2.8 (m, 7H), 2.45 (br d, 1H, J = 13.4 Hz), 2.1-2.3 (m, 3H) 206 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.47 (d, J = 5.1 Hz, 1 H), 464.0 7.65-7.76 (m, 1 H), 7.37 (dd, J = 8.0, 1.9 Hz, 1 H), 7.31 (dd, J = 9.5, 1.9 Hz, 1 H), 7.26 (s, 1 H), 7.15 (d, J = 4.7 Hz, 1 H), 4.56 (dd, J = 11.4, 1.9 Hz, 1 H), 4.33-4.45 (m, 1 H), 3.78-3.92 (m, 1 H), 3.57-3.67 (m, 1 H), 2.86 (s, 3 H), 2.74 (s, 3 H), 2.58 (s, 3 H), 2.47 (br d, J = 13.2 Hz, 1 H), 2.20-2.30 (m, 2 H), 2.02-2.14 (m, 1 H) 207 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.47 (d, J = 5.1 Hz, 1 H), 464.2 7.70 (dd, J = 8.1, 7.5 Hz, 1 H), 7.37 (dd, J = 8.0, 1.8 Hz, 1 H), 7.31 (dd, J = 9.5, 1.9 Hz, 1 H), 7.26 (s, 1 H), 7.15 (d, J = 5.3 Hz, 1 H), 4.56 (dd, J = 11.5, 1.9 Hz, 1 H), 4.33-4.44 (m, 1 H), 3.81-3.89 (m, 1 H), 3.56- 3.66 (m, 1 H), 2.86 (s, 3 H), 2.74 (s, 3 H), 2.58 (s, 3 H), 2.47 (br d, J = 13.6 Hz, 1 H), 2.21-2.29 (m, 2 H), 2.07 (dt, J = 13.2, 11.9 Hz, 1 H) 208 .sup.1H NMR (Chloroform-d, 500 MHz) δ 8.15 (d, 1H, J = 5.4 Hz), 7.70 (t, 480.2 1H, J = 7.6 Hz), 7.2-7.4 (m, 2H), 6.96 (dd, 1H, J = 1.2, 5.4 Hz), 6.8-6.9 (m, 1H), 4.55 (dd, 1H, J = 1.9, 11.5 Hz), 4.3-4.5 (m, 1H), 3.9-4.0 (m, 3H), 3.8-3.9 (m, 1H), 3.6-3.7 (m, 1H), 2.85 (s, 3H), 2.74 (s, 3H), 2.46 (br d, 1H, J = 13.4 Hz), 2.1-2.3 (m, 2H), 1.9-2.1 (m, 1H) 209 .sup.1H NMR (600 MHz, DMSO-d6) δ 1.84-1.92 (m, 1 H) 2.01 (qd, 465.0 J = 12.62, 4.45 Hz, 1 H) 2.14 (br dd, J = 13.26, 1.82 Hz, 1 H) 2.37- 2.49 (m, 1 H) 2.61 (s, 3 H) 2.66 (s, 3 H) 2.71-2.80 (m, 3 H) 3.57 (tt, J = 11.94, 3.77 Hz, 1 H) 3.80 (td, J = 11.99, 2.00 Hz, 1 H) 4.25 (br dd, J = 10.72, 4.00 Hz, 1 H) 4.66-4.74 (m, 1 H) 7.52 (d, J = 8.32 Hz, 1 H) 7.67 (d, J = 9.45 Hz, 1 H) 7.77 (t, J = 7.90 Hz, 1 H) 8.71 (s, 2 H) 210 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.46 (d, J = 5.1 Hz, 1 H), 448.2 7.75 (td, J = 8.1, 6.5 Hz, 1 H), 7.25 (s, 1 H), 7.14 (d, J = 4.8 Hz, 1 H), 7.07-7.12 (m, 1 H), 6.98-7.04 (m, 1 H), 4.55 (dd, J = 11.5, 1.9 Hz, 1 H), 4.38 (dt, J = 11.2, 3.2 Hz, 1 H), 3.79-3.93 (m, 1 H), 3.53-3.68 (m, 1 H), 2.85 (s, 3 H), 2.74 (s, 3 H), 2.57 (s, 3 H), 2.46 (br d, J = 13.4 Hz, 1 H), 2.21-2.30 (m, 2 H), 2.00-2.12 (m, 1 H) 211 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.46 (d, J = 5.2 Hz, 1 H), 448.2 7.76 (td, J = 8.1, 6.6 Hz, 1 H), 7.25 (s, 1 H), 7.14 (d, J = 4.9 Hz, 1 H), 7.10 (td, J = 8.1, 2.1 Hz, 1 H), 7.01 (td, J = 9.4, 2.5 Hz, 1 H), 4.55 (dd, J = 11.4, 1.9 Hz, 1 H), 4.39 (dt, J = 11.2, 3.2 Hz, 1 H), 3.79-3.90 (m, 1 H), 3.55-3.67 (m, 1 H), 2.85 (s, 3 H), 2.74 (s, 3 H), 2.57 (s, 3 H), 2.47 (br d, J = 13.4 Hz, 1 H), 2.20-2.28 (m, 2 H), 2.00-2.16 (m, 1 H) 212 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.41 (d, J = 5.2 Hz, 1 H), 7.87 448.2 (td, J = 8.4, 6.7 Hz, 1 H), 7.52 (ddd, J = 10.2, 9.4, 2.5 Hz, 1 H), 7.36 (td, J = 8.5, 2.5 Hz, 1 H), 7.22 (s, 1 H), 7.11-7.16 (m, 1 H), 4.72 (d, J = 8.6 Hz, 1 H), 3.90-3.98 (m, 1 H), 3.76-3.88 (m, 1 H), 3.63- 3.73 (m, 1 H), 2.81 (s, 3 H), 2.69-2.75 (m, 4 H), 2.47 (s, 3 H), 2.42 (s, 1 H), 2.02-2.22 (m, 2H) 213 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.41 (d, J = 5.2 Hz, 1 H), 7.87 448.2 (td, J = 8.5, 6.7 Hz, 1 H), 7.52 (ddd, J = 10.5, 9.5, 2.5 Hz, 1 H), 7.31- 7.42 (m, 1 H), 7.19-7.25 (m, 1 H), 7.13 (d, J = 5.3 Hz, 1 H), 4.72 (d, J = 9.2 Hz, 1 H), 3.91-4.02 (m, 1 H), 3.76-3.87 (m, 1 H), 3.68 (s, 1 H), 2.81 (s, 3 H), 2.63-2.76 (m, 4 H), 2.47 (s, 3 H), 1.99-2.23 (m, 3 H) 214 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.47 (d, J = 5.2 Hz, 1 H), 458.0 7.26 (s, 1 H), 7.15 (d, J = 4.8 Hz, 1 H), 4.91 (quin, J = 8.1 Hz, 1 H), 4.57 (dd, J = 11.4, 1.7 Hz, 1 H), 4.33-4.46 (m, 1 H), 3.80-3.92 (m, 1 H), 3.50-3.62 (m, 1 H), 3.10-3.26 (m, 1 H), 2.82 (s, 3 H), 2.77 (s, 7 H), 2.58 (s, 3 H), 2.46 (br d, J = 13.4 Hz, 1 H), 2.15-2.28 (m, 2 H), 1.99-2.09 (m, 1 H) 215 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 8.47 (d, J = 5.2 Hz, 1 H), 458.0 7.26 (s, 1 H), 7.15 (d, J = 4.9 Hz, 1 H), 4.91 (quin, J = 8.1 Hz, 1 H), 4.57 (dd, J = 11.4, 1.5 Hz, 1 H), 4.33-4.46 (m, 1 H), 3.80-3.94 (m, 1 H), 3.52-3.60 (m, 1 H), 3.10-3.25 (m, 1 H), 2.82 (s, 3 H), 2.70- 2.79 (m, 7 H), 2.58 (s, 3 H), 2.46 (br d, J = 13.4 Hz, 1 H), 2.18-2.28 (m, 2 H), 1.98-2.09 (m, 1 H) 216 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.68-7.75 (m, 1 H), 7.53 467.0 (s, 1 H), 7.45 (s, 1 H), 7.37 (dd, J = 8.2, 1.8 Hz, 1 H), 7.31 (dd, J = 9.5, 1.9 Hz, 1 H), 4.65 (dd, J = 11.5, 2.0 Hz, 1 H), 3.89 (s, 3 H), 3.87 (td, J = 5.5, 1.9 Hz, 1 H), 3.59 (tt, J = 12.2, 3.6 Hz, 1 H), 2.86 (s, 3 H), 2.75 (s, 3 H), 2.40-2.46 (m, 1 H), 2.22-2.28 (m, 1 H), 2.08-2.20 (m, 1 H), 1.84-1.93 (m, 1 H), 1.35 (d, J = 6.1 Hz, 3 H) 217 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.39 (d, J = 5.0 Hz, 1 H), 7.85 463.0 (s, 1 H), 7.65 (t, J = 7.9 Hz, 1 H), 7.59 (dd, J = 9.6, 1.8 Hz, 1 H), 7.47 (dd, J = 8.2, 1.9 Hz, 1 H), 7.28 (s, 1 H), 7.20 (d, J = 4.6 Hz, 1 H), 4.53- 4.62 (m, 1 H), 4.14-4.30 (m, 1 H), 3.79 (td, J = 11.7, 2.5 Hz, 1 H), 3.41-3.49 (m, 1 H), 2.74 (s, 3 H), 2.63 (s, 3 H), 2.46 (s, 3 H), 2.27- 2.33 (m, 1 H), 1.91-2.05 (m, 2 H), 1.74 (q, J = 11.9 Hz, 1 H) 218 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.39 (d, J = 5.2 Hz, 1 H), 7.85 463.0 (s, 1 H), 7.65 (t, J = 7.9 Hz, 1 H), 7.59 (dd, J = 9.6, 1.9 Hz, 1 H), 7.47 (dd, J = 8.2, 2.0 Hz, 1 H), 7.28 (s, 1 H), 7.20 (d, J = 4.8 Hz, 1 H), 4.60 (br d, J = 9.8 Hz, 1 H), 4.25 (br dd, J = 11.3, 3.0 Hz, 1 H), 3.79 (td, J = 11.7, 2.5 Hz, 1 H), 3.43 (ddt, J = 11.6, 7.8, 3.9, 3.9 Hz, 1 H), 2.74 (s, 3 H), 2.63 (s, 3 H), 2.46 (s, 3 H), 2.29 (br d, J = 12.8 Hz, 1 H), 1.92- 2.06 (m, 2 H), 1.74 (q, J = 12.0 Hz, 1 H) 219 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.41 (d, J = 5.1 Hz, 1 H), 8.19 449.0 (dd, J = 8.5, 3.5 Hz, 1 H), 7.75-7.84 (m, 2 H), 7.57-7.66 (m, 2 H), 7.22 (s, 1 H), 7.10-7.16 (m, 1 H), 4.73 (dd, J = 10.2, 2.7 Hz, 1 H), 3.90-3.98 (m, 1 H), 3.83 (dd, J = 12.4, 9.8 Hz, 1 H), 3.65 (t, J = 4.4 Hz, 1 H), 2.79 (s, 3 H), 2.65-2.76 (m, 2H), 2.47 (s, 3H), 2.01-2.21 (m, 2H) 220 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.41 (d, J = 5.1 Hz, 1 H), 8.19 449.0 (dd, J = 8.5, 3.5 Hz, 1 H), 7.74-7.85 (m, 2 H), 7.57-7.67 (m, 2 H), 7.22 (s, 1 H), 7.13 (d, J = 5.1 Hz, 1 H), 4.73 (d, J = 9.2 Hz, 1 H), 3.90- 3.99 (m, 1 H), 3.77-3.88 (m, 1 H), 3.65 (d, J = 5.2 Hz, 1 H), 2.79 (s, 3H), 2.70 (d, J = 15.3 Hz, 2 H), 2.47 (s, 3 H), 1.99-2.21 (m, 2 H) 221 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.41 (d, J = 5.2 Hz, 1 H), 8.18 432.48 (dd, J = 8.4, 3.5 Hz, 1 H), 7.84 (td, J = 8.5, 6.5 Hz, 1 H), 7.64 (d, J = 8.5 Hz, 1 H), 7.55-7.62 (m, 1 H), 7.40 (td, J = 8.4, 2.5 Hz, 1 H), 7.22 (s, 1 H), 7.13 (d, J = 5.6 Hz, 1 H), 4.73 (dd, J = 10.2, 2.7 Hz, 1 H), 3.91- 3.99 (m, 1 H), 3.79-3.90 (m, 1 H), 3.61-3.72 (m, 1 H), 2.79 (s, 3 H), 2.65-2.75 (m, 2 H), 2.47 (s, 3 H), 2.00-2.21 (m, 2 H) 222 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.46 (s, 1 H), 7.88 (d, J = 3.8 443.2 Hz, 1 H), 7.54 (t, J = 7.6 Hz, 1 H), 7.09-7.28 (m, 4 H), 4.83 (d, J = 9.4 Hz, 1 H), 3.95-4.07 (m, 2 H), 3.71 (q, J = 4.7 Hz, 1 H), 2.91 (d, J = 13.7 Hz, 1 H), 2.83 (s, 3 H), 2.61-2.71 (m, 1 H), 2.44-2.60 (m, 9 H), 2.13-2.33 (m, 2 H) 223 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.42-8.51 (m, 1 H), 7.88 443.2 (d, J = 3.8 Hz, 1 H), 7.54 (t, J = 7.6 Hz, 1 H), 7.20-7.28 (m, 2 H), 7.09- 7.20 (m, 2 H), 4.83 (dd, J = 9.8, 2.9 Hz, 1 H), 3.95-4.07 (m, 2 H), 3.72 (t, J = 4.7 Hz, 1 H), 2.91 (d, J = 13.7 Hz, 1 H), 2.83 (s, 3 H), 2.61- 2.70 (m, 1 H), 2.45-2.60 (m, 9 H), 2.22 (dddd, J = 18.6, 14.3, 9.6, 5.0 Hz, 2 H) 224 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.72-7.79 (m, 1 H), 7.60 452.0 (t, J = 7.9 Hz, 1 H), 7.52 (s, 1 H), 7.43 (s, 1 H), 7.41 (dd, J = 8.4, 1.9 Hz, 1 H), 7.35 (dd, J = 9.6, 1.9 Hz, 1 H), 4.58 (dd, J = 11.4, 1.9 Hz, 1 H), 4.28 (ddd, J = 11.5, 4.4, 1.6 Hz, 1 H), 3.89 (s, 3 H), 3.82 (td, J = 11.8, 2.6 Hz, 1 H), 3.53 (tt, J = 11.9, 3.8 Hz, 1 H), 2.82 (s, 3 H), 2.48 (d, J = 0.6 Hz, 3 H), 2.41-2.47 (m, 1 H), 2.14-2.30 (m, 3 H) 225 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.79 (d, J = 4.0 Hz, 1 H), 452.0 7.60 (t, J = 7.9 Hz, 1 H), 7.51 (s, 1 H), 7.38-7.43 (m, 2 H), 7.36 (dd, J = 9.5, 1.9 Hz, 1 H), 4.94 (dd, J = 7.3, 3.6 Hz, 1 H), 3.92-4.01 (m, 2 H), 3.91 (s, 3 H), 3.66-3.77 (m, 1 H), 2.83 (s, 3 H), 2.79 (ddd, J = 13.5, 6.7, 3.6 Hz, 1 H), 2.49 (d, J = 0.6 Hz, 4 H), 2.32-2.41 (m, 1 H), 2.13-2.23 (m, 1 H) 226 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 7.77 (d, J = 3.9 Hz, 1 H), 451.9 7.60 (t, J = 7.9 Hz, 1 H), 7.52 (d, J = 0.8 Hz, 1 H), 7.39-7.44 (m, 2 H), 7.35 (dd, J = 9.5, 1.9 Hz, 1 H), 4.58 (dd, J = 11.5, 2.2 Hz, 1 H), 4.28 (ddd, J = 11.5, 4.4, 1.8 Hz, 1 H), 3.89 (s, 3 H), 3.82 (td, J = 11.7, 2.9 Hz, 1 H), 3.47-3.58 (m, 1 H), 2.82 (s, 3 H), 2.42-2.51 (m, 4 H), 2.11-2.31 (m, 4 H) 227 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.46 (d, J = 5.2 Hz, 1 H), 7.83 447.1 (dd, J = 3.9, 1.1 Hz, 1 H), 7.66 (td, J = 8.4, 6.3 Hz, 1 H), 7.25 (d, J = 7.6 Hz, 1 H), 7.14-7.20 (m, 2 H), 7.09 (ddd, J = 10.0, 8.7, 2.4 Hz, 1 H), 4.82 (dd, J = 9.7, 2.9 Hz, 1 H), 3.93-4.07 (m, 2 H), 3.71 (p, J = 4.6 Hz, 1 H), 2.78-2.97 (m, 4 H), 2.63 (dd, J = 13.2, 4.2 Hz, 1 H), 2.58 (s, 3 H), 2.51 (d, J = 1.0 Hz, 3 H), 2.16-2.31 (m, 2 H) 228 .sup.1H NMR (400 MHz, chloroform-d) δ ppm 8.47 (d, J = 5.2 Hz, 1 H), 447.1 7.83 (dd, J = 3.9, 1.1 Hz, 1 H), 7.66 (td, J = 8.3, 6.3 Hz, 1 H), 7.26 (s, 1 H), 7.13-7.21 (m, 2 H), 7.09 (ddd, J = 10.0, 8.7, 2.4 Hz, 1 H), 4.82 (dd, J = 9.8, 2.9 Hz, 1 H), 3.93-4.09 (m, 2 H), 3.71 (p, J = 4.7 Hz, 1 H), 2.85-2.95 (m, 1 H), 2.84 (s, 3 H), 2.61-2.69 (m, 1 H), 2.58 (s, 3 H), 2.51 (d, J = 1.1 Hz, 3 H), 2.24 (dddd, J = 16.2, 13.8, 10.0, 5.1 Hz, 2 H) 229 .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.76 (d, J = 3.1 Hz, 1 H), 466.0 7.59 (t, J = 7.9 Hz, 1 H), 7.52 (s, 1 H), 7.44 (s, 1 H), 7.41 (dd, J = 8.2, 1.9 Hz, 1 H), 7.35 (dd, J = 9.5, 1.9 Hz, 1 H), 4.63 (dd, J = 11.4, 2.1 Hz, 1 H), 3.88 (s, 3 H), 3.85 (td, J = 5.5, 1.9 Hz, 1 H), 3.55 (tt, J = 12.2, 3.8 Hz, 1 H), 2.82 (s, 3 H), 2.48 (s, 3 H), 2.41 (ddt, J = 13.2, 3.7, 1.9, 1.9 Hz, 1 H), 2.23 (ddt, J = 13.2, 3.7, 1.9, 1.9 Hz, 1 H), 2.11-2.21 (m, 1 H), 1.85-1.99 (m, 1 H), 1.34 (d, J = 6.2 Hz, 3 H) 230 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.74 (s, 1 H), 7.63 (t, 466.0 J = 7.8 Hz, 1 H), 7.52 (s, 1 H), 7.42 (s, 1 H), 7.31-7.36 (m, 1 H), 7.24- 7.27 (m, 1 H), 4.65 (dd, J = 11.3, 1.9 Hz, 1 H), 3.83-3.94 (m, 4 H), 3.35-3.52 (m, 1 H), 2.78 (s, 3 H), 2.70 (s, 3 H), 2.31-2.45 (m, 1 H), 2.10-2.25 (m, 1 H), 1.95 (q, J = 12.3 Hz, 1 H), 1.63-1.74 (m, 1 H), 1.35 (d, J = 6.1 Hz, 3H) 231 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.53-8.56 (m, 1 H), 472.0 7.84 (s, 1 H), 7.47 (s, 1 H), 4.76 (br d, J = 12.53 Hz, 1 H), 4.62 (br s, 1 H), 4.49 (dd, J = 10.35, 2.72 Hz, 1 H), 3.98-4.05 (m, 1 H), 3.68-3.73 (m, 1 H), 3.60-3.68 (m, 1 H), 3.14-3.25 (m, 1 H), 2.63 (s, 3 H), 2.57 (s, 6 H), 1.19-1.32 (m, 1 H), 0.93-1.05 (m, 5 H) 232 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.56 (s, 1 H), 8.43- 457.0 8.51 (m, 1 H), 7.35 (s, 1 H), 7.25-7.32 (m, 1 H), 4.87 (br d, J = 11.63 Hz, 1 H), 4.61 (br dd, = 10.44, 2.45 Hz, 1 H), 4.15 (br dd, J = 11.90, 2.27 Hz, 1 H), 3.68-3.77 (m, 1 H), 2.98-3.10 (m, 1 H), 2.64 (s, 3 H), 2.58 (s, 5 H), 2.52-2.53 (m, 1 H), 2.43- 2.49 (m, 1 H), 0.97-1.07 (m, 1 H)

(907) The compounds disclosed below in Table 8A were made by a method of the present disclosure or a similar method. The appropriate reagents, starting materials and conditions necessary for synthesizing the compounds of Table 8A would be apparent to a person of ordinary skill in the art.

(908) TABLE-US-00012 TABLE 8A Additional Compounds Ex # Structure Name M + H 233 02embedded image (S)-4-(5-(4-chloro-2- fluorophenyl)pyrido[3,4- b]pyrazin-7-yl)-2-(1-methyl-1H- pyrazol-4-yl)morpholine 425.2 234 03embedded image (S)-4-(5-(4-chloro-2- fluorophenyl)-1,6-naphthyridin- 7-yl)-2-(1-methyl-1H-pyrazol-4- yl)morpholine 424.0 235 04embedded image (S)-4-(1-(4-chloro-2- fluorophenyl)isoquinolin-3-yl)- 2-(1-methyl-1H-pyrazol-4- yl)morpholine 423.0 236 05embedded image (S)-4-(1-(4-chloro-2- fluorophenyl)-7- methylisoquinolin-3-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 437.2 237 06embedded image (S)-4-(8-(4-chloro-2- fluorophenyl)-2,3-dimethyl-1,7- naphthyridin-6-yl)-2-(1-methyl- 1H-pyrazol-4-yl)morpholine 452.0 238 07embedded image (S)-4-(5-(4-chloro-2- fluorophenyl)-2-ethyl-1,6- naphthyridin-7-yl)-2-(1-methyl- 1H-pyrazol-4-yl)morpholine 452.0 239 08embedded image (S)-4-(5-(4-chloro-2- fluorophenyl)-2-methyl-1,6- naphthyridin-7-yl)-2-(1-ethyl- 1H-pyrazol-4-yl)morpholine 452.0 240 09embedded image (R)-4-(5-(4-chloro-2- fluorophenyl)-2-methyl-1,6- naphthyridin-7-yl)-2-(2- methylpyridin-4-yl)morpholine 449.0 241 0embedded image 2-((2S,4R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-4-(2,4- difluorophenyl)-6,7- dimethylpteridine 463.2 242 embedded image 4-(4-chloro-2-fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(1- methy1-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pteridine 453.0 243 embedded image (R)-4-(4-(2,4-difluorophenyl)- 6,7-dimethylpteridin-2-yl)-2- ((R)-tetrahydrofuran-3- yl)morpholine 428.2 244 embedded image (S)-2-(3- (difluoromethyl)pyrrolidin-1- yl)-4-(2,4-difluorophenyl)-6,7- dimethylpteridine 392.0 245 embedded image 5-(4-chloro-2-fluorophenyl)-2,3- dimethyl-7-((2R,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine 452.0 246 embedded image 5-(4-chloro-2-fluorophenyl)-2- methyl-7-((2S,4S)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine 438.0 247 embedded image (S)-4-(4-chloro-2-fluorophenyl)- 2-(3-difluoromethyl)pyrrolidin- 1-yl)-6,7-dimethylpteridine 408.0 248 embedded image 5-(4-chloro-2-fluorophenyl)-2- methyl-7-((2S,4R)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[3,4- b]pyrazine 438.0 249 embedded image 8-(4-chloro-2-fluorophenyl)-2,3- dimethyl-6-((2R,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-b]pyrazine 452.2 250 embedded image 8-(4-chloro-2-fluorophenyl)-2,3- dimethyl-6-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-b]pyrazine 452.0 251 0embedded image (S)-4-(4-(2,4-difluorophenyl)- 6,7-dimethylpteridin-2-yl)-2- ((S)-tetrahydrofuran-3- yl)morpholine 428.0 252 embedded image 4-(2,4-difluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(2- methylpyridin-4-yl)tetrahydro- 2H-pyran-4-yl)pteridine 448.2 253 embedded image (R)-4-(4-(2,4-difluorophenyl)-7- methylpteridin-2-yl)-2-((R)- tetrahydrofuran-3-yl)morpholine 414.0 254 embedded image (2S)-4-(6,7-dimethyl-4-(4- (trifluoromethyl)cyclohex-1-en- 1-yl)pteridin-2-yl)-2-(1-methyl- 1H-pyrazol-4-yl)morpholine 474.3 255 embedded image 8-(2,4-difluorophenyl)-2,3- dimethyl-6-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-b]pyrazine 436.0 256 embedded image 4-(2,4-difluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pteridine 437.2 257 embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine 436.0 258 embedded image 5-(2-fluoro-4-methylphenyl)- 2,3-dimethyl-7-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine 432.0 259 embedded image (R)-4-(4-(4-chloro-2- fluorophenyl)-7- methylpyrido[2,3-d]pyrimidin- 2-yl)-2-(6-methylpyridazin-4- yl)morpholine 451.2 260 embedded image 4-(4-chloro-2-fluorophenyl)-2- ((2S,4R)-2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-7-methylpyrido[2,3- d]pyrimidine 464.2 261 0embedded image (R)-4-(4-(4-chloro-2- fluorophenyl)-7-methylpteridin- 2-yl)-2-(2-methylpyrimidin-5- yl)morpholine 452.1 262 embedded image (R)-4-(4-((R)-3-fluoropiperidin- 1-yl)-6,7-dimethylpteridin-2-yl)- 2-(1-methyl-1H-pyrazol-4- yl)morpholine 427.0 263 embedded image 4-(2,4-difluorophenyl)-6,7- dimethyl-2-((2S,4S)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pteridine 437.0 264 embedded image 4-(2-fluoro-4-methylphenyl)- 6,7-dimethyl-2-((2S,4S)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pteridine 433.0 265 embedded image 8-(2,4-difluorophenyl)-2,3- dimethyl-6-((2S,4S)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-b]pyrazine 436.1 266 embedded image 8-(2-fluoro-4-methylphenyl)- 2,3-dimethyl-6-((2S,4S)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-b]pyrazine 432.4 267 embedded image 4-(2,4-difluorophenyl)-6,7- dimethyl-2-((2R,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-d]pyrimidine 436.0 268 embedded image 4-(2-fluoro-4-methylphenyl)- 6,7-dimethyl-2-((2R,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-d]pyrimidine 432.1 269 embedded image (S)-4-(4-(3- (difluoromethyl)azetidin-1-yl)- 6,7-dimethylpteridin-2-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 431.0 270 embedded image 4-(4-chloro-2-fluorophenyl)-2- ((2S,4R)-2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-7-methylpteridine 465.1 271 0embedded image 8-(4-chloro-2-fluorophenyl)-3- methyl-6-((2S,4R)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- b]pyrazine 438.2 272 embedded image 4-(4-chloro-2-fluorophenyl)-6,7- dimethyl-2-((2S,4S)-2-(2- methylpyridin-4-yl)tetrahydro- 2H-pyran-4-yl)pteridine 464.1 273 embedded image 4-(4-chloro-2-fluorophenyl)-6,7- dimethyl-2-((2R,4R)-2-(2- methylpyridin-4-yl)tetrahydro- 2H-pyran-4-yl)pteridine 464.1 274 embedded image (S)-2-(1-methyl-1H-pyrazol-4- yl)-4-(7-methyl-4-((1s,3R)-3- (trifluoromethyl)cyclobutyl) pteridin-2-yl)morpholine 434.0 275 embedded image (S)-2-(1-methyl-1H-pyrazol-4- yl)-4-(7-methyl-4-((1s,3R)-3- (trifluoromethyl)cyclobutyl) pyrido[2,3 -d]pyrimidin-2- yl)morpholine 433.2 276 embedded image 4-(4-chloro-2-fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pteridine 453.0 277 embedded image 4-(4-chloro-2-fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(1- methyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-d]pyrimidine 452.0 278 embedded image 4-(2,4-difluorophenyl)-7- methyl-2-((2R,4R)-2-(2- methylpyridin-4-yl)tetrahydro- 2H-pyran-4-yl)pyrido[2,3- d]pyrimidine 433.0 279 embedded image (S)-4-(7-methyl-4--((1r,3S)-3- (trifluoromethyl)cyclobutyl)pteridin- 2-yl)-2-(6-methylpyridazin- 4-yl)morpholine 446.0 280 embedded image (S)-4-(7-methy1-4-((1s,3R)-3- (trifluoromethyl)cyclobutyl)pteridin- 2-yl)-2-(6-methylpyridazin- 4-yl)morpholine 446.0 281 0embedded image (R)-4-(7-methyl-4-((1r,3S)-3- (trifluoromethyl)cyclobutyl)pteridin- 2-yl)-2-(6-methylpyridazin- 4-yl)morpholine 446.0 282 embedded image 4-(4-chloro-2-fluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(2- methylpyrimidin-5- yl)tetrahydro-2H-pyran-4- yl)pteridine 465.0 283 embedded image (S)-4-(7-chloro-4-(4-chloro-2- fluorophenyl)pyrido[2,3- d]pyrimidin-2-yl)-2-(1-methyl- 1H-pyrazol-4-yl)morpholine 461.1 284 embedded image 8-(4-chloro-2-fluorophenyl)-2,3- dimethyl-6-((2R,4R,6R)-2- methyl-6-(1-methyl-1H-pyrazol- 4-yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-b]pyrazine 466.0 285 embedded image 4-(2-fluoro-4-methylphenyl)- 6,7-dimethyl-2-((2R,4R)-2-(2- methylpyridin-4-yl)tetrahydro- 2H-pyran-4-yl)pteridine 444.3 286 embedded image 4-(2-fluoro-4-methylphenyl)- 6,7-dimethyl-2-((2S,4S)-2-(2- methylpyridin-4-yl)tetrahydro- 2H-pyran-4-yl)pteridine 444.2 287 embedded image 4-(4-chloro-2-fluorophenyl)-7- methyl-2-((2R,4S)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine 438.1 288 embedded image 4-(4-chloro -2-fluorophenyl)-7- methyl-2((2S,4R)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine 438.1 289 embedded image 4-(2,4-difluorophenyl)-7- methyl-2-((2R,4S)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine 422.2 290 embedded image 4-(2,4-difluorophenyl)-7- methyl-2-((2S,4R)-2-(1-methyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)pyrido[2,3- d]pyrimidine 422.2 291 0embedded image (S)-4-(4-(5-chloropyridin-2-yl)- 6,7-dimethylpteridin-2-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 437.1 292 embedded image (S)-4-(4-(5-fluoropyridin-2-yl)- 6,7-dimethylpteridin-2-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 421.2 293 embedded image (S)-4-(6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridin-2-yl)-2-(2- methylpyridin-4-yl)morpholine 482.0 294 embedded image (S)-4-(6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridin-2-yl)-2-(2- methylpyrimidin-5- yl)morpholine 483.1 295 embedded image (R)-4-(6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridin-2-yl)-2-(2- methylpyrimidin-5- yl)morpholine 483.1 296 embedded image 5-(4-chloro-2-fluorophenyl)-7- ((2R,4S)-2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-2,3- dimethylpyrido[3,4-b]pyrazine 478.2 297 embedded image 5-(4-chloro-2-fluorophenyl)-7- ((2S,4R)-2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-2,3- dimethylpyrido[3,4-b]pyrazine 478.1 298 embedded image (S)-2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(6,7-dimethyl-4- (6-(trifluoromethyl)pyridin-3- yl)pteridin-2-yl)morpholine 497.0 299 embedded image (S)-4-(6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridin-2-yl)-2-(6- methylpyridazin-4- yl)morpholine 483.1 300 embedded image 2-((2R,4S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridine 496.0 301 0embedded image 2-((2S,4R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridine 496.0 302 embedded image (S)-4-(4-((S)-3,3- dimethylcyclopentyl)-6,7- dimethylpteridin-2-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 422.2 303 embedded image (S)-4-(4-((R)-3,3- dimethylcyclopentyl)-6,7- dimethylpteridin-2-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 422.3 304 embedded image (R)-4-(4-chloro-2-fluorophenyl)- 6-methyl-2-(2-(1-methyl-1H- pyrazol-4-yl)morpholino)-5,6- dihydro-7H-pyrrolo[3,4- b]pyridin-7-one 442.0 305 embedded image 2-((2R,4S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-4-(2,4- difluorophenyl)-6,7- dimethylpteridine 463.2

(909) TABLE-US-00013 TABLE 8B Additional Compounds Method used Ex # Structure Name to synthesize 306 embedded image (2,3-dimethyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- (trifluoromethyl)pyridin-3- yl)pyrido[3,4-b]pyrazine Method 37 307 embedded image 5-(2,4-difluorophenyl)-2- methyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine Method 37 308 embedded image 2-methyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-5-(6- (trifluoromethyl)pyridin-3- yl)pyrido[3,4-b]pyrazine Method 37 309 embedded image 6,7-dimethyl-2-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- (trifluoromethyl)pyridin-3- yl)pteridine Method 37 310 embedded image 5-(4-chloro-2-fluorophenyl)- 2-methyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine Method 37 311 0embedded image 4-(2-methyl-5-(6- (trifluoromethyl)pyridin-3- yl)pyrido[3,4-b]pyrazin-7- yl)-2-(2-methylpyridin-4- yl)morpholine Method 42 312 embedded image 4-(2,3-dimethyl-5-(6- (trifluoromethyl)pyridin-3- yl)pyrido[3,4-b]pyrazin-7- yl)-2-(2-methylpyridin-4- yl)morpholine Method 42 313 embedded image 4-(5-(2,4-difluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)-2-(2-methylpyridin-4- yl)morpholine Method 42 314 embedded image 4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methoxypyridin-4- yl)morpholine Method 1 315 embedded image 4-(5-(2,4-difluorophenyl)- 2,3-dimethylpyrido[3,4- b]pyrazin-7-yl)-2-(2- methylpyridin-4- yl)morpholine Method 42 316 embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-[(2S,4R)-2-(2- methyl-4- pyridyl)tetrahydropyran-4- yl]pyrido[3,4-b]pyrazine Method 37 317 embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-[(2R,4S)-2-(2- methyl-4- pyridyl)tetrahydropyran-4- yl]pyrido[3,4-b]pyrazine Method 37 318 embedded image 4-(6,7-dimethyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 2-(2-methoxypyridin-4- yl)morpholine Method 1 319 embedded image 2,3-dimethyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-5-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pyrido[3,4- b]pyrazine Method 37 320 embedded image 4-(4-chloro-2-fluorophenyl)- 2-((2S,4S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)tetrahydro- 2H-pyran-4-yl)-6,7- dimethylpteridine Method 9 321 0embedded image 4-(2-chloro-4-fluorophenyl)- 2-((2R,4R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-6,7-dimethylpteridine Method 9 322 embedded image 4-(6,7-dimethyl-4-(6- (trifluoromethyl)pyridin-3- yl)pteridin-2-yl)-2-(2- methoxypyridin-4- yl)morpholine Method 37 323 embedded image 4-(2,4-difluorophenyl)-7- methyl-2-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-d]pyrimidine Method 37 324 embedded image 7-methyl-2-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-4-(6- (trifluoromethyl)pyridin-3- yl)pyrido[2,3-d]pyrimidine Method 37 325 embedded image 4-(4-chloro-2-fluorophenyl)- 7-methyl-2-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[2,3-d]pyrimidine Method 37 326 embedded image 5-(2,4-difluorophenyl)-2- methyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-1,6-naphthyridine Method 37 327 embedded image 5-(4-chloro-2-fluorophenyl)- 2,3-dimethyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-1,6-naphthyridine Method 37 328 embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-1,6-naphthyridine Method 37 329 embedded image 2-[(2S,4R)-2-(1- cyclopropylpyrazol-4- yl)tetrahydropyran-4-yl]-4- (2,4-difluorophenyl)-7- methyl-pteridine Method 9 330 embedded image 2-[(2R,4S)-2-(1- cyclopropylpyrazol-4- yl)tetrahydropyran-4-yl]-4- (2,4-difluorophenyl)-7- methyl-pteridine Method 9 331 00embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-((2R,4R)-2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine Method 42 332 01embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-((2R,4S)-2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pyrido[3,4-b]pyrazine Method 42 333 02embedded image (R)-4-(5-(2,4- difluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)-2-(2-methylpyridin-4- yl)morpholine Method 42 334 03embedded image (S)-4-(5-(2,4- difluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)-2-(2-methylpyridin-4- yl)morpholine Method 42 335 04embedded image (S)-4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methoxypyridin-4- yl)morpholine Method 1 336 05embedded image (R)-4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methoxypyridin-4- yl)morpholine Method 1 337 06embedded image 4-(4-(4-chloro-2,3- difluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methylpyridin-4- yl)morpholine Method 1 338 07embedded image 2-((2R,4R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-4-(2,4-difluorophenyl)-7- methylpteridine Method 9 339 08embedded image 2-((2S,4S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)tetrahydro- 2H-pyran-4-yl)-4-(2,4- difluorophenyl)-7- methylpteridine Method 9 340 09embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(2-methyl-5- (6-(trifluoromethyl)pyridin- 3-yl)pyrido[3,4-b]pyrazin-7- yl)morpholine Method 42 341 0embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)morpholine Method 42 342 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)morpholine Method 42 343 embedded image 4-(4-(4-chloro-2- (trifluoromethyl)phenyl)- 6,7-dimethylpteridin-2-yl)-2- (2-methylpyridin-4- yl)morpholine Method 1 344 embedded image 4-(5-(4-chloro-2- fluorophenyl)-2,3-dimethyl- 1,6-naphthyridin-7-yl)-2-(2- methylpyridin-4- yl)morpholine Method 40 345 embedded image 6,7-dimethyl-2-(2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)-4-(6- (trifluoromethyl)pyridin-3- yl)pteridine Method 37 346 embedded image 4-(5-(2,4-difluorophenyl)- 2,3-dimethyl-1,6- naphthyridin-7-yl)-2-(2- methylpyridin-4- yl)morpholine Method 40 347 embedded image 4-(2,3-dimethyl-5-(6- (trifluoromethyl)pyridin-3- yl)-1,6-naphthyridin-7-yl)-2- (2-methylpyridin-4- yl)morpholine Method 40 348 embedded image 4-(5-(4-chloro-2- fluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)morpholine Method 42 349 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(2,3- dimethyl-5-(6- (trifluoromethyl)pyridin-3- yl)pyrido[3,4-b]pyrazin-7- yl)morpholine Method 42 350 embedded image 4-(4-chloro-2-fluorophenyl)- 2-((2R,4R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-7-methylpteridine Method 9 351 0embedded image 4-(4-chloro-2-fluorophenyl)- 2-(2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-7- methylpteridine Method 9 352 embedded image 4-(4-(4-chloro-2,5- difluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methylpyridin-4- yl)morpholine Method 1 353 embedded image (R)-4-(7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 2-(2-methylpyridin-4- yl)morpholine Method 1 354 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-6-methyl-4-(7- methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2- yl)morpholine Method 1 355 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-6-methyl-4-(7- methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2- yl)morpholine Method 1 356 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(6,7- dimethyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 6-methylmorpholine Method 1 357 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)-6- methylmorpholine Method 10 358 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)-6- methylmorpholine Method 10 359 embedded image (R)-2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(7-methyl-4- (3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2- yl)morpholine Method 1 360 embedded image 2-(2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridine Method 9 361 0embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)-6-methylmorpholine Method 10 362 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)-6-methylmorpholine Method 10 363 embedded image (S)-4-(4-(4-chloro-2,3- difluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methylpyridin-4- yl)morpholine Method 1 364 embedded image (R)-4-(4-(4-chloro-2,3- difluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(2- methylpyridin-4- yl)morpholine Method 1 365 embedded image 2-(2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-6,7-dimethyl-4- (3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridine Method 9 366 embedded image 2-(2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-6,7-dimethyl-4- (3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridine Method 9 367 embedded image 4-(5-(4-chloro-2- fluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 10 368 embedded image 4-(5-(4-chloro-2- fluorophenyl)-2- methylpyrido[3,4-b]pyrazin- 7-yl)-2-(1-cyclopropyl-1H- pyrazol-4-yl)-6- methylmorpholine Method 10 369 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-6,7- dimethylpteridin-2-yl)-6- methylmorpholine Method 1 370 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-7- methylpteridin-2-yl)-6- methylmorpholine Method 1 371 0embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-7- methylpteridin-2-yl)-6- methylmorpholine Method 1 372 embedded image 4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 373 embedded image 4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 374 embedded image 4-(4-(4-chloro-2- fluorophenyl)-7- methylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 375 embedded image 4-(4-(4-chloro-2- fluorophenyl)-7- methylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 376 embedded image 2-(2-methyl-4-pyridyl)-4-[2- methyl-5-[3- (trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido [3,4-b]pyrazin-7- yl]morpholine Method 5 377 embedded image 2-(1-cyclopropylpyrazol-4- yl)-6-methyl-4-[2-methyl-5- [3-(trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido [3,4-b]pyrazin-7- yl]morpholine Method 10 378 embedded image 2-(1-cyclopropylpyrazol-4- yl)-4-[2,3-dimethyl-5-[3- (trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido [3,4-b]pyrazin-7-yl]-6- methyl-morpholine Method 10 379 embedded image 2-(1-cyclopropylpyrazol-4- yl)-4-[2,3-dimethyl-5-[3- (trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido [3,4-b]pyrazin-7-yl]-6- methyl-morpholine Method 10 380 embedded image 7-[(2R,4S,6R)-2-(1- cyclopropylpyrazol-4-yl)-6- methyl-tetrahydropyran-4- yl]-5-(2,4-difluorophenyl)- 2,3-dimethyl-pyrido[3,4- b]pyrazine Method 37 381 0embedded image 4-[4-(4-chloro-2-fluoro- phenyl)-6,7-dimethyl- pteridin-2-yl]-2-(1- cyclopropylpyrazol-4- yl)morpholine Method 1 382 embedded image (2S)-4-[5-(4-chloro-2- fluoro-phenyl)-2,3-dimethyl- pyrido[3,4-b]pyrazin-7-yl]- 2-(1-cyclopropylpyrazol-4- yl)morpholine Method 42 383 embedded image (2R)-4-[5-(4-chloro-2- fluoro-phenyl)-2,3-dimethyl- pyrido[3,4-b]pyrazin-7-yl]- 2-(1-cyclopropylpyrazol-4- yl)morpholine Method 42 384 embedded image (2S)-2-(1- cyclopropylpyrazol-4-yl)-4- [2,3-dimethyl-5-[6- (trifluoromethyl)-3- pyridyl]pyrido[3,4- b]pyrazin-7-yl]morpholine Method 42 385 embedded image (2R)-2-(1- cyclopropylpyrazol-4-yl)-4- [2,3-dimethyl-5-[6- (trifluoromethyl)-3- pyridyl]pyrido[3,4- b]pyrazin-7-yl]morpholine Method 42 386 embedded image 2-methyl-7-[2-(1- cyclopropylpyrazol-4- yl)tetrahydropyran-4-yl]-5- [3-(trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido [3,4-b]pyrazine Method 39 387 embedded image (2S)-4-[4-(4-chloro-2,5- difluoro-phenyl)-6,7- dimethyl-pteridin-2-yl]-2-(2- methyl-4- pyridyl)morpholine Method 1 388 embedded image 5-(2,4-difluorophenyl)-2- methyl-7-[2-(1- cyclopropylpyrazol-4- yl)tetrahydropyran-4- yl]pyrido[3,4-b]pyrazine Method 39 389 embedded image 4-(4-chloro-3,5-difluoro- phenyl)-6,7-dimethyl-2-[2- (2-methyl-4- pyridyl)tetrahydropyran-4- yl]pteridine Method 41 390 embedded image 4-(4-chloro-3,5-difluoro- phenyl)-6,7-dimethyl-2-[2- (2-methyl-4- pyridyl)tetrahydropyran-4- yl]pteridine Method 41 391 0embedded image (2R)-4-[4-(4-chloro-2,5- difluoro-phenyl)-6,7- dimethyl-pteridin-2-yl]-2-(2- methyl-4- pyridyl)morpholine Method 1 392 embedded image 2,3-dimethyl-7-[2-(1- cyclopropylpyrazol-4- yl)tetrahydropyran-4-yl]-5- [3-(trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido [3,4-b]pyrazine Method 39 393 embedded image 7-[2-(1-cyclopropylpyrazol- 4-yl)tetrahydropyran-4-yl]- 5-(2,4-difluorophenyl)-2,3- dimethyl-pyrido[3,4- b]pyrazine Method 39 394 embedded image 4-(4-chloro-2,3-difluoro- phenyl)-7-methyl-2-[2-(2- methyl-4- pyridyl)tetrahydropyran-4- yl]pteridine Method 38 395 embedded image 4-(4-chloro-2,3-difluoro- phenyl)-2-[2-(2-methyl-4- pyridyl)tetrahydropyran-4- yl]-6,7- bis(trideuteriomethyl)pteridine Method 38 396 embedded image 4-(4-chloro-2,3- difluorophenyl)-6,7- dimethyl-2-((2S,4R)-2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pteridine Method 41 397 embedded image 4-(4-chloro-2,3- difluorophenyl)-6,7- dimethyl-2-((2R,4S)-2-(2- methylpyridin-4- yl)tetrahydro-2H-pyran-4- yl)pteridine Method 41 398 embedded image (2R,6S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)-6- methylmorpholine Method 10 399 embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-[2-(2-methyl-4- pyridyl)tetrahydropyran-4- yl]-1,6-naphthyridine 400 embedded image 5-(2,4-difluorophenyl)-2,3- dimethyl-7-[2-(2-methyl-4- pyridyl)tetrahydropyran-4- yl]-1,6-naphthyridine 401 0embedded image 5-(4-chloro-2-fluoro- phenyl)-2,3-dimethyl-7-[2- (2-methyl-4- pyridyl)tetrahydropyran-4- yl]-1,6-naphthyridine 402 embedded image 8-(4-chloro-2-fluorophenyl)- 6-(2-(1-cyclopropyl-1H- pyrazol-4-yl)tetrahydro-2H- pyran-4-yl)-2,3- dimethylpyrido[2,3- b]pyrazine Method 44 403 embedded image (2S,6R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(5-(2,4- difluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazin-7-yl)-6- methylmorpholine Method 10 404 embedded image (2S,6S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-6-methyl- 4-(7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2- yl)morpholine Method 1 405 embedded image (2R,6R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-6-methyl- 4-(7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2- yl)morpholine Method 1 406 embedded image 2-((2R,4R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridine Method 9 407 embedded image 2-((2R,4S)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridine Method 9 408 embedded image (2S,6S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(6,7- dimethyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 6-methylmorpholine Method 1 409 embedded image (2R,6R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(6,7- dimethyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 6-methylmorpholine Method 1 410 embedded image (2R,6S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(6,7- dimethyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 6-methylmorpholine Method 1 411 0embedded image (2S,6R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(6,7- dimethyl-4-(3- (trifluoromethyl)bicyclo[1.1.1] pentan-1-yl)pteridin-2-yl)- 6-methylmorpholine Method 1 412 embedded image 2-((2R,4R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-4-(2-fluoro-4- (trifluoromethyl)phenyl)- 6,7-dimethylpteridine Method 9 413 embedded image 2-((2R,4S)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-4-(2-fluoro-4- (trifluoromethyl)phenyl)- 6,7-dimethylpteridine Method 9 414 embedded image 4-(4-chloro-2-fluorophenyl)- 2-((2R,4S,6R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methyltetrahydro-2H- pyran-4-yl)-7- methylpyrido[2,3- d]pyrimidine 415 embedded image 2-((2R,4S,6R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methyltetrahydro-2H- pyran-4-yl)-4-(2,4- difluorophenyl)-7- methylpteridine 416 embedded image 2-((2R,4S,6R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methyltetrahydro-2H- pyran-4-yl)-4-(2,4- difluorophenyl)-7- methylpyrido[2,3- d]pyrimidine 417 embedded image 7-((2R,4S,6R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methyltetrahydro-2H- pyran-4-yl)-5-(2,4- difluorophenyl)-2- methylpyrido[3,4-b]pyrazine 418 embedded image 2-(1-cyclopropyl-1H- pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-6,7- dimethylpteridin-2-yl)-6- methylmorpholine Method 1 419 embedded image (2R,6S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-7- methylpteridin-2-yl)-6- methylmorpholine Method 1 420 embedded image (2S,6R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-7- methylpteridin-2-yl)-6- methylmorpholine Method 1 421 0embedded image 7-((2R,4S,6R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methyltetrahydro-2H- pyran-4-yl)-2-methyl-5-(3- methylbicyclo[1.1.1]pentan- 1-yl)pyrido[3,4-b]pyrazine 422 embedded image (2S,6R)-4-(4-(4-chloro-2- fluorophenyl)-7- methylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 423 embedded image (2R,6S)-4-(4-(4-chloro-2- fluorophenyl)-7- methylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 424 embedded image (2R,6S)-4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 425 embedded image (2S,6R)-4-(4-(4-chloro-2- fluorophenyl)-6,7- dimethylpteridin-2-yl)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methylmorpholine Method 1 426 embedded image (2R,6S)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-6,7- dimethylpteridin-2-yl)-6- methylmorpholine Method 1 427 embedded image (2S,6R)-2-(1-cyclopropyl- 1H-pyrazol-4-yl)-4-(4-(2,4- difluorophenyl)-6,7- dimethylpteridin-2-yl)-6- methylmorpholine Method 1 428 embedded image 2-((2R,4S)-2-(1- cyclopropyl-1H-pyrazol-4- yl)tetrahydro-2H-pyran-4- yl)-4-(3- isopropylbicyclo[1.1.1]pentan- 1-yl)-7-methylpyrido[2,3- d]pyrimidine 429 embedded image 2-((2R,4S,6R)-2-(1- cyclopropyl-1H-pyrazol-4- yl)-6-methyltetrahydro-2H- pyran-4-yl)-4-isopropyl-7- methylpyrido[2,3- d]pyrimidine

(910) The compounds disclosed below in Table 8B were made by a method of the present disclosure or a similar method. The appropriate reagents, starting materials and conditions necessary for synthesizing the compounds of Table 8B would be apparent to a person of ordinary skill in the art. Compounds designated with “(+/−)” were isolated as a mixture of diastereomers sharing the same relative stereochemistry (i.e. cis or trans). Compounds designated with “(rac)” were isolated as a mixture of all possible stereoisomers of the shown compound. Compounds lacking either designation were isolated with the specific stereochemistry shown, such that the specific stereoisomer shown made up at least 9000 of the isolated product.

(911) TABLE-US-00014 TABLE 8C Analytical data for compounds of Table 8B Ex # NMR M + H 306 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.87 (1H, s), 480.2 8.39 (1H, d, J = 5.2 Hz), 7.85 (1H, s), 7.66 (1H, q, J = 7.7 Hz), 7.37-7.32 (1H, m), 7.31-7.29 (1H, m), 7.26-7.20 (2H, m), 4.59 (1H, d, J = 11.1 Hz), 4.24- 4.21 (1H, m), 3.80-3.73 (1H, m), 2.73 (3H, s), 2.45 (3H, s), 2.28 (1H, d, J = 13.6 Hz), 2.00-1.96 (2H, m), 1.72 (1H, q, J = 12.1 Hz). 307 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.43 (1H, s), 433.2 9.00 (1H, s), 8.75 (1H, d, J = 8.2 Hz), 8.42 (1H, d, J = 5.2 Hz), 8.14-8.10 (2H, m), 7.94 (1H, s), 7.34 (2H, s), 7.26 (2H, d, J = 5.1 Hz), 4.65 (1H, d, J = 11.1 Hz), 4.28 (1H, d, J = 11.3 Hz), 3.89-3.79 (2H, m), 3.53 (2H, br s), 3.34 (3H, s), 2.80 (3H, s), 2.49 (4H, s), 2.36 (2H, d, J = 12.8 Hz), 2.07-2.05 (2H, m), 1.82 (1H, q, J = 12.1 Hz). 308 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.59 (1H, s), 466.2 8.90 (1H, d, J = 8.2 Hz), 8.37 (1H, d, J = 5.3 Hz), 8.15 (1H, d, J = 8.3 Hz), 7.27 (1H, s), 7.19 (1H, d, J = 5.3 Hz), 4.62 (1H, d, J = 11.2 Hz), 4.25 (1H, dd, J = 11.3, 4.2 Hz), 3.80 (1H, t, J = 11.8 Hz), 3.59 (1H, t, J = 11.6 Hz), 2.78 (3H, s), 2.73 (3H, s), 2.44 (4H, s), 2.16 (1H, d, J = 13.1 Hz), 2.06-1.93 (1H, m), 1.77 (1H, q, J = 12.2 Hz). 309 .sup.1H NMR (400 MHz, DMSO-d6): δ 9.59 (s, 1 H), 481.2 8.90 (d, 1 H), 8.37 (d, 1 H), 8.15 (d, 1 H), 7.27 (s, 1 H), 7.19 (d, 1 H), 4.62 (d, 1 H), 4.25 (d, 1 H), 3.80 (t, 1 H), 3.59 (s, 1 H), 2.78 (s, 3 H), 2.73 (s, 3H), 2.39-2.44 (m, 4 H), 2.16 (d, 1 H), 1.99 (d, 1 H), 1.77 (q, 1 H). 310 .sup.1H NMR (400 MHz, Chloroform-d): δ H ppm 8.78 449.1 (1H, s), 8.74 (3H, s), 8.46 (4H, t, J = 5.5 Hz), 7.86 (1H, s), 7.74 (3H, s), 7.64 (1H, t, J = 7.9 Hz), 7.58 (3H, t, J = 7.8 Hz), 7.33 (5H, t, J = 8.4 Hz), 7.22 (5H, s), 7.11 (5H, d, J = 5.0 Hz), 4.91-4.88 (1H, m), 4.55 (4H, d, J = 11.2 Hz), 4.38 (4H, d, J = 11.5 Hz), 3.96 (2H, dd, J = 6.4, 4.3 Hz), 3.87-3.81 (3H, m), 3.55-3.52 (1H, m), 3.47-3.39 (3H, m), 2.80 (10H, s), 2.56-2.55 (14H, m), 2.33-2.24 (3H, m), 2.15-2.07 (7H, m), 1.84 (4H, q, J = 12.2 Hz). 311 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 9.60 446.8 (1H, s), 8.75 (1H, d, J = 8.2 Hz), 8.53 (1H, d, J = 5.1 Hz), 7.83 (1H, d, J = 8.1 Hz), 7.18 (1H, d, J = 5.1 Hz), 7.03 (1H, s), 4.65 (1H, d, J = 10.5 Hz), 4.52 (1H, d, J = 13.0 Hz), 4.28 (2H, t, J = 9.1 Hz), 3.94 (1H, dd, J = 12.7, 10.5 Hz), 3.23 (1H, dd, J = 13.3, 10.4 Hz), 2.95 (1H, dd, J = 12.7, 10.6 Hz), 2.71 (3H, s), 2.67 (3H, s), 2.60 (3H, s). Note: One aromatic proton is obscured by solvent signal. 19F NMR (376 MHz, Chloroform-d) δ ppm −67.9. 312 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.51 480.4 (d, J = 4.9 Hz, 1H), 8.46 (s, 1H), 7.66-7.58 (m, 1H), 7.18 (d, J = 5.5 Hz, 1H), 7.07-7.01 (m, 1H), 7.00- 6.93 (m, 2H), 4.64 (d, J = 9.9 Hz, 1H), 4.53 (d, J = 12.6 Hz, 1H), 4.32-4.20 (m, 2H), 3.97-3.88 (m, 1H), 3.23 (td, J = 12.7, 3.3 Hz, 1H), 3.00-2.89 (m, 1H), 2.71 (s, 3H), 2.59 (s, 3H). Note: One aromatic proton is obscured by solvent signal. 19F NMR (376 MHz, Chloroform-d) δ ppm −108.30 (s), −108.66 (s). 313 .sup.1H NMR (400 MHz, CD2Cl2) δ ppm 8.41 (d, J = 434.8 5.1 Hz, 1H), 7.51-7.44 (m, 1H), 7.44-7.36 (m, 1H), 7.22 (s, 1H), 7.13 (d, J = 4.7 Hz, 1H), 4.54 (dd, J = 11.6, 1.2 Hz, 1H), 4.37-4.30 (m, 1H), 3.88-3.77 (m, 1H), 3.63-3.52 2.80 (s, 3H), 2.70 (s, 3H), 2.51 (s, 3H), 2.46-2.39 (m, 1H), 2.23-2.11 (m ,2H), 2.00-1.89 (m, 1H) 314 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.18 (d, J = 481.2 5.3 Hz, 1H), 7.74 (t, J = 7.9 Hz, 1H), 7.65 (d, J = 9.7 Hz, 1H), 7.50 (d, J = 8.3 Hz, 1H), 7.06 (d, J = 5.3 Hz, 1H), 6.87 (s, 1H), 4.81 (d, J = 13.2 Hz, 1H), 4.66 (t, J = 12.5 Hz, 2H), 4.14 (d, J = 11.5 Hz, 1H), 3.86 (s, 3H), 3.83-3.64 (m, 1H), 3.30-3.22 (m, 1H), 3.04 (dd, J = 13.1, 10.5 Hz, 1H), 2.66 (s, 3H), 2.52 (s, 3H). 315 1H NMR (400 MHz, DMSO-d6) δ ppm 8.44 (d, 448.2 J = 5.1 Hz, 1H), 7.66 (q, J = 7.8 Hz, 1H), 7.44-7.32 (m, 2H), 7.30-7.19 (m, 3H), 4.78-4.57 (m, 1H), 4.58-4.39 (m, 1H), 4.32 (d, J = 12.9 Hz, 1H), 4.15 (d, J = 11.8 Hz, 1H), 3.81 (t, J = 11.5 Hz, 1H), 3.07 (dd, J = 13.4. 10.1 Hz, 1H), 2.94-2.73 (m, 1H), 2.64 (s, 3H), 2.52 (s, 3H), 2.49 (s, 3H). 316 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46 448.2 (3H, t, J = 5.2 Hz), 7.82 (1H, s), 7.72-7.68 (2H, m), 7.66-7.60 (3H, m), 7.22 (3H, s), 7.12 (3H, d, J = 5.1 Hz), 7.08-7.00 (3H, m), 6.99-6.93 (3H, m), 4.89 (1H, dd, J = 8.6, 3.1 Hz), 4.54 (2H, d, J = 11.2 Hz), 4.39-4.35 (2H, m), 3.96 (2H, dd, J = 6.6, 4.2 Hz), 3.83 (2H, td, J = 11.4, 3.2 Hz), 3.53 (1H, t, J = 5.2 Hz), 3.41 (2H, tt, J = 11.7, 4.0 Hz), 2.78 (3H, s), 2.75 (6H, s), 2.71 (3H, s), 2.67 (6H, s), 2.56 (10H, m), 2.39 (2H, d, J = 13.4 Hz), 2.29-2.23 (3H, m), 2.14-2.05 (4H, m), 1.86-1.77 (2H, m). 317 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46 448.2 (1H, d, J = 5.1 Hz), 7.69 (1H, s), 7.63 (1H, m), 7.26 (1H, s), 7.18 (1H, s), 7.05 (1H, m), 6.96 (1H, m), 4.56 (1H, d, J = 11.2 Hz), 4.38 (1H, d, J = 11.5 Hz), 3.84 (1H, m), 3.41 (1H, m), 2.75 (3H, s), 2.67 (3H, s), 2.60 (3H, s), 2.40 (1H, d, J = 13.3 Hz), 2.12 (2H, m), 1.80 (1H, m). 318 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 11.51-11.55 487.2 (1H, m), 7.35-7.38 (1H, m), 6.34 (1H, s), 6.19-6.22 (1H, m), 4.59-4.81 (1H, m), 4.38-4.41 (1H, m), 4.07-4.11 (1H, m), 3.62-3.69 (1H m), 3.16-3.25 (1H, m), 2.92-3.01 (1H, m), 2.60-2.61 (3H, m), 2.59 (3H, s), 2.56 (6H, s). 319 .sup.1H NMR (400 MHz, Chloroform-d): δppm 8.47 469.2 (1H, m), 7.53 (1H, s), 7.23 (1H, s), 7.13 (1H, m), 4.54 (1H, d, J = 11.3 Hz), 4.36 (1H, d, J = 11.4 Hz), 3.86-3.80 (1H, m), 3.29 (1H, m), 2.73 (3H, s), 2.72 (3H, s), 2.60 (6H, s), 2.57 (3H, s), 2.30 (1H, d, J = 13.5 Hz), 2.22-2.15 (1H, m), 2.05 (2H, m), 1.82- 1.73 (1H, m). 320 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.79 (d, 479.0 J = 7.9 Hz, 1H), 7.75 (d, J = 7.2 Hz, 1H), 7.69 (dd, J = 9.8, 2.0 Hz, 1H), 7.54 (dd, J = 8.3, 2.0 Hz, 1H), 7.39 (s, 1H), 4.52 (dd, J = 11.4, 2.1 Hz, 1H), 4.11 (dd, J = 11.1, 4.2 Hz, 1H), 3.71-3.77 (m, 1H), 3.62- 3.71 (m, 1H), 3.43-3.53 (m, 1H), 2.79 (s, 3H), 2.67 (s, 3H), 2.30 (s, 2H), 1.24 (s, 2H), 0.97-1.04 (m, 2H), 0.92 (td, J = 7.3, 5.1 Hz, 2H) 321 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.79 (d, J = 478.9 7.9 Hz, 1H), 7.75 (d, J = 7.2 Hz, 1H), 7.69 (dd, J = 9.8, 2.0 Hz, 1H), 7.54 (dd, J = 8.3, 2.0 Hz, 1H), 7.39 (s, 1H), 4.52 (dd, J = 11.4, 2.1 Hz, 1H), 4.11 (dd, J = 11.1, 4.2 Hz, 1H), 3.71-3.77 (m, 1H), 3.62-3.71 (m, 1H), 3.43-3.53 (m, 1H), 2.79 (s, 3H), 2.67 (s, 3H), 2.30 (s, 2H), 1.24 (s, 2H), 0.97-1.04 (m, 2H), 0.97-1.04 (m, 2H), 0.92 (td, J = 7.3, 5.1 Hz, 2H) 322 .sup.1H NMR (DMSO-d6, 400 MHz): δH 9.57 (1H, s), 498.2 8.87-8.90 (1H, m), 8.18 (1H, d, J = 5.1 Hz), 8.13 (1H, d, J = 8.3 Hz), 7.07-7.08 (1H, m), 6.89 (1H, s), 4.82 (2H, bd, J = 64.4 Hz), 4.64 (1H, d, J = 10.1 Hz), 4.13-4.18 (1H, m), 3.85 (3H, s), 3.71-3.79 (1H, m), 3.00-3.12 (1H, m), 2.71-2.77 (1H, m), 2.65-2.67 (3H, s), 2.61-2.61 (3H, s). 323 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46 434.2 (1H, d, J = 5.3 Hz), 8.07 (1H, dd, J = 8.5, 3.8 Hz), 7.69-7.63 (1H, m), 7.46-7.43 (1H, m), 7.32-7.31 (2H, m), 7.17-7.10 (1H, m), 7.12-7.03 (1H, m), 4.85 (1H, dd, J = 9.7, 2.7 Hz), 4.04-3.97 (2H, m), 3.97-3.93 (1H, m), 3.74-3.69 (1H, m), 2.88 (3H, s), 2.62-2.57 (4H, m), 2.32-2.23 (1H, m), 2.22-2.14 (1H, m). 324 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.48 467.2 (1H, d, J = 5.3 Hz), 8.22 (1H, m), 8.07 (1H, d, J = 8.2 Hz), 7.59 (1H, t, J = 7.9 Hz), 7.47-7.35 (4H, m), 4.86 (1H, d, J = 9.9 Hz), 4.01-3.94 (2H, m), 3.72 (1H, m), 2.92-2.88 (4H, m), 2.63 (4H, s), 2.25 (1H, m), 2.16 (1H, m). 19F NMR (376 MHz, Chloroform-d) δ F −110.9. 325 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46 450.1 (2H, m), 7.99 (1H, dd, J = 8.6, 3.3 Hz), 7.92 (1H, dd, J = 8.7, 3.5 Hz), 7.87 (1H, s), 7.73 (1H, s), 7.61-7.52 (2H, m), 7.37-7.34 (1H, m), 7.32-7.29 (3H, m), 7.23-7.17 (2H, m), 7.12-7.05 (2H, m), 7.03-6.97 (2H, m), 4.90-4.87 (1H, m), 4.56 (1H, dd, J = 11.2, 2.0 Hz), 4.40-4.36 (1H, m), 3.98- 3.94 (2H, m), 2.86-3.79 (1H, m), 3.54-3.51 (1H, m), 3.42-3.35 (1H, m), 2.80 (3H, s), 2.77 (3H, s), 2.66-2.59 (7H, m), 2.45-2.37 (2H, m), 2.32-2.20 (2H, m), 2.15-2.03 (2H, m), 1.87-1.75 (1H, m). 326 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46- 432.2 8.43 (2H, m), 7.84 (1H, s), 7.74-7.71 (3H, m), 7.67- 7.65 (3H, m), 7.54-7.47 (2H, m), 7.45-7.33 (2H, m), 7.19-7.12 (3H, m), 4.88-4.85 (1H, m), 4.57-4.53 (1H, m), 4.39-4.34 (1H, m), 3.98-3.94 (1H, m), 3.85-3.78 (2H, m), 3.52-3.49 (1H, m), 3.41-3.36 (1H, m), 2.74 (6H, m), 2.58 (6H, s), 2.42 (6H, m), 2.33-2.16 (3H, m), 2.14-1.99 (4H, m), 1.85-1.74 (1H, m). 327 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46 462.2 (2H, m), 7.84 (1H, s), 7.74-7.73 (1H, m), 7.71 (1H, s), 7.67 (1H, m), 7.58-7.49 (2H, m), 7.22-7.16 (2H, m), 7.12-6.97 (6H, m), 4.90-4.86 (1H, m), 4.56-4.53 (1H, m), 4.39-4.34 (1H, m), 3.97-3.94 (2H, m), 3.85-3.78 (1H, m), 3.54-3.50 (1H, m), 3.42-3.34 (1H, m), 2.74 (3H, s), 2.71 (3H, s), 2.64-2.55 (6H, m), 2.45 (3H, s), 2.42 (3H, s), 2.39-2.35 (2H, m), 2.32-2.18 (2H, m), 2.14-2.03 (3H, m), 1.84-1.73 (1H, m). 328 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.48- 446.2 8.46 (1H, m), 7.82 (1H, s), 7.71-7.67 (1H, m), 7.33 (2H, m), 7.08-7.03 (1H, m), 7.02-6.96 (1H, m), 4.96-4.92 (1H, m), 3.98 (2H, m), 3.56-3.53 (1H, m), 2.78 (3H, s), 2.70 (3H, s), 2.66-2.60 (4H, m), 2.30-2.17 (3H, m). 329 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.98 (d, 449.1 J = 14.8 Hz, 1H), 7.83 (td, J = 8.4, 6.7 Hz, 1H), 7.74 (s, 1H), 7.53-7.43 (m, 1H), 7.39 (s, 1H), 7.33 (td, J = 8.3, 2.3 Hz, 1H), 4.57-4.47 (m, 1H), 4.11 (dd, J = 11.4, 3.2 Hz, 1H), 3.78-3.60 (m, 2H), 3.51 (s, 1H), 2.81 (s, 3H), 2.32 (d, J = 12.1 Hz, 1H), 2.08 (d, J = 12.8 Hz, 1H), 2.02-1.85 (m, 2H), 1.03-0.84 (m, 4H). 330 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.00 (s, 1H), 449.1 7.83 (td, J = 8.4, 6.7 Hz, 1H), 7.74 (s, 1H), 7.49 (td, J = 10.1, 2.5 Hz, 1H), 7.39 (s, 1H), 7.33 (td, J = 8.4, 2.0 Hz, 1H), 4.58-4.46 (m, 1H), 4.11 (dd, J = 11.4, 3.2 Hz, 1H), 3.80-3.59 (m, 2H), 3.51 (ddd, J = 12.1, 8.3, 3.6 Hz, 1H), 2.81 (s, 3H), 2.32 (d, J = 11.9 Hz, 1H), 2.08 (d, J = 11.7 Hz, 1H), 1.99- 1.88 (m, 2H), 1.04-0.97 (m, 2H), 0.94-0.87 (m, 2H). 331 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.46 448.2 (1H, d, J = 5.1 Hz), 7.69 (1H, s), 7.63 (1H, m), 7.26 (1H, s), 7.18 (1H, s), 7.05 (1H, m), 6.96 (1H, m), 4.56 (1H, d, J = 11.2 Hz), 4.38 (1H, d, J = 11.5 Hz), 3.84 (1H, m), 3.41 (1H, m), 2.75 (3H, s), 2.67 (3H, s), 2.60 (3H, s), 2.40 (1H, d, J = 13.3 Hz), 2.12 (2H, m), 1.80 (1H, m). 332 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.53 448.2 (s, 1H), 8.44 (d, J = 5.1 Hz, 1H), 7.72-7.64 (m, 1H), 7.41-7.33 (m, 2H), 7.29 (d, J = 6.0 Hz, 1H), 7.26-7.20 (m, 2H), 4.66 (d, J = 8.9 Hz, 1H), 4.51 (d, J = 12.1 Hz, 1H), 4.36 (d, J = 12.4 Hz, 1H), 4.16 (d, J = 10.9 Hz, 1H), 3.81 (t, J = 11.5 Hz, 1H), 3.11 (t, J = 11.1 Hz, 1H), 2.92-2.82 (m, 1H), 2.65 (s, 3H). Note: One methyl signal is obscured by solvent peak. 19F NMR (376 MHz, DMSO- d6) δ ppm −108.64 (s), −109.12 (s). 333 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.53 (s, 434.2 1H), 8.44 (d, J = 5.1 Hz, 1H), 7.72-7.63 (m, 1H), 7.42-7.34 (m, 2H), 7.29 (d, J = 4.2 Hz, 1H), 7.27- 7.20 (m, 2H), 4.66 (d, J = 10.2 Hz, 1H), 4.51 (d, J = 13.0 Hz, 1H), 4.36 (d, J = 12.1 Hz, 1H), 4.16 (d, J = 8.5 Hz, 1H), 3.81 (t, J = 10.5 Hz, 1H), 3.11 (t, J = 10.6 Hz, 1H), 2.93-2.82 (m, 1H), 2.65 (s, 3H). Note: One methyl signal is obscured by solvent peak. 19F NMR (376 MHz, DMSO-d6) δ ppm −108.64 (s), −109.12 (s). 334 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.18 (d, 434.2 J = 5.2 Hz, 1H), 7.74 (t, J = 7.9 Hz, 1H), 7.65 (dd, J = 9.8, 2.1 Hz, 1H), 7.50 (dd, J = 8.2, 2.0 Hz, 1H), 7.05 (d, J = 5.3 Hz, 1H), 6.87 (s, 1H), 4.81 (d, J = 13.2 Hz, 1H), 4.65 (t, J = 12.5 Hz, 2H), 4.14 (d, J = 11.5 Hz, 1H), 3.86 (s, 3H), 3.75 (t, J = 11.5 Hz, 1H), 3.30-3.19 (m, 1H), 3.04 (dd, J = 13.2, 10.5 Hz, 1H), 2.65 (s, 3H), 2.52 (s, 3H). 335 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.18 (d, 481.1 J = 5.2 Hz, 1H), 7.74 (t, J = 7.9 Hz, 1H), 7.65 (dd, J = 9.8, 2.0 Hz, 1H), 7.54-7.43 (m, 1H), 7.06 (d, J = 5.3 Hz, 1H), 6.87 (s, 1H), 4.81 (d, J = 13.2 Hz, 1H), 4.65 (t, J = 12.5 Hz, 2H), 4.20-4.08 (m, 1H), 3.86 (s, 3H), 3.79-3.64 (m, 1H), 3.26 (d, J = 14.6 Hz, 1H), 3.04 (dd, J = 13.2, 10.5 Hz, 1H), 2.66 (s, 3H), 2.52 (s, 3H). 336 v NMR (400 MHz, Chloroform-d) δ ppm 7.71 481.1 (1H, s), 7.61 (1H, t, J = 7.8 Hz), 7.48-7.45 (2H, m), 7.31 (1H, d, J = 8.4 Hz), 7.23 (1H, m), 4.56 (1H, d, J = 11.2 Hz), 4.26 (1H, d, J = 11.5 Hz), 3.83-3.78 (1H, m), 3.57-3.53 (1H, m), 3.34 (1H, m), 2.76 (3H, s), 2.68-2.67 (3H, s), 2.38 (1H, d, J = 13.2 Hz), 2.08-1.93 (3H, m), 1.09 (2H, t, J = 3.9 Hz), 1.00-0.95 (2H, m). 19F NMR (376 MHz, Chloroform-d) δ F −109.5 337 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.71 483.2 (1H, s), 7.61 (1H, t, J = 7.8 Hz), 7.48-7.45 (2H, m), 7.31 (1H, d, J = 8.4 Hz), 7.23 (1H, m), 4.56 (1H, d, J = 11.2 Hz), 4.26 (1H, d, J = 11.5 Hz), 3.83-3.78 (1H, m), 3.57-3.53 (1H, m), 3.34 (1H, m), 2.76 (3H, s), 2.68-2.67 (3H, s), 2.38 (1H, d, J = 13.2 Hz), 2.08-1.93 (3H, m), 1.09 (2H, t, J = 3.9 Hz), 1.00-0.95 (2H, m). 19 F NMR (376 MHz, Chloroform-d) δ F −109.5 338 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.98 (d, 449.1 J = 14.8 Hz, 1H), 7.83 (td, J = 8.4, 6.7 Hz, 1H), 7.74 (s, 1H), 7.53-7.43 (m, 1H), 7.39 (s, 1H), 7.33 (td, J = 8.3, 2.3 Hz, 1H), 4.57-4.47 (m, 1H), 4.11 (dd, J = 11.4, 3.2 Hz, 1H), 3.78-3.60 (m, 2H), 3.51 (s, 1H), 2.81 (s, 3H), 2.32 (d, J = 12.1 Hz, 1H), 2.08 (d, J = 12.8 Hz, 1H), 2.02-1.85 (m, 2H), 1.03-0.84 (m, 4H). 339 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.00 (s, 449.1 1H), 7.83 (td, J = 8.4, 6.7 Hz, 1H), 7.74 (s, 1H), 7.49 (td, J = 10.1, 2.5 Hz, 1H), 7.39 (s, 1H), 7.33 (td, J = 8.4, 2.0 Hz, 1H), 4.58-4.46 (m, 1H), 4.11 (dd, J = 11.4, 3.2 Hz, 1H), 3.80-3.59 (m, 2H), 3.51 (ddd, J = 12.1, 8.3, 3.6 Hz, 1H), 2.81 (s, 3H), 2.32 (d, J = 11.9 Hz, 1H), 2.08 (d, J = 11.7 Hz, 1H), 1.99-1.88 (m, 2H), 1.04-0.97 (m, 2H), 0.94-0.87 (m, 2H). 340 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.51 (s, 483.2 1H), 7.85 (s, 1H), 7.66 (td, J = 8.4, 6.6 Hz, 1H), 7.48 (s, 1H), 7.36 (td, J = 9.8, 2.5 Hz, 1H), 7.23 (td, J = 8.6, 2.6 Hz, 1H), 7.18 (s, 1H), 4.56 (dd, J = 10.4, 2.7 Hz, 1H), 4.41 (d, J = 13.2 Hz, 1H), 4.29-4.19 (m, 1H), 4.09-3.86 (m, 1H), 3.89-3.52 (m, 2H), 3.21-2.84 (m, 2H), 2.64 (s, 3H), 1.11- 0.98 (m, 2H), 0.98-0.89 (m, 2H). 341 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.84 (s, 449.2 1H), 7.65 (td, J = 8.4, 6.7 Hz, 1H), 7.47 (s, 1H), 7.36 (td, J = 9.8, 2.5 Hz, 1H), 7.22 (td, J = 9.5, 9.0, 3.1 Hz, 1H), 7.18 (s, 1H), 4.55 (dd, J = 10.5, 2.7 Hz, 1H), 4.37 (d, J = 12.6 Hz, 1H), 4.22 (d, J = 12.8 Hz, 1H), 4.02 (dd, J = 11.6, 3.2 Hz, 1H), 3.82-3.55 (m, 2H), 3.18-2.84 (m, 2H), 2.64 (s, 3H), 2.51 (s, 3H), 1.08-0.99 (m, 2H), 0.98-0.89 (m, 2H). 342 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.45 (d, J = 463.2 4.7 Hz, 1H), 7.86 (s, 1H), 7.67 (d, J = 8.2 Hz, 1H), 7.52 (d, J = 8.2 Hz, 1H), 7.25 (s, 1H), 7.17 (s, 1H), 5.01 (d, J = 11.9 Hz, 1H), 4.83 (d, J = 13.0 Hz, 1H), 4.54 (d, J = 10.8 Hz, 1H), 4.17 (d, J = 9.9 Hz, 1H), 3.81 (t, J = 10.5 Hz, 1H), 3.28 (t, J = 12.4 Hz, 1H), 3.00 (dd, J = 13.3, 10.7 Hz, 1H), 2.67 (s, 3H), 2.54 (s, 3H), 2.51 (s, 3H). 19F NMR (376 (MHz, CD.sub.2Cl.sub.2) δ ppm −57.89 (s). 343 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.46 (d, J = 515.20 5.2 Hz, 1H), 7.64 (s, 1H), 7.50 (t, J = 7.9 Hz, 1H), 7.40-7.30 (m, 3H), 7.26 (s, 2H), 4.66 (dd, J = 10.3, 1.6 Hz, 1H), 4.53 (dd, J = 12.1, 1.7 Hz, 1H), 4.27- 4.17 (m, 2H), 3.90 (td, J = 11.7, 2.9 Hz, 1H), 3.19 (t, J = 11.1 Hz, 1H), 2.93-2.84 (m, 1H), 2.70 (s, 3H), 2.60 (s, 3H), 2.34 (s, 3H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −112.30 (s). 344 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.46 (d, J = 5.2 463.2 Hz, 1H), 7.64 (s, 1H), 7.50 (t, J = 7.9 Hz, 1H), 7.40- 7.30 (m, 3H), 7.26 (s, 2H), 4.66 (dd, J = 10.3, 1.6 Hz, 1H), 4.53 (dd, J = 12.1, 1.7 Hz, 1H), 4.27-4.17 (m, 2H), 3.90 (td, J = 11.7, 2.9 Hz, 1H), 3.19 (t, J = 11.1 Hz, 1H), 2.93-2.84 (m, 1H), 2.70 (s, 3H), 2.70 (s, 3H), 2.60 (s, 3H), 2.34 (s, 3H). .sup.19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −112.30. 345 .sup.1H NMR (400 MHz, Chloroform-d): δ ppm 9.84 481.2 (1H, s), 8.95 (1H, d, J = 8.3 Hz), 8.47-8.44 (1H, m), 7.91-7.87 (1H, m), 7.26-7.24 (3H, m), 7.15- 7.08 (1H, m), 4.58-4.52 (1H, m), 4.41-4.37 (1H, m), 3.89-3.83 (1H, m), 3.67-3.59 (1H, m) 2.87 (3H, s), 2.81 (3H, s), 2.56 (3H, s), 2.50-2.46 (1H, m), 2.29-2.21 (2H, m), 2.09-2.00 (1H, m). 19F NMR (376 MHz, Chloroform-d): δ ppm −68.1. 346 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 9.03 (s, 1H), 447.2 8.46 (d, J = 5.1 Hz, 1H), 8.20 (d, J = 8.0 Hz, 1H), 7.87 (d, J = 8.0 Hz, 1H), 7.80 (s, 1H), 7.27 (s, 1H), 7.19 (d, J = 4.9 Hz, 1H), 7.10 (s, 1H), 4.65 (dd, J = 10.4, 2.5 Hz, 1H), 4.50 (d, J = 13.0 Hz, 1H), 4.29- 4.17 (m, 2H), 3.96-3.87 (m, 1H), 3.22-3.11 (m, 1H), 2.87 (dd, J = 12.7, 10.6 Hz, 1H), 2.64 (s, 3H), 2.56 (s, 3H), 2.35 (s, 3H). 19F NMR (376 MHz, CD.sub.2Cl2) δ ppm −68.18 (s) 347 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 9.03 (s, 1H), 480.2 8.46 (d, J = 5.1 Hz, 1H), 8.20 (d, J = 8.0 Hz, 1H), 7.87 (d, J = 8.0 Hz, 1H), 7.80 (s, 1H), 7.27 (s, 1H), 7.19 (d, J = 4.9 Hz, 1H), 7.10 (s, 1H), 4.65 (dd, J = 10.4, 2.5 Hz, 1H), 4.50 (d, J = 13.0 Hz, 1H), 4.29- 4.17 (m, 2H), 3.96-3.87 (m, 1H), 3.22-3.11 (m, 1H), 2.87 (dd, J = 12.7, 10.6 Hz, 1H), 2.64 (s, 3H), 2.56 (s, 3H), 2.35 (s, 3H). .sup.19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −68.18. 348 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.48 (d, 479.1 J = 2.0 Hz, 1H), 8.78 (dd, J = 8.1, 2.1 Hz, 1H), 8.07 (d, J = 8.2 Hz, 1H), 7.86 (s, 1H), 7.50 (s, 1H), 7.25 (s, 1H), 4.58 (dd, J = 10.5, 2.7 Hz, 1H), 4.46 (d, J = 12.7 Hz, 1H), 4.32 (d, J = 12.8 Hz, 1H), 4.14-3.98 (m, 1H), 3.75 (dd, J = 10.7, 2.3 Hz, 1H), 3.69 (dq, J = 7.4, 3.8 Hz, 1H), 3.09 (dd, J = 12.5, 3.5 Hz, 1H), 3.02 (dd, J = 12.9, 10.5 Hz, 1H), 2.66 (s, 3H), 2.61 (s, 3H), 1.06-1.00 (m, 2H), 0.95 (td, J = 7.4, 5.1 Hz, 2H). 349 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 9.67-9.68 496.2 (1H, m), 8.87-8.90 (1H, m), 7.86-7.88 (1H, m), 7.28-7.31 (1H, m), 6.61-6.63 (1H, m), 6.33-6.35 (1H, m), 5.02-5.09 (1H, m), 4.86-4.91 (1H, m), 4.43-4.47 (1H, m), 4.17-4.21 (1H, m), 3.78-3.85 (1H, m), 3.32-3.36 (1H, m), 3.04-3.11 (1H, m), 2.71 (3H, s), 2.65 (3H, s). Note: The exchangeable proton was not observed. 19F NMR (CH2Cl2-d2), 376 MHz) δ ppm −68.4 350 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.00 (s, 465.0 1 H), 7.78-7.84 (m, 1 H), 7.74 (s, 1 H), 7.70 (d, J = 9.9 Hz, 1 H), 7.55 (d, J = 8.3 Hz, 1 H), 7.40 (s, 1 H), 4.53 (d, J = 9.9 Hz, 1 H), 4.16-4.08 (m, 1 H), 3.74-3.62 (m, 2 H), 3.56-3.45 (m, 1 H), 2.82 (s, 3 H), 2.31 (d, J = 13.2 Hz, 1 H), 2.08 (d, J = 13.1 Hz, 1 H), 1.87-1.99 (m, 2 H), 1.06-0.96 (m, 2 H), 0.94-0.83 (m, 2 H) 351 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 9.00 (s, 465.0 1 H), 7.78-7.84 (m, 1 H), 7.74 (s, 1 H), 7.70 (d, J = 9.9 Hz, 1 H), 7.55 (d, J = 8.3 Hz, 1 H), 7.40 (s, 1 H), 4.53 (d, J = 9.9 Hz, 1 H), 4.16-4.08 (m, 1 H), 3.74-3.62 (m, 2 H), 3.56-3.45 (m, 1 H), 2.82 (s, 3 H), 2.31 (d, J = 13.2 Hz, 1 H), 2.08 (d, J = 13.1 Hz, 1 H), 1.87-1.99 (m, 2 H), 1.06-0.96 (m, 2 H), 0.94-0.83 (m, 2 H) 352 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.46 (d, J = 483.2 5.0 Hz, 1H), 7.49-7.42 (m, 1H), 7.39-7.34 (m, 1H), 7.27 (s, 1H), 7.19 (d, J = 4.4 Hz, 1H), 5.02 (d, J = 13.6 Hz, 1H), 4.85 (d, J = 13.3 Hz, 1H), 4.56 (dd, J = 10.6, 1.5 Hz, 1H), 4.18 (dd, J = 12.0, 2.5 Hz, 1H), 3.88-3.77 (m, 1H), 3.36-3.25 (m, 1H), 3.03 (dd, J = 13.3, 10.7 Hz, 1H), 2.69 (s, 3H), 2.57 (s, 3H), 2.55 (s, 3H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −133.16 (s), −139.03 (s). 353 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.56 (s, 457.0 1 H), 8.43-8.51 (m, 1 H), 7.35 (s, 1 H), 7.25-7.32 (m, 1 H), 4.87 (br d, J = 11.63 Hz, 1 H), 4.61 (br dd, = 10.44, 2.45 Hz, 1 H), 4.15 (br dd, J = 11.90, 2.27 Hz, 1 H), 3.68-3.77 (m, 1 H), 2.98-3.10 (m, 1 H), 2.64 (s, 3 H), 2.58 (s, 5 H), 2.52-2.53 (m, 1 H), 2.43-2.49 (m, 1 H), 0.97-1.07 (m, 1 H) 354 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.38 (s, 1H), 486.0 7.66-7.36 (m, 2H), 5.06 (s, 1H), 4.70 (dt, J = 100.5, 50.4 Hz, 2H), 4.05-3.68 (m, 2H), 3.49 (dq, J = 7.3, 3.8 Hz, 1H), 3.27 (d, J = 87.1 Hz, 1H), 2.70 (s, 3H), 2.59 (d, J = 10.7 Hz, 6H), 1.24 (s, 3H), 1.02 (dd, J = 8.4, 4.9 Hz, 2H), 0.93 (t, J = 16.8 Hz, 2H). 355 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.38 (s, 1H), 486.0 7.54 (d, J = 8.6 Hz, 2H), 5.06 (d, J = 44.1 Hz, 2H), 4.57 (dd, J = 10.9, 2.4 Hz, 1H), 3.80 (ddd, J = 10.6, 6.3, 2.5 Hz, 1H), 3.65-3.52 (m, 1H), 3.05 (s, 1H), 2.81 (dd, J = 13.2, 10.8 Hz, 1H), 2.71 (s, 3H), 2.58 (s, 6H), 1.33 (d, J = 4.2 Hz, 3H), 1.13 (s, 3H), 0.99 (dd, J = 27.6, 6.8 Hz, 2H). 356 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.46 (s, 2H), 500.0 5.05 (t, J = 3.5 Hz, 1H), 4.86 (s, 1H), 4.60 (s, 1H), 3.90 (s, 2H), 3.49 (ddd, J = 11.1, 7.3, 3.8 Hz, 1H), 3.15 (s, 1H), 2.70 (d, J = 14.3 Hz, 3H), 2.63 (s, 3H), 2.60 (s, 6H), 1.26-1.22 (m, 3H), 1.05-0.99 (m, 2H), 0.95 (d, J = 14.3 Hz, 2H). 357 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.65 (dd, J = 477.0 14.9, 8.2 Hz, 1H), 7.53 (d, J = 6.8 Hz, 2H), 7.05- 6.88 (m, 3H), 4.69 (dd, J = 10.8, 2.6 Hz, 1H), 4.44 (d, J = 12.7 Hz, 1H), 4.27 (d, J = 12.7 Hz, 1H), 3.95-3.86 (m, 1H), 3.58 (ddd, J = 11.0, 7.3, 3.8 Hz, 1H), 2.99-2.92 (m, 1H), 2.79-2.65 (m, 4H), 2.60 (s, 3H), 1.34 (d, J = 6.2 Hz, 3H), 1.12 (dd, J = 7.0, 4.4 Hz, 2H), 1.00 (t, J = 5.9 Hz, 2H). 358 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.65 (dd, J = 477.0 14.9, 8.2 Hz, 1H), 7.54 (s, 2H), 7.04-6.91 (m, 3H), 4.69 (dd, J = 10.8, 2.5 Hz, 1H), 4.45 (d, J = 12.8 Hz, 1H), 4.27 (d, J = 12.6 Hz, 1H), 3.96-3.88 (m, 1H), 3.60-3.55 (m, 1H), 3.01-2.93 (m, 1H), 2.78- 2.68 (m, 4H), 2.60 (s, 3H), 1.34 (d, J = 6.2 Hz, 3H), 1.12 (dd, J = 7.1, 4.4 Hz, 2H), 1.00 (t, J = 6.1 Hz, 2H). 359 .sup.1H NMR (600 MHz, DMSO-d6) δ ppm 8.53-8.56 472.0 (m, 1 H), 7.84 (s, 1 H), 7.47 (s 1 H), 4.76 (br d, J = 12.53 Hz, 1 H), 4.62 (br s, 1 H), 4.49 (dd, J = 10.35, 2.72 Hz, 1 H), 3.98-4.05 (m, 1 H), 3.68-3.73 (m, 1 H), 3.60-3.68 (m, 1 H), 3.14-3.25 (m, 1 H), 2.63 (s, 3 H), 2.57 (s, 6 H), 1.19-1.32 (m, 1 H), 0.93-1.05 (m, 5 H). 360 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.75 (d, J = 471.0 7.1 Hz, 1H), 7.56 (d, J = 3.9 Hz, 1H), 7.47 (d, J = 15.4 Hz, 1H), 4.86-4.13 (m, 2H), 3.88-3.75 (m, 1H), 3.51 (t, J = 33.6 Hz, 2H), 2.81 (d, J = 5.2 Hz, 3H), 2.59 (s, 7H), 2.32 (d, J = 13.7 Hz, 1H), 2.08 (dd, J = 20.6, 8.9 Hz, 2H), 1.03 (d, J = 5.0 Hz, 4H). 361 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.48 (s, 1H), 463.0 7.66-7.60 (m, 2H), 7.52 (s, 1H), 7.50 (d, J = 3.1 Hz, 2H), 7.00 (s, 1H), 5.08 (s, 1H), 4.51-4.47 (m, 1H), 4.01-3.99 (m, 1H), 3.73 (d, J = 9.2 Hz, 1H), 3.53 (d, J = 3.6 Hz, 2H), 3.25-3.17 (m, 2H), 2.87 (s, 3H), 1.28 (d, J = 6.3 Hz, 3H), 1.06 (d, J = 4.0 Hz, 1H), 0.98 (d, J = 5.3 Hz, 2H). 362 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.48 (s, 1H), 462.9 7.66-7.60 (m, 2H), 7.52 (s, 1H), 7.50 (d, J = 3.1 Hz, 2H), 7.00 (s, 1H), 5.08 (s, 1H), 4.51-4.47 (m, 1H), 4.01-3.99 (m, 1H), 3.73 (d, J = 9.2 Hz, 1H), 3.53 (d, J = 3.6 Hz, 2H), 3.25-3.17 (m, 2H), 2.87 (s, 3H), 1.28 (d, J = 6.3 Hz, 3H), 1.06 (d, J = 4.0 Hz, 1H), 0.98 (d, J = 5.3 Hz, 2H). 363 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.47 (d, J = 483.2 4.9 Hz, 1H), 7.49-7.41 (m, 1H), 7.39-7.33 (m, 1H), 7.27 (s, 1H), 7.19 (d, J = 3.7 Hz, 1H), 5.02 (d, J = 13.0 Hz, 1H), 4.86 (d, J = 13.1 Hz, 1H), 4.56 (d, J = 10.2 Hz, 1H), 4.19 (dd, J = 11.8, 2.1 Hz, 1H), 3.88-3.77 (m, 1H), 3.37-3.26 (m, 1H), 3.03 (dd, J = 13.2, 10.7 Hz, 1H), 2.69 (s, 3H), 2.57 (s, 3H), 2.55 (s, 3H), 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −133.15 (s), −139.04 (s). 364 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 11.45 (s, 1H), 483.1 7.34 (d, J = 6.8 Hz, 1H), 6.61 (s, 1H), 6.35 (d, J = 8.2 Hz, 1H), 4.99 (d, J = 13.7 Hz, 1H), 4.82 (d, J = 12.8 Hz, 1H), 4.41 (d, J = 7.8 Hz, 1H), 4.15 (d, J = 11.3 Hz, 1H), 3.81-3.72 (m, 1H), 3.31-3.20 (m, 1H), 3.06-2.95 (m, 1H), 2.65 (s, 3H), 2.62 (s, 3H), 2.60 (s, 6H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −73.46 (s) 365 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.42 (t, J = 485.2 12.8 Hz, 2H), 4.77 (dd, J = 8.0, 3.4 Hz, 1H), 3.92- 3.73 (m, 2H), 3.64-3.41 (m, 2H), 2.72 (t, J = 11.3 Hz, 6H), 2.57 (s, 6H), 2.39-2.30 (m, 1H), 2.28-2.18 (m, 1H), 2.08 (qd, J = 8.7, 4.6 Hz, 1H), 1.18 (s, 1H), 1.06-1.01 (m, 2H), 0.93 (qd, J = 5.5, 1.2 Hz, 2H). 366 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.44 (t, J = 5.8 485.3 Hz, 2H), 4.47 (dd, J = 11.4, 1.9 Hz, 1H), 4.18 (dt, J = 6.0, 3.3 Hz, 1H), 3.79-3.66 (m, 1H), 3.49 (tt, J = 7.3, 3.8 Hz, 1H), 3.37 (ddd, J = 15.8, 11.8, 3.7 Hz, 1H), 2.79-2.65 (m, 6H), 2.58 (s, 6H), 2.30 (d, J = 13.2 Hz, 1H), 2.07 (ddd, J = 11.6, 9.9, 4.2 Hz, 3H), 1.20(d, J = 12.5 Hz, 1H), 1.06-0.96 (m, 2H), 0.92(td, J = 7.1, 4.9 Hz, 2H). 367 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.70-7.56 (m, 493.0 5H), 7.55-7.47 (m, 8H), 7.00 (s, 2H), 6.95 (s, 3H), 5.07 (s, 3H), 4.33 (s, 3H), 3.91 (d, J = 6.4 Hz, 4H), 3.66-3.58 (m, 3H), 3.51 (dd, J = 7.4, 3.6 Hz, 3H), 3.13-3.02 (m, 3H), 2.77 (s, 4H), 2.77 (s, 4H), 2.69 (d, J = 1.9 Hz, 13H), 2.60 (s, 10H), 1.27 (d, J = 6.4 Hz, 11H), 1.04 (d, J = 4.2 Hz, 7H), 1.00-0.89 (m, 7H). 368 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.43 (d, J = 478.9 4.4 Hz, 1H), 7.58 (t, J = 7.9 Hz, 1H), 7.54 (s, 2H), 7.31-7.28 (m, 1H), 7.25-7.22 (m, 1H), 6.95 (s, 1H), 4.68 (dd, J = 10.9, 2.5 Hz, 1H), 4.46 (d, J = 12.5 Hz, 1H), 4.29 (d, J = 12.4 Hz, 1H), 3.94-3.86 (m, 1H), 3.57 (td, J = 7.3, 3.7 Hz, 1H), 2.99 (dd, J = 12.7, 11.0 Hz, 1H), 2.77 (dd, J = 12.6, 10.7 Hz, 1H), 2.70 (s, 3H), 1.34 (d, J = 6.2 Hz, 3H), 1.12 (td, J = 7.3, 4.4 Hz, 2H), 1.04-0.99 (m, 2H). 369 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.72 (dd, J = 14.8, 478.1 8.1 Hz, 1H), 7.51 (d, J = 9.1 Hz, 2H), 7.11-6.89 (m, 2H), 5.06 (s, 1H), 4.75 (d, J = 69.4 Hz, 2H), 3.86 (d, J = 64.9 Hz, 2H), 3.49 (s, 1H), 3.21 (s, 1H), 2.72 (s, 3H), 2.60 (s, 3H), 1.25 (d, J = 6.3 Hz, 3H), 1.01 (s, 2H), 0.93 (dd, J = 6.7, 3.1 Hz, 2H). 370 .sup.1H NMR (400 MHz, CDCl3) δ 8.41 (s, 1H), 7.69 464.0 (dd, J = 14.8, 7.8 Hz, 1H), 7.50 (dd, J = 27.7, 12.3 Hz, 2H), 7.03 (dt, J = 17.4, 8.2 Hz, 2H), 5.07 (s, 1H), 4.83 (t, J = 28.4 Hz, 1H), 4.70 (d, J = 12.6 Hz, 1H), 4.06-3.72 (m, 2H), 3.58-3.17 (m, 2H), 2.74 (s, 3H), 1.26 (d, J = 6.3 Hz, 3H), 1.01 (s, 2H), 0.94 (d, J = 6.6 Hz, 2H). 371 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.47-8.35 (m, 1H), 464.0 7.68 (dd, J = 14.5, 7.4 Hz, 1H), 7.53 (d, J = 5.3 Hz, 2H), 7.13-6.92 (m, 2H), 5.04 (s, 2H), 4.60 (d, J = 10.6 Hz, 1H), 3.91-3.76 (m, 1H), 3.57 (ddd, J = 10.9, 7.3, 3.7 Hz, 1H), 3.10 (dd, J = 13.4, 11.0 Hz, 1H), 2.86 (dd, J = 13.4, 10.7 Hz, 1H), 2.74 (s, 3H), 1.33 (d, J = 6.2 Hz, 3H), 1.17-1.07 (m, 2H), 1.06- 0.96 (m, 2H). 372 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.65 (t, J = 7.8 494.0 Hz, 1H), 7.53 (t, J = 4.1 Hz, 2H), 7.30 (t, J = 6.0 Hz, 1H), 7.24 (d, J = 2.0 Hz, 1H), 4.97 (s, 2H), 4.60 (d, J = 8.7 Hz, 1H), 3.89-3.76 (m, 1H), 3.57 (ddd, J = 11.1, 7.3, 3.9 Hz, 1H), 3.07 (dd, J = 13.3, 11.0 Hz, 1H), 2.84 (dd, J = 13.4, 10.7 Hz, 1H), 2.71 (s, 3H), 2.59 (s, 3H), 1.32 (d, J = 6.2 Hz, 3H), 1.15- 1.07 (m, 2H), 1.01 (dt, J = 12.3, 6.3 Hz, 2H). 373 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.65 (t, J = 7.8 Hz, 494.0 1H), 7.53 (t, J = 4.5 Hz, 2H), 7.33-7.28 (m, 1H), 7.24 (d, J = 1.9 Hz, 1H), 4.97 (s, 2H), 4.60 (d, J = 8.6 Hz, 1H), 3.88-3.77 (m, 1H), 3.62-3.53 (m, 1H), 3.07 (dd, J = 13.3, 11.0 Hz, 1H), 2.84 (dd, J = 13.3, 10.7 Hz, 1H), 2.71 (s, 3H), 2.59 (s, 3H), 1.32 (d, J = 6.2 Hz, 3H), 1.16-1.08 (m, 2H), 1.01 (q, J = 6.7 Hz, 2H). 374 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.41 (s, 1H), 481.0 7.62 (s, 1H), 7.58-7.50 (m, 2H), 7.38-7.27 (m, 2H), 5.04 (s, 2H), 4.60 (d, J = 9.1 Hz, 1H), 3.83 (s, 1H), 3.58 (s, 1H), 3.09 (dd, J = 13.4, 11.0 Hz, 1H), 2.86 (dd, J = 13.3, 10.7 Hz, 1H), 2.74 (s, 3H), 1.33 (d, J = 6.2 Hz, 3H), 1.18-1.07 (m, 2H), 1.06-0.95 (m, 2H). 375 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.41 (s, 1H), 481.0 7.62 (s, 1H), 7.53 (d, J = 5.8 Hz, 2H), 7.30 (dd, J = 15.3, 7.4 Hz, 2H), 5.04 (s, 2H), 4.60 (d, J = 9.4 Hz, 1H), 3.83 (s, 1H), 3.58 (s, 1H), 3.10 (dd, J = 13.4, 11.0 Hz, 1H), 2.86 (dd, J = 13.4, 10.7 Hz, 1H), 2.74 (s, 3H), 1.33 (d, J = 6.2 Hz, 3H), 1.12 (dt, J = 8.3, 4.3 Hz, 2H), 1.06-0.98 (m, 2H). 376 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.70 456.20 (1H, s), 7.68-7.62 (1H, m), 7.49 (2H, s), 7.05 (1H, t, J = 8.4 Hz), 6.96 (1H, td, J = 9.4, 2.4 Hz), 4.61 (1H, d, J = 11.2 Hz), 3.85 (1H, dd, J = 10.8, 6.0 Hz), 3.54 (1H, tt, J = 7.2, 3.8 Hz), 2.76 (3H, s), 3.39-3.33 (1H, m), 2.68 (3H, s), 2.35 (1H, d, J = 13.1 Hz), 2.15 (1H, d, J = 13.1 Hz), 1.93 (1H, q, J = 12.2 Hz), 1.70-1.61 (1H, m), 1.33 (3H, d, J = 6.2 Hz), 1.09 (2H, t, J = 3.5 Hz), 0.99 (2H, t, J = 6.6 Hz). 19F NMR (376 MHz, Chloroform-d) δ ppm −109.3, −109.3, −109.2, −109.2, −109.2, −109.2, −109.2, −107.7, −107.7, −107.7, −107.7. 377 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.33 (d, J = 485.0 7.0 Hz, 1H), 7.56-7.42 (m, 2H), 6.69 (d, J = 21.2 Hz, 1H), 4.60 (dd, J = 10.8, 2.6 Hz, 1H), 4.37 (d, J = 12.6 Hz, 1H), 4.19 (d, J = 12.3 Hz, 1H), 3.82 (ddd, J = 10.4, 6.4, 2.6 Hz, 1H), 3.52 (tt, J = 7.3, 3.8 Hz, 1H), 2.95-2.75 (m, 1H), 2.70-2.57 (m, 4H), 2.52-2.47 (m, 6H), 1.27 (d, J = 6.2 Hz, 3H), 1.07 (td, J = 7.3, 4.6 Hz, 2H), 0.98-0.92 (m, 2H). 378 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.47 (s, 2H), 6.73 499.1 (s, 1H), 4.61 (dd, J = 10.8, 2.6 Hz, 1H), 4.34 (d, J = 12.6 Hz, 1H), 4.16 (d, J = 12.5 Hz, 1H), 3.88- 3.78 (m, 1H), 3.52 (ddd, J = 11.1, 7.4, 3.8 Hz, 1H), 2.88-2.79 (m, 1H), 2.65-2.60 (m, 1H), 2.58 (s, 6H), 2.50 (s, 5H), 1.26 (d, J = 6.2 Hz, 3H), 1.18 (s, 1H), 1.09-1.04 (m, 2H), 0.98-0.93 (m, 2H). 379 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.47 (s, 2H), 499.1 6.73 (s, 1H), 4.61 (dd, J = 10.8, 2.6 Hz, 1H), 4.34 (d, J = 12.6 Hz, 1H), 4.16 (d, J = 12.5 Hz, 1H), 3.88-3.78 (m, 1H), 3.52 (ddd, J = 11.1, 7.4, 3.8 Hz, 1H), 2.88-2.79 (m, 1H), 2.65-2.60 (m, 1H), 2.58 (s, 6H), 2.50 (s, 5H), 1.26 (d, J = 6.2 Hz, 3H), 1.18 (s, 1H), 1.09-1.04 (m, 2H), 0.98-0.93 (m, 2H). 380 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 9.58 476.2 (s, 1H), 8.78 (dd, J = 8.0, 2.1 Hz, 1H), 7.81 (d, J = 8.2 Hz, 1H), 7.54 (s, 1H), 7.48 (s, 1H), 7.01 (s, 1H), 4.64 (dd, J = 10.4, 2.8 Hz, 1H), 4.52-4.37 (m, 1H), 4.22 (d, J = 12.7 Hz, 1H), 4.17-4.06 (m, 1H), 3.87 (td, J = 11.6, 2.8 Hz, 1H), 3.58 (tt, J = 7.4, 3.8 Hz, 1H), 3.20 (td, J = 12.1, 3.6 Hz, 1H), 3.10 (dd, J = 12.8, 10.4 Hz, 1H), 2.67 (s, 3H), 2.64 (s, 3H), 1.09 (td, J = 4.7, 2.9 Hz, 2H), 1.06-0.94 (m, 2H). 381 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.84 (s, 496.2 1H), 7.72 (t, J = 7.9 Hz, 1H), 7.64 (dd, J = 9.8, 2.0 Hz, 1H), 7.56-7.38 (m, 2H), 4.73 (d, J = 13.2 Hz, 1H), 4.61 (d, J = 13.3 Hz, 1H), 4.51 (dd, J = 10.5, 2.7 Hz, 1H), 4.01 (d, J = 11.5 Hz, 1H), 3.76- 3.60 (m, 2H), 3.28-3.15 (m, 2H), 2.65 (s, 3H), 2.51 (s, 3H), 1.08-0.98 (m, 2H), 0.98-0.84 (m, 2H). 382 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 7.59 (t, J = 479.1 7.9 Hz, 1H), 7.52 (s, 1H), 7.46 (s, 1H), 7.29 (dd, J = 8.4, 2.1 Hz, 1H), 7.24 (dd, J = 9.3, 2.0 Hz, 1H), 6.97 (s, 1H), 4.63 (dd, J = 10.3, 2.8 Hz, 1H), 4.44-4.27 (m, 1H), 4.20-4.12 (m, 1H), 4.12-4.05 (m, 1H), 3.85 (td, J = 11.5, 2.8 Hz, 1H), 3.57 (dq, J = 7.4, 3.7 Hz, 1H), 3.15 (td, J = 12.1, 3.7 Hz, 1H), 3.05 (dd, J = 12.8, 10.3 Hz, 1H), 2.65 (s, 3H), 2.56 (s, 3H), 1.14-1.04 (m, 2H), 1.02-0.94 (m, 2H). 383 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 7.59 (t, J = 479.2 7.8 Hz, 1H), 7.52 (s, 1H), 7.46 (s, 1H), 7.29 (dd, J = 8.9, 1.6 Hz, 1H), 7.24 (dd, J = 9.5, 2.0 Hz, 1H), 6.97 (s, 1H), 4.63 (dd, J = 10.3, 2.8 Hz, 1H), 4.38 (d, J = 12.8 Hz, 1H), 4.15 (d, J = 12.9 Hz, 1H), 4.09 (d, J = 12.0 Hz, 1H), 3.85 (td, J = 11.5, 2.8 Hz, 1H), 3.57 (tt, J = 7.2, 3.7 Hz, 1H), 3.15 (td, J = 12.0, 3.5 Hz, 1H), 3.05 (dd, J = 12.8, 10.3 Hz, 1H), 2.65 (s, 3H), 2.56 (s, 3H), 1.14-1.03 (m, 2H), 1.02-0.92 (m, 2H). 384 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 7.59 (t, J = 496.2 7.8 Hz, 1H), 7.52 (s, 1H), 7.46 (s, 1H), 7.29 (dd, J = 8.9, 1.6 Hz, 1H), 7.24 (dd, J = 9.5, 2.0 Hz, 1H), 6.97 (s, 1H), 4.63 (dd, J = 10.3, 2.8 Hz, 1H), 4.38 (d, J = 12.8 Hz, 1H), 4.15 (d, J = 12.9 Hz, 1H), 4.09 (d, J = 12.0 Hz, 1H), 3.85 (td, J = 11.5, 2.8 Hz, 1H), 3.57 (tt, J = 7.2, 3.7 Hz, 1H), 3.15 (td, J = 12.0, 3.5 Hz, 1H), 3.05 (dd, J = 12.8, 10.3 Hz, 1H), 2.65 (s, 3H), 2.56 (s, 3H), 1.14-1.03 (m, 2H), 1.02-0.92 (m, 2H). 385 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 9.58 (d, J = 496.2 1.6 Hz, 1H), 8.78 (dd, J = 8.1, 2.0 Hz, 1H), 7.81 (d, J = 8.2 Hz, 1H), 7.54 (s, 1H), 7.48 (s, 1H), 7.01 (s, 1H), 4.64 (dd, J = 10.4, 2.8 Hz, 1H), 4.44 (dd, J = 12.5, 2.8 Hz, 1H), 4.22 (d, J = 12.7 Hz, 1H), 4.11 (d, J = 3.4 Hz, 1H), 3.87 (td, J = 11.6, 2.9 Hz, 1H), 3.58 (tt, J = 7.5, 3.8 Hz, 1H), 3.20 (td, J = 12.1, 3.6 Hz, 1H), 3.10 (dd, J = 12.8, 10.4 Hz, 1H), 2.67 (s, 3H), 2.64 (s, 3H), 1.14- 1.03 (m, 2H), 1.03-0.94 (m, 2H). 386 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.72 470.2 (1H, s), 7.57 (1H, s), 7.48 (2H, s), 4.56 (1H, d, J = 11.2 Hz), 4.27-4.23 (1H, m), 3.85-3.77 (1H, m), 3.56 (1H, m), 3.30-3.21 (1H, m), 2.78 (3H, s), 2.61 (6H, s), 2.31 (1H, d, J = 13.2 Hz), 2.04- 1.92 (3H, m), 1.12-1.06 (2H, m), 1.03-0.94 (2H, m). 19F NMR (376 MHz, Chloroform-d) δ ppm −73.0 387 .sup.1H NMR (400 MHz, CD2Cl2) δ ppm 9.70 (s, 1H), 483.10 8.91 (d, J = 8.4 Hz, 1H), 7.88 (d, J = 8.2 Hz, 1H), 7.33 (d, J = 4.5 Hz, 1H), 6.65 (s, 1H), 6.34 (d, J = 7.2 Hz, 1H), 5.11-4.99 (m, 1H), 4.90 (d, J = 13.5 Hz, 1H), 4.42 (d, J = 8.7 Hz, 1H), 4.20 (d, J = 12.1 Hz, 1H), 3.82 (t, J = 11.2 Hz, 1H), 3.38-3.26 (m, 1H), 3.06 (dd, J = 13.7, 9.8 Hz, 1H), 2.72 (s, 3H), 2.67 (s, 3H). one exchangeable proton is not visible. 19F NMR (376 MHz, CD2Cl2) δ −68.40. 388 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.47 (s, 1H), 448.2 7.55 (dd, J = 8.9, 5.9 Hz, 1H), 7.34 (dd, J = 8.8, 5.9 Hz, 1H), 7.28 (s, 1H), 7.20 (s, 1H), 5.02 (dd, J = 13.6, 0.8 Hz, 1H), 4.85 (d, J = 13.6 Hz, 1H), 4.56 (d, J = 8.3 Hz, 1H), 4.18 (dd, J = 11.6, 2.5 Hz, 1H), 3.87-3.79 (m, 1H), 3.36-3.25 (m, 1H), 3.03 (dd, J = 13.4, 10.6 Hz, 1H), 2.68 (s, 3H), 2.57 (s, 3H), 2.55 (s, 3H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −115.09 (s), −122.08 (s). 389 .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 8.87 (1H, 482.2 s), 7.85 (1H, s), 7.66-7.72 (2H, m), 7.37-7.40 (2H, m), 7.25 (1H, t, J = 8.4 Hz), 4.48 (1H, d, J = 11.0 Hz), 4.08 (1H, d, J = 11.2 Hz), 3.61-3.71 (2H, m), 2.74 (3H, s), 2.21 (1H, d, J = 13.0 Hz), 1.85-1.97 (3H, m), 0.97 (2H, d, J = 4.2 Hz), 0.89 (2H, d, J = 7.3 Hz). 390 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.41 (s, 2H), 482.2 8.39 (s, 1H), 7.23 (s, 1H), 7.14 (d, J = 4.0 Hz, 1H), 4.56 (dd, J = 11.3, 1.1 Hz, 1H), 4.39-4.32 (m, 1H), 3.90-3.79 (m, 1H), 3.64-3.51 (m, 1H), 2.81 (s, 3H), 2.79 (s, 3H), 2.52 (s, 3H), 2.48-2.40 (m, 1H), 2.24- 2.13 (m, 2H), 2.01-1.88 (m, 1H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −113.77 (s), −113.80 (s). 391 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.42 (d, J = 483.10 5.0 Hz, 1H), 8.35 (d, J = 8.2 Hz, 2H), 7.23 (s, 1H), 7.14 (d, J = 4.9 Hz, 1H), 4.69-4.57 (m, 2H), 4.40-4.33 (m, 1H), 3.99-3.89 (m, 1H), 2.83 (s, 3H), 2.82 (s, 3H), 2.52 (s, 3H), 2.34-2.24 (m, 1H), 2.23-2.16 (m, 1H), 2.12-2.01 (m, 1H), 2.01-1.93 (m, 1H), 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −113.54 (s), −113.56 (s). 392 .sup.1H NMR (400 MHz, Chloroform-d): δ ppm 7.54 484.2 (1H, s), 7.48 (2H, s), 4.55 (1H, d, J = 11.2 Hz), 4.25 (1H, d, J = 11.4 Hz), 3.78-3.84 (1H, m), 3.53-3.59 (1H, m), 3.22 (1H, s), 2.73 (6H, d, J = 2.2 Hz), 2.61 (6H, s), 2.30 (1H, d, J = 13.1 Hz), 1.95-2.02 (3H, m), 1.10 (2H, t, J = 3.5 Hz), 0.99 (2H, t, J = 6.7 Hz). 393 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2) δ ppm 8.47 (d, J = 462.2 4.9 Hz, 1H), 7.55 (dd, J = 8.9, 5.9 Hz, 1H), 7.34 (dd, J = 8.8, 5.9 Hz, 1H), 7.27 (s, 1H), 7.20 (d, J = 4.4 Hz, 1H), 5.02 (d, J = 13.5 Hz, 1H), 4.85 (d, J = 13.4 Hz, 1H), 4.56 (dd, J = 10.3, 2.0 Hz, 1H), 4.18 (dd, J = 11.5, 2.4 Hz, 1H), 3.83 (td, J = 11.7, 2.7 Hz, 1H), 3.31 (td, J = 13.4, 3.5 Hz, 1H), 3.03 (dd, J = 13.4, 10.6 Hz, 1H), 2.68 (s, 3H), 2.57 (s, 3H), 2.55 (s, 3H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −115.10 (s), −122.08 (s). 394 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.62 468.20 (t, J = 7.8 Hz, 1H), 7.48 (s, 1H), 7.42 (s, 1H), 7.31 (d, J = 8.5 Hz, 1H), 7.26 (d, J = 9.8 Hz, 1H), 4.84 (d, J = 13.4 Hz, 1H), 4.77 (d, J = 13.5 Hz, 1H), 3.66-3.50 (m, 1H), 3.41 (d, J = 11.9 Hz, 1H), 3.35-3.08 (m, 2H), 3.10-2.95 (m, 1H), 2.65 (s, 3H), 2.54 (d, J = 2.5 Hz, 3H), 2.36 (t, J = 11.9 Hz, 1H), 2.16 (s, 3H), 1.08 (q, J = 3.5 Hz, 2H), 0.98 (d, J = 6.8 Hz, 2H). 395 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.67- 488.20 7.58 (m, 1H), 7.48 (s, 1H), 7.42 (s, 1H), 7.31 (d, J = 8.4 Hz, 1H), 7.26 (d, J = 9.8 Hz, 1H), 4.91- 4.80 (m, 1H), 4.81-4.68 (m, 1H), 3.57 (tq, J = 7.5, 4.1 Hz, 1H), 3.48-3.36 (m, 1H), 3.32-3.20 (m, 1H), 3.20-3.11 (m, 1H), 3.10-2.97 (m, 1H), 2.65 (s, 3H), 2.54 (d, J = 2.8 Hz, 3H), 2.42-2.31 (m, 1H), 2.16 (s, 3H), 1.14-1.05 (m, 2H), 1.02-0.92 (m, 2H). 396 .sup.1H NMR (400 MHz, CD.sub.2Cl.sub.2δ ppm 8.81 (s, 1H), 482.20 8.41 (s, 1H), 7.50-7.45 (m, 1H), 7.43-7.37 (m, 1H), 7.23 (s, 1H), 7.13 (d, J = 4.6 Hz, 1H), 4.55 (d, J = 11.5 Hz, 1H), 4.34 (dd, J = 10.6, 3.8 Hz, 1H), 3.84 (td, J = 11.7, 3.2 Hz, 1H), 3.66-3.57 (m, 1H), 2.86 (s, 3H), 2.51 (s, 3H), 2.47-2.40 (m, 1H), 2.25-2.13 (m, 2H), 2.01-1.90 (m, 1H). 19F NMR (376 MHz, CD.sub.2Cl.sub.2) δ ppm −133.01 (s), −138.66 (s). 397 .sup.1H NMR (400 MHz, CD2Cl2) δ ppm 8.41 (d, J = 482.20 5.1 Hz, 1H), 7.51-7.44 (m, 1H), 7.44-7.36 (m, 1H), 7.22 (s, 1H), 7.13 (d, J = 4.7 Hz, 1H), 4.54 (dd, J = 11.6, 1.2 Hz, 1H), 4.37-4.30 (m, 1H), 3.88-3.77 (m, 1H), 3.63-3.52 (m, 1H), 2.80 (s, 3H), 2.70 (s, 3H), 2.51 (s, 3H), 2.46-2.39 (m, 1H), 2.23-2.11 (m, 2H), 2.00-1.89 (m, 1H) 398 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.66 (dd, J = 477.1 14.9, 8.2 Hz, 1H), 7.52 (d, J = 6.9 Hz, 2H), 7.06- 6.92 (m, 2H), 6.90 (s, 1H), 5.06 (t, J = 3.6 Hz, 1H), 4.34 (dd, J = 12.9, 3.3 Hz, 1H), 4.07-3.87 (m, 2H), 3.62 (dd, J = 12.9, 3.8 Hz, 1H), 3.51 (ddd, J = 11.0, 7.4, 3.8 Hz, 1H), 3.06 (dt, J = 22.0, 11.0 Hz, 1H), 2.63 (d, J = 32.2 Hz, 6H), 1.26 (d, J = 6.3 Hz, 3H), 1.07-1.00 (m, 2H), 0.98-0.88 (m, 2H). 399 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.48- 446.2 8.46 (1H, m), 7.82 (1H, s), 7.71-7.67 (1H, m), 7.33 (2H, m), 7.08-7.03 (1H, m), 7.02-6.96 (1H, m), 4.96-4.92 (1H, m), 3.98 (2H, m), 3.56-3.53 (1H, m), 2.78 (3H, s), 2.70 (3H, s), 2.66-2.60 (4H, m), 2.30-2.17 (3H, m). 400 .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 8.48- 446.2 8.46 (1H, m), 7.82 (1H, s), 7.71-7.67 (1H, m), 7.33 (2H, m), 7.08-7.03 (1H, m), 7.02-6.96 (1H, m), 4.96-4.92 (1H, m), 3.98 (2H, m), 3.56-3.53 (1H, m), 2.78 (3H, s), 2.70 (3H, s), 2.66-2.60 (4H, m), 2.30-2.17 (3H, m). 401 463.1 402 478.0 403 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.66 (dd, J = 477.1 14.9, 8.2 Hz, 1H), 7.52 (d, J = 6.9 Hz, 2H), 7.06- 6.92 (m, 2H), 6.90 (s, 1H), 5.06 (t, J = 3.6 Hz, 1H), 4.34 (dd, J = 12.9, 3.3 Hz, 1H), 4.07-3.87 (m, 2H), 3.62 (dd, J = 12.9, 3.8 Hz, 1H), 3.51 (ddd, J = 11.0, 7.4, 3.8 Hz, 1H), 3.06 (dt, J = 22.0, 11.0 Hz, 1H), 2.63 (d, J = 32.2 Hz, 6H), 1.26 (d, J = 6.3 Hz, 3H), 1.07-1.00 (m, 2H), 0.98-0.88 (m, 2H). 404 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.38 (s, 1H), 486.0 7.66-7.36 (m, 2H), 5.06 (s, 1H), 4.70 (dt, J = 100.5, 50.4 Hz, 2H), 4.05-3.68 (m, 2H), 3.49 (dq, J = 7.3, 3.8 Hz, 1H), 3.27 (d, J = 87.1 Hz, 1H), 2.70 (s, 3H), 2.59 (d, J = 10.7 Hz, 6H), 1.24 (s, 3H), 1.02 (dd, J = 8.4, 4.9 Hz, 2H), 0.93 (t, J = 16.8 Hz, 2H). 405 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.38 (s, 1H), 486.0 7.54 (d, J = 8.6 Hz, 2H), 5.06 (d, J = 44.1 Hz, 2H), 4.57 (dd, J = 10.9, 2.4 Hz, 1H), 3.80 (ddd, J = 10.6, 6.3, 2.5 Hz, 1H), 3.65-3.52 (m, 1H), 3.05 (s, 1H), 2.81 (dd, J = 13.2, 10.8 Hz, 1H), 2.71 (s, 3H), 2.58 (s, 6H), 1.33 (d, J = 4.2 Hz, 3H), 1.13 (s, 2H), 0.99 (dd, J = 27.6, 6.8 Hz, 2H). 406 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.75 (d, J = 471.0 7.1 Hz, 1H), 7.56 (d, J = 3.9 Hz, 1H), 7.47 (d, J = 15.4 Hz, 1H), 4.86-4.13 (m, 2H), 3.88-3.75 (m, 1H), 3.51 (t, J = 33.6 Hz, 2H), 2.81 (d, J = 5.2 Hz, 3H), 2.59 (s, 7H), 2.32 (d, J = 13.7 Hz, 1H), 2.08 (dd, J = 20.6, 8.9 Hz, 2H), 1.03 (d, J = 5.0 Hz, 4H). 407 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.75 (d, J = 471.0 7.1 Hz, 1H), 7.56 (d, J = 3.9 Hz, 1H), 7.47 (d, J = 15.4 Hz, 1H), 4.86-4.13 (m, 2H), 3.88-3.75 (m, 1H), 3.51 (t, J = 33.6 Hz, 2H), 2.81 (d, J = 5.2 Hz, 3H), 2.59 (s, 7H), 2.32 (d, J = 13.7 Hz, 1H), 2.08 (dd, J = 20.6, 8.9 Hz, 2H), 1.03 (d, J = 5.0 Hz, 4H). 408 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.46 (s, 2H), 500.0 5.05 (t, J = 3.5 Hz, 1H), 4.86 (s, 1H), 4.60 (s, 1H), 3.90 (s, 2H), 3.49 (ddd, J = 11.1, 7.3, 3.8 Hz, 1H), 3.15 (s, 1H), 2.70 (d, J = 14.3 Hz, 3H), 2.63 (s, 3H), 2.60 (s, 6H), 1.26-1.22 (m, 3H), 1.05-0.99 (m, 2H), 0.95 (d, J = 14.3 Hz, 2H). 409 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.46 (s, 2H), 500.0 5.05 (t, J = 3.4 Hz, 1H), 4.87 (s, 1H), 4.60 (s, 1H), 3.89 (s, 2H), 3.49 (ddd, J = 11.1, 7.3, 3.8 Hz, 1H), 3.14 (s, 1H), 2.66 (d, J = 10.5 Hz, 3H), 2.63 (s, 3H), 2.60 (s, 6H), 1.23 (d, J = 6.2 Hz, 3H), 1.05- 0.99 (m, 2H), 0.94 (s, 2H). 410 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.58-7.50 500.0 (m, 2H), 5.09-4.89 (m, 2H), 4.57 (dd, J = 10.9, 2.6 Hz, 1H), 3.80 (ddd, J = 10.6, 6.3, 2.6 Hz, 1H), 3.58 (tt, J = 7.3, 3.8 Hz, 1H), 3.07-2.99 (m, 1H), 2.79 (dd, J = 13.3, 10.7 Hz, 1H), 2.68 (s, 3H), 2.63 (s, 3H), 2.58 (s, 6H), 1.32 (d, J = 6.2 Hz, 3H), 1.13 (s, 2H), 1.05-0.98 (m, 2H). 411 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.57-7.51 500.0 (m, 2H), 4.98 (d, J = 46.1 Hz, 2H), 4.57 (dd, J = 10.9, 2.6 Hz, 1H), 3.80 (ddd, J = 10.5, 6.2, 2.5 Hz, 1H), 3.58 (tt, J = 7.3, 3.8 Hz, 1H), 3.07-2.98 (m, 1H), 2.79 (dd, J = 13.3, 10.7 Hz, 1H), 2.68 (s, 3H), 2.63 (s, 3H), 2.58 (s, 6H), 1.32 (d, J = 6.1 Hz, 3H), 1.10 (d, J = 16.9 Hz, 2H), 1.05-0.98 (m, 2H). 412 513.0 413 513.0 414 478.2 415 463.1 416 462.2 417 462.2 418 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.72 (dd, J = 14.8, 478.1 8.1 Hz, 1H), 7.51 (d, J = 9.1 Hz, 2H), 7.11-6.89 (m, 2H), 5.06 (s, 1H), 4.75 (d, J = 69.4 Hz, 2H), 3.86 (d, J = 64.9 Hz, 2H), 3.49 (s, 1H), 3.21 (s, 1H), 2.72 (s, 3H), 2.60 (s, 3H), 1.25 (d, J = 6.3 Hz, 3H), 1.01 (s, 2H), 0.93 (dd, J = 6.7, 3.1 Hz, 2H). 419 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 8.42 (s, 1H), 463.0 7.66-7.58(m, 1H), 7.51(d, J = 8.2 Hz, 2H), 7.08- 6.94(m, 2H), 6.90(s, 1H), 5.07 (t, J = 3.7 Hz, 1H), 4.38 (dd, J = 12.8, 3.4 Hz, 1H), 4.03-3.89 (m, 2H), 3.66 (dd, J = 13.0, 3.9 Hz, 1H), 3.51 (td, J = 7.3, 3.7 Hz, 1H), 3.12 (dd, J = 12.5, 8.6 Hz, 1H), 2.70 (s, 3H), 1.27 (d, J = 6.3 Hz, 3H), 1.07- 1.01 (m, 2H), 0.99-0.91 (m, 2H). 420 464.0 422 513.0 424 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.66 (t, J = 494.0 7.8 Hz, 1H), 7.52 (s, 2H), 7.37-7.27 (m, 2H), 5.06 (s, 1H), 4.76 (d, J = 57.5 Hz, 2H), 3.86 (d, J = 65.7 Hz, 2H), 3.50 (s, 1H), 3.21 (s, 1H), 2.72 (s, 3H), 2.59 (s, 3H), 1.25 (d, J = 6.2 Hz, 3H), 1.02 (s, 2H), 0.95 (s, 2H). 425 .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.65 (t, J = 494.0 7.8 Hz, 1H), 7.53 (t, J = 4.1 Hz, 2H), 7.30 (t, J = 6.0 Hz, 1H), 7.24 (d, J = 2.0 Hz, 1H), 4.97 (s, 2H), 4.60 (d, J = 8.7 Hz, 1H), 3.89-3.76 (m, 1H), 3.57 (ddd, J = 11.1, 7.3, 3.9 Hz, 1H), 3.07 (dd, J = 13.3, 11.0 Hz, 1H), 2.84 (dd, J = 13.4, 10.7 Hz, 1H), 2.71 (s, 3H), 2.59 (s, 3H), 1.32 (d, J = 6.2 Hz, 3H), 1.15-1.07 (m, 2H), 1.01 (dt, J = 12.3, 6.3 Hz, 2H). 426 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.71 (dd, J = 14.9, 478.1 7.8 Hz, 1H), 7.54 (t, J = 4.8 Hz, 2H), 7.10-6.87 (m, 2H), 5.03 (d, J = 37.5 Hz, 2H), 4.60 (d, J = 8.5 Hz, 1H), 3.92-3.72 (m, 1H), 3.57 (ddd, J = 10.9, 7.2, 3.7 Hz, 1H), 3.08 (dd, J = 13.4, 11.0 Hz, 1H), 2.84 (dd, J = 13.3, 10.7 Hz, 1H), 2.71 (s, 3H), 2.59 (s, 3H), 1.33 (d, J = 6.2 Hz, 3H), 1.16-1.08 (m, 2H), 1.01 (q, J = 6.8 Hz, 2H). 427 .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.71 (dd, J = 15.0, 478.1 7.9 Hz, 1H), 7.54 (t, J = 5.2 Hz, 2H), 7.07-6.93 (m, 2H), 5.03 (d, J = 37.1 Hz, 3H), 4.60 (d, J = 8.6 Hz, 1H), 3.91-3.74 (m, 1H), 3.65-3.47 (m, 1H), 3.08 (dd, J = 13.3, 11.0 Hz, 1H), 2.84 (dd, J = 13.4, 10.7 Hz, 1H), 2.71 (s, 3H), 2.59 (s, 3H), 1.33 (d, J = 6.2 Hz, 3H), 1.16-1.07 (m, 2H), 1.06- 0.97 (m, 2H).

Synthesis of Intermediates

Method 11

Intermediate 1; 5,7-dichloro-2,3-dimethylpyrido[3,4-b]pyrazine

(912) ##STR01799##

(913) A 500 mL round bottom flask was charged with 3,4-diamino-2,6-dichloropyridine (27 g, 152 mmol) and 2,3-butanedione (15.99 mL, 182 mmol). EtOH (152 mL) was added to the flask and the mixture was heated to 70° C. After 5 h, the mixture was filtered through a fritted funnel and the eluent was concentrated to about 75 mL under reduced pressure. H.sub.2O (150 mL) was added to the solution and the resulting solid was filtered off. The combined solid from both filtrations was washed with H.sub.2O 3 times and was allowed to dry on the filter under air to afford 5,7-dichloro-2,3-dimethylpyrido[3,4-b]pyrazine as a light brown solid (34.5 g, 152 mmol). LC/MS (ESI.sup.+) m/z=228.0 [M+H].sup.+ 1H NMR (500 MHz, Chloroform-d) δ ppm 7.82 (s, 1H), 2.83 (s, 3H), 2.80 (s, 3H).

Method 12

Intermediate 2; 6,8-dichloro-2,3-dimethylpyrido[2,3-b]pyrazine

(914) ##STR01800##

(915) 4,6-dichloropyridine-2,3-diamine (30 g, 169 mmol) and butane-2,3-dione (16.12 mL, 185 mmol) were combined in a 1 L round bottom flask. EtOH (600 mL) was added and the mixture was heated to 80° C. for 5 h. After cooling, the solvent was removed under reduced pressure. The resulting solid was triturated with diethyl ether and was filtered to afford 6,8-dichloro-2,3-dimethylpyrido[2,3-b]pyrazine as a light brown solid (36.5 g, 160 mmol). LC/MS (ESI.sup.+) m/z=228.0 [M+H].sup.+ 1H NMR (400 MHz, DMSO-d6); δ ppm 8.21 (s, 1H), 2.76 (s, 6H)

Method 13

Intermediate 3; 2,4-dichloro-6,7-dimethylpteridine

(916) ##STR01801##

(917) In a 100 mL round bottom flask 2,6-dichloropyrimidine-4,5-diamine (5 g, 27.9 mmol) and butane-2,3-dione (2.91 mL, 33.5 mmol) were combined in EtOH (27.9 mL) and the mixture was stirred at 30° C. for 18 h. After cooling, the solvent was removed under reduced pressure. The resulting solid was triturated with diethyl ether and filtered to afford 2,4-dichloro-6,7-dimethylpteridine (6.02 g, 26.3 mmol) as a light brown solid. LC/MS (ESI.sup.+) m/z=229.0 [M+H].sup.+ 1H NMR (500 MHz, Chloroform-d) δ ppm 2.88 (s, 3H), 2.87 (s, 3H).

Method 14

Intermediate 4; 5,7-dichloro-2-methylpyrido[3,4-b]pyrazine

(918) ##STR01802##

(919) Reaction was set up in two batches using 20 g and 25 g of 2,6-dichloropyridine-3,4-diamine (45 g, 252 mmol total). To a 50 mL round bottom flask were added 2,6-dichloropyridine-3,4-diamine (25 g, 140 mmol) and 2-oxopropanal (30.4 g, 169 mmol) in EtOH (250 mL). The reaction mixture was heated at 85° C. for 2 h. The reaction flask was cooled to room temperature. The mixture was diluted with H.sub.2O and the resulting solids were filtered and washed with H.sub.2O. The solid material was dissolved in DCM, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to furnish the reaction crude. This crude material was combined with 2,6-dichloropyridine-3,4-diamine from the second batch and both absorbed onto a plug of silica gel and purified by chromatography through a silica gel column, eluting with a gradient of 100% DCM, to provide 5,7-dichloro-2-methylpyrido[3,4-b]pyrazine (25.57 g, 119 mmol) as an off-white solid and 7.8 g of mixture of 2 isomers. Major isomer; LC/MS (ESI.sup.+) m/z=213.9 [M+H].sup.+ 1H NMR (400 MHz, DMSO-d6); δ ppm 9.06 (s, 1H), 8.11 (s, 1H), 2.79 (s, 3H). Minor isomer; LC/MS (ESI.sup.+) m/z=214.0 [M+H].sup.+ 1H NMR (400 MHz, DMSO-d6); δ ppm 9.16 (s, 1H), 8.20 (s, 1H), 2.79 (s, 3H).

Method 15

Intermediate 5; 5,7-dichloro-2,3-dimethyl-1,8-naphthyridine and

Intermediate 6; 2,4-dichloro-7-ethyl-1,8-naphthyridine

(920) ##STR01803##

(921) A screw-capped vial was charged with 2-amino-4,6-dichloronicotinaldehyde (0.5 g, 2.62 mmol) and methyl ethyl ketone (2.62 mL). To this solution was added KOH (0.147 g, 2.62 mmol). The reaction was stirred overnight at room temperature. H.sub.2O was added and the aqueous phase was neutralized to a pH of 7 using 1N aqueous HCl. The aqueous phase was extracted with DCM. The organic phase was separated using a phase separator and was concentrated under reduced pressure. The crude material was purified by silica gel chromatography (0-10% MeOH (+1% NH.sub.3) in DCM) to afford 5,7-dichloro-2,3-dimethyl-1,8-naphthyridine (0.284 g, 1.25 mmol, 47.7%). LC/MS (ESI.sup.+) m/z=227.0 [M+H].sup.+ and 2,4-dichloro-7-ethyl-1,8-naphthyridine (0.18 g, 0.79 mmol) LC/MS (ESI.sup.+) m/z=227.0 [M+H].sup.+.

Method 16

Intermediate 7; 5,7-dichloro-2-methyl-1,6-naphthyridine

(922) ##STR01804##

(923) To a 50 mL vial were added 4-amino-2,6-dichloronicotinaldehyde (1.91 g, 10 mmol, JW Pharmlab) and KOH (0.84 g, 15.0 mmol) in acetone (10 mL). The reaction was stirred at rt for 30 min and a precipitate formed. The reaction mixture was diluted with EtOAc, dried, and concentrated. The crude material was purified via chromatography (0-30% EtOAc in DCM) to yield 1.65 g (71%) of 5,7-dichloro-2-methyl-1,6-naphthyridine as an off-white solid.

Method 17

Intermediate 8; 2,4-dichloro-7-methyl-1,8-naphthyridine

(924) ##STR01805##

(925) To a 50 mL vial were added 2-amino-4,6-dichloronicotinaldehyde (0.3507 g, 1.836 mmol) and acetone (1.836 mL). To this solution was added KOH (0.155 g, 2.75 mmol). The reaction was stirred at room temperature for 30 minutes. H.sub.2O was added and the aqueous phase was extracted with DCM. The organic phase was separated using a phase separator and was concentrated under reduced pressure to afford 2,4-dichloro-7-methyl-1,8-naphthyridine (0.317 g, 1.49 mmol). LC/MS (ESI.sup.+) m/z=213.0 [M+H].sup.+

Method 18

Intermediate 9; 7-chloro-5-(4-chloro-2-fluorophenyl)-2-methyl-1,6-naphthyridine

(926) ##STR01806##

(927) 5,7-dichloro-2-methyl-1,6-naphthyridine (Intermediate 7, 0.852 g, 4 mmol), (1,1′-bis(diphenyl-phosphino)ferrocene)dichloropalladium (0.146 g, 0.200 mmol), (4-chloro-2-fluorophenyl)-boranediol (0.697 g, 4.00 mmol) and Cs.sub.2CO.sub.3 (3.91 g, 12.00 mmol) were combined in a 50 mL vial. The vial was evacuated and filled with N.sub.2, and 1,4-dioxane (10 mL) and H.sub.2O (3 mL) were added. The reaction was stirred at 60° C. for 30 min, cooled to rt, and partitioned between DCM and H.sub.2O. The mixture was passed through a phase separation cartridge, concentrated, and purified via silica gel chromatography (0-50% EtOAc in heptane) to yield 7-chloro-5-(4-chloro-2-fluorophenyl)-2-methyl-1,6-naphthyridine (710 mg, 2.3 mmol, 58%).

(928) TABLE-US-00015 TABLE 9 Intermediates 10-58 were prepared following the procedure described in Method 18, as follows: Int Starting Starting # Structure Name Material 1 Material 2 10 07embedded image 6-chloro-4-(4-chloro- 2-fluorophenyl)-2- methyl-2,3-dihydro- 1H-pyrrolo[3,4- c]pyridin-1-one 6-chloro-4-(4- chloro-2- fluorophenyl)- 2,3-dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Enamine, Monmouth Jct., NJ, USA) (4-chloro-2- fluorophenyl) boronic acid 11 08embedded image 3-chloro-1-(4-chloro- 2-fluorophenyl)-6- methylisoquinoline 1,3-dichloro-6- methylisoquinoline (Enamine, Monmouth Jct., NJ, USA) (4-chloro-2- fluorophenyl) boronic acid 12 09embedded image 7-chloro-5-(4-chloro- 2-fluorophenyl)-2,3- dimethyl-1,6- naphthyridine 5,7-dichloro-2,3- dimethyl-1,6- naphthyridine (PharmaBlock Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 13 0embedded image 2-chloro-4-(4-chloro- 2-fluorophenyl)-7- methylpteridine 2,4-dichloro-7- methylpteridine (PharmaBlock Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 14 embedded image 2-chloro-4-(2,4- difluorophenyl)-7- methylpteridine 2,4-dichloro-7- methylpteridine (PharmaBlock Hatfield, PA, USA) (2,4- difluorophenyl) boronic acid 15 embedded image 2-chloro-4-(2-fluoro- 4-methylphenyl)-7- methylpteridine 2,4-dichloro-7- methylpteridine (PharmaBlock Hatfield, PA, USA) (2-fluoro-4- methylphenyl) boronic acid 16 embedded image 2-chloro-4-(4-chloro- 2-fluorophenyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4-chloro-2- fluorophenyl) boronic acid 17 embedded image 2-chloro-4-(2,4- difluorophenyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (2,4- difluorophenyl) boronic acid 18 embedded image 2-chloro-4-(2-fluoro- 4- (trifluoromethyl)phenyl)- 6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (2-fluoro-4- (trifluoromethyl) phenyl)boronic acid 19 embedded image 2-chloro-4-(2-fluoro- 4-methylphenyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (2-fluoro-4- methylphenyl) boronic acid 20 embedded image 2-chloro-6,7-dimethyl- 4-(3,4,5- trifluorophenyl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (3,4,5- trifluorophenyl) boronic acid 21 embedded image 2-chloro-6,7-dimethyl- 4-(6- (trifluoromethyl)pyridin- 3-yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (6- (trifluoromethyl) pyridin-3- yl)boronic acid 22 embedded image 2-chloro-6,7-dimethyl- 4-(6-methylpyridin-3- yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (6-methylpyridin- 3-yl)boronic acid 23 0embedded image 2-chloro-4-(4-chloro- 2-methylphenyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4-chloro-2- methylphenyl) boronic acid 24 embedded image 2-chloro-4-(4-fluoro- 2-methylphenyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4-fluoro-2- methylphenyl) boronic acid 25 embedded image 2-chloro-4-(3,4- difluorophenyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (3,4- difluorophenyl) boronic acid 26 embedded image 2-chloro-6,7-dimethyl- 4-(2,3,4- trifluorophenyl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (2,3,4- trifluorophenyl) boronic acid 27 embedded image 2-chloro-6,7-dimethyl- 4-(2,4,5- trifluorophenyl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (2,4,5- trifluorophenyl) boronic acid 28 embedded image 6-chloro-8-(4-chloro- 2-fluorophenyl)-3- methylpyrido[2,3- b]pyrazine 6,8-dichloro-3- methylpyrido[2,3- b]pyrazine (PharmaBlock Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 29 embedded image 6-chloro-8-(4-chloro- 2-fluorophenyl)-2,3- dimethylpyrido[2,3- b]pyrazine 6,8-dichloro-2,3- dimethylpyrido[2,3- b]pyrazine (Intermediate 2) (4-chloro-2- fluorophenyl) boronic acid 30 embedded image 6-chloro-8-(2,4- difluorophenyl)-2,3- dimethylpyrido[2,3- b]pyrazine 6,8-dichloro-2,3- dimethylpyrido[2,3- b]pyrazine (Intermediate 2) (2,4- difluorophenyl) boronic acid 31 embedded image 6-chloro-8-(2-fluoro- 4-methylphenyl)-2,3- dimethylpyrido[2,3- b]pyrazine 6,8-dichloro-2,3- dimethylpyrido[2,3- b]pyrazine (Intermediate 2) (2-fluoro-4- methylphenyl) boronic acid 32 embedded image 7-chloro-5-(4-chloro- 2-fluorophenyl)-2- methylpyrido[3,4- b]pyrazine 5,7-dichloro-2- methylpyrido[3,4- b]pyrazine (Intermediate 4) (4-chloro-2- fluorophenyl) boronic acid 33 0embedded image 7-chloro-5-(4-chloro- 2-fluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazine 5,7-dichloro-2,3- dimethylpyrido[3,4- b]pyrazine (Intermediate 1) (4-chloro-2- fluorophenyl) boronic acid 34 embedded image 7-chloro-5-(2,4- difluorophenyl)-2,3- dimethylpyrido[3,4- b]pyrazine 5,7-dichloro-2,3- dimethylpyrido[3,4- b]pyrazine (Intermediate 1) (2,4- difluorophenyl) boronic acid 35 embedded image 7-chloro-5-(2-fluoro- 4-methylphenyl)-2,3- dimethylpyrido[3,4- b]pyrazine 5,7-dichloro-2,3- dimethylpyrido[3,4- b]pyrazine (Intermediate 1) (2-fluoro-4- methylphenyl) boronic acid 36 embedded image 2-chloro-4-(4-chloro- 2- fluorophenyl)pyrido[2,3- d]pyrimidine 2,4- dichloropyrido[2,3- d]pyrimidine (Combi-Blocks, San Diego, CA, USA) (4-chloro-2- fluorophenyl) boronic acid 37 embedded image 2-chloro-4-(4-chloro- 2-fluorophenyl)-7- methylpyrido[2,3- d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 38 embedded image 2-chloro-4-(2,4- difluorophenyl)-7- methylpyrido[2,3- d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (2,4- difluorophenyl) boronic acid 39 embedded image 2-chloro-4-(2-fluoro- 4-methylphenyl)-7- methylpyrido[2,3- d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (2-fluoro-4- methylphenyl) boronic acid 40 embedded image 2-chloro-4-(4-chloro- 2-fluorophenyl)-6,7- dimethylpyrido[2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 41 embedded image 2-chloro-4-(2,4- difluorophenyl)-6,7- dimethylpyrido [2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine Hatfield, PA, (PharmaBlock, USA) (2,4- difluorophenyl) boronic acid 42 embedded image 2-chloro-4-(2-fluoro- 4-methylphenyl)-6,7- dimethylpyrido[2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (2-fluoro-4- methylphenyl) boronic acid 43 0embedded image 2,6-dichloro-4-(4- chloro-2- fluorophenyl)-7- methylpyrido[2,3- d]pyrimidine 2,4,6-trichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 44 embedded image 7-chloro-5-(4-chloro- 2-fluorophenyl)-2- methylquinazoline 5,7-dichloro-2- methylquinazoline (PharmaBlock, Hatfield, PA, USA) (4-chloro-2- fluorophenyl) boronic acid 45 embedded image 7-chloro-5-(2,4- difluorophenyl)-2- methylquinazoline 5,7-dichloro-2- methylquinazoline (PharmaBlock, Hatfield, PA, USA) (2,4- difluorophenyl) boronic acid 46 embedded image 6-chloro-4-(4-chloro- 2-fluorophenyl)-2- ethyl-2,3-dihydro-1H- pyrrolo[3,4-c]pyridin- 1-one 4,6-dichloro-2- ethyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Enamine, Monmouth Jct., NJ, USA) (4-chloro-2- fluorophenyl) boronic acid 47 embedded image 6-chloro-4-(4-chloro- 2-fluorophenyl)-2- isopropyl-2,3-dihydro- 1H-pyrrolo[3,4- c]pyridin-1-one 4,6-dichloro-2- isopropyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Enamine, Monmouth Jct., NJ, USA) (4-chloro-2- fluorophenyl) boronic acid 48 embedded image 2-chloro-6,7-dimethyl- 4-(4- (trifluoromethyl) cyclohex-1-en-1- yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4- (trifluoromethyl) cyclohex-1-en-1- yl)boronic acid 49 embedded image 2-chloro-4-(4,4- difluorocyclohex-1- en-1-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4,4- difluorocyclohex- 1-en-1-yl)boronic acid 50 embedded image 4-(4-((tert- butyldimethylsilyl)oxy) cyclohex-1-en-1-yl)- 2-chloro-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4-((tert- butyldimethylsilyl) oxy)cyclohex- 1-en-1-yl)boronic acid 51 embedded image 2-chloro-4-(cyclopent- 1-en-1-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) cyclopent-1-en-1- ylboronic acid 52 embedded image 2-chloro-4-(cyclohex- 1-en-1-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) cyclohex-1-en-1- ylboronic acid 53 0embedded image 2-chloro-6,7-dimethyl- 4-(4-methylcyclohex- 1-en-1-yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4- methylcyclohex- 1-en-1-yl)boronic acid 54 embedded image 2-chloro-4-(4,4- dimethylcyclohex-1- en-1-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (4,4- dimethylcyclohex- 1-en-1- yl)boronic acid 55 embedded image 2-chloro-6,7-dimethyl- 4-(spiro[2.5]oct-5-en- 6-yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) spiro[2.5]oct-5- en-6-ylboronic acid 56 embedded image 2-chloro-7-methyl-4- (4- (trifluoromethyl) cyclohex-1-en-1- yl)pyrido[2,3- d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (4- (trifluoromethyl) cyclohex-1-en-1- yl)boronic acid 57 embedded image 2-chloro-4-(4,4- difluorocyclohex-1- en-1-yl)-7- methylpyrido[2,3- d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock, Hatfield, PA, USA) (4,4- difluorocyclohex- 1-en-1-yl)boronic acid 58 embedded image 2-chloro-6,7-dimethyl- 4-((1S,2S)-2- (trifluoromethyl) cyclopropyl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) ((1S,2S)-2- (trifluoromethyl) cyclopropyl) boronic acid

Method 19

Intermediate 59; 2-chloro-6,7-dimethyl-4-((trans)-3-(trifluoromethyl)cyclobutyl)pteridine and

Intermediate 60; 2-chloro-6,7-dimethyl-4-((cis)-3-(trifluoromethyl)cyclobutyl)pteridine

(929) ##STR01856##

Step 1; (3-(trifluoromethyl)cyclobutyl)zinc(II) chloride

(930) Magnesium (0.190 g, 7.82 mmol) was cleaned with a crystal of iodine then suspended in dry THF (3 mL) under N.sub.2. 1-bromo-3-(trifluoromethyl)cyclobutane (1.25 g, 6.16 mmol) was added and the mixture stirred at rt. The mixture was stirred at ambient temperature for ˜60 minutes and became a milky suspension. Zinc chloride solution in 2-MeTHF (2.92 mL, 5.54 mmol) was added dropwise and the mixture was stirred for 30 minutes. A white precipitate formed. The mixture was centrifuged for 10 min and the resulting dark yellow supernatant solution was used without further manipulation.

Step 2; 2-chloro-6,7-dimethyl-4-(3-(trifluoromethyl)cyclobutyl)pteridine

(931) To a 40 mL vial was added bis(di-tert-butyl(4-dimethylaminophenyl)phosphine)-dichloropalladium(ii) (0.354 g, 0.500 mmol) and 2,4-dichloro-6,7-dimethylpteridine (Intermediate 3) (1.145 g, 5.00 mmol, Syngene) under N.sub.2, 2.0 mL THF was added at rt, followed by ((1R,3R)-3-(trifluoromethyl)cyclobutyl)zinc(II) bromide in THF (1.0 eq). The solution turned purple and was stirred at 45 for 40 min. The reaction was concentrated, diluted with DCM (20 mL), quenched with H.sub.2O (10 mL) and HCl (2N, 3 mL) and extracted with DCM. The DCM extracts were combined, washed with brine, dried over MgSO.sub.4 and concentrated. The residue was purified via silica gel chromatography (0%-40% EtOAc/EtOH in 10% DCM in Heptane) to afford 2-chloro-6,7-dimethyl-4-(3-(trifluoromethyl)cyclobutyl)pteridine (1.51 g, 4.77 mmol, 95% yield) as a yellow solid (˜2.5/1 ratio of the cis/trans isomer). The compound was repurified via silica gel chromatography (0%80% EtOAc in 1000 DCM in Heptane) to afford;

(932) Peak 1; 2-chloro-6,7-dimethyl-4-(trans-3-(trifluoromethyl)cyclobutyl)-pteridine (0.864 g, 2.73 mmol, 54.6 yield) as a yellow solid. 2H NMR (500 MHz, Chloroform-d) δ ppm 4.89-4.98 (i, 1H), 3.08-3.29 (m, 1H), 2.66-2.88 (n, 10H), .sup.19F NMR (Chloroform-d, 471 MHz) δ ppm−74.03 (s); m/z (ESI, +ve ion); 317.0 (M+H).sup.+

(933) Peak 2; 2-chloro-6,7-dimethyl-4-(cis-3-(trifluoromethyl)cyclobutyl)pteridine, 19% as a yellow solid. .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 4.56-4.68 (m, 1H), 3.10-3.17 (m, 1H), 2.63-2.78 (in, 10H), .sup.19F NMR (Chloroform-d, 471 MHz) δ ppm−73.38 (s); m/z (ESI, +ve ion); 317.0 (M+H).sup.+

(934) TABLE-US-00016 TABLE 10 Intermediates 61-70 and 110-113 were prepared following the procedure described in Method 19, as follows: Starting Starting Int # Structure Name Material 1 Material 2  61 embedded image 2-chloro-7-methyl-4- (trans-3- (trifluoromethyl) cyclobutyl)pteridine 2,4-dichloro-7- methylpteridine (PharmaBlock Hatfield, PA, USA) 1-bromo-3- (trifluoromethyl) cyclobutane  62 embedded image 2-chloro-7-methyl-4- (cis-3- (trifluoromethyl) cyclobutyl)pteridine 2,4-dichloro-7- methylpteridine (PharmaBlock Hatfield, PA, USA) 1-bromo-3- (trifluoromethyl) cyclobutane  63 embedded image 7-chloro-2,3- dimethyl-5-(trans-3- (trifluoromethyl) cyclobutyl)pyrido[3,4- b]pyrazine 5,7-dichloro-2,3- dimethylpyrido[3,4- b]pyrazine (Intermediate 1) 1-bromo-3- (trifluoromethyl) cyclobutane  64 0embedded image 2-chloro-7-methyl-4- (trans-3- (trifluoromethyl)cyclo- butyl)pyrido[2,3- d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock Hatfield, PA, USA) 1-bromo-3- (trifluoromethyl) cyclobutane  65 embedded image 2-chloro-6,7- dimethyl-4-(trans-3- (trifluoromethyl)cyclo- butyl)pyrido[2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine (PharmaBlock Hatfield, PA, USA) 1-bromo-3- (trifluoromethyl) cyclobutane  66 embedded image 6-chloro-2-methyl-4- (3- (trifluoromethyl)cyclo- butyl)-2,3-dihydro- 1H-pyrrolo[3,4- c]pyridin-1-one 4,6-dichloro-2- methyl-2,3- dihydro-1H- pyrrolo[3,4- c]pyridin-1-one (Enamine, Monmouth Jct., NJ, USA) 1-bromo-3- (trifluoromethyl) cyclobutane  67 embedded image 2-chloro-4-(3- (difluoromethyl)cyclo- butyl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 1-bromo-3- (difluoromethyl) cyclobutane  68 embedded image 2-chloro-6,7- dimethyl-4-(5,8- dioxaspiro[3.4]octan- 2-yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 2-bromo-5,8- dioxaspiro[3.4] octane  69 embedded image 2-chloro-4-(6,6- difluorospiro[3.3] heptan-2-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 6-bromo-2,2- difluorospiro [3.3]heptane  70 embedded image 2-chloro-6,7- dimethyl-4-(3,3,3- trifluoropropyl) pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (3,3,3- trifluoropropyl) zinc(II) bromide 110 embedded image 7-chloro-5-(2,4- difluorophenyl)-2- methylpyrido[3,4- b]pyrazine 5,7-dichloro-2- methylpyrido[3,4- b]pyrazine 2,4-difluoro-1- iodobenzene 111 embedded image 2-chloro-4-[4-chloro- 2- (trifluoromethyl) phenyl]-6,7-dimethyl- pteridine 2,4-dichloro-7- methylpteridine 4-chloro-1- iodo-2- (trifluoromethyl) benzene 112 embedded image 2-chloro-4-(4-chloro- 2,3-difluoro-phenyl)- 7-methyl-pteridine 2,4-dichloro-7- methyl-pteridine 1,2-dichloro-3- fluoro-4- iodobenzene 113 0embedded image 2-chloro-4-(4-chloro- 2,3-difluoro-phenyl)- 6,7- bis(trideuteriomethyl) pteridine 2,4-dichloro-6,7- bis(trideuterio- methyl)pteridine 1,2-dichloro-3- fluoro-4- iodobenzene

Method 20

Intermediate 71; 2-chloro-6,7-dimethyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridine

(935) ##STR01871##

(936) Step 1; (3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)zinc(II) chloride.

(937) To an oven-dried 40 mL vial was added magnesium (122 mg, 5.04 mmol) and a small piece of I.sub.2 (˜5 mg). The vial was evacuated and filled with N.sub.2 3 times and 1.0 mL THF was added. The vial was sonicated for 1 min and stirred at rt for 5 min. The mixture became a dark red/purple suspension. Then 1-iodo-3-(trifluoromethyl)bicyclo[1.1.1]pentane (1200 mg, 4.58 mmol) in 1 mL THF was added dropwise at room temperature. The purple I.sub.2 color disappeared quickly, but no further exotherm was noticed. The vial was sealed and heated at 74° C. The mixture quickly turned clear and gradually became cloudy again. The mixture was heated for another 30 min until minimal Mg was left. An aliquot of the mixture was taken and subject to H and F NMR analysis, which showed >90% conv. to the Grignard reagent [Product; .sup.19F NMR (Chloroform-d, 471 MHz) δ−73.99 (s, 1F); Substrate; .sup.19F NMR (Chloroform-d, 471 MHz) δ−71.81 (s, 1F)]. The reaction mixture was cooled to room temperature. Zinc chloride solution in 2-MeTHF (2290 μL, 4.58 mmol) was added dropwise with an ice-H.sub.2O bath. The mixture was warmed to rt and stirred for 30 minutes. A white precipitate formed, and the mixture was left to settle overnight. The clear supernatant solution was used without further manipulation. Titration with I.sub.2 confirmed organozinc formation (12.3 mg I.sub.2, 0.115 mL solution, 0.42 M solution in THF). Approximately 6.5 mL was able to be taken out (2.7 mmol, 59% yield).

Step 2; 2-chloro-6,7-dimethyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridine

(938) To a 40 mL vial was added bis(di-tert-butyl(4-dimethylaminophenyl)phosphine)-dichloro-palladium(ii) (49.6 mg, 0.070 mmol) and 2,4-dichloro-6,7-dimethylpteridine (Intermediate 3) (160 mg, 0.700 mmol, Syngene). The vial was evacuated and filled with N.sub.2 3 times. 0.5 mL THF was added at rt, followed with (3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)zinc(II) chloride (1.0 eq). The solution gradually turned purple and was stirred at 45° C. After 40 min, reaction reached ˜90% conv. No change was observed after 2 h. The reaction was concentrated, diluted with DCM (8 mL), quenched with H.sub.2O (4 mL) and HCl (2 N, 0.4 mL), and extracted with DCM (10 mL×3). The DCM extracts were separated with a phase separator, concentrated, and purified with column chromatography (RediSep 12 g, 0%-40% EA/EtOH=3/1 blend in 10% DCM in Heptane) to afford 2-chloro-6,7-dimethyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridine (174 mg, 0.529 mmol, 76% yield) as a yellow solid. .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 2.82 (m, 6H), 2.69 (s, 6H). .sup.19F NMR (471 MHz, Chloroform-d) S ppm−73.11 (s). m/z (ESI, +ve ion); 329.0 (M+H).sup.+.

(939) TABLE-US-00017 TABLE 11 Intermediates 72 and 114-116 were prepared following the procedure described in Method 20, as follows: Int # Structure Name Starting Material  72 embedded image 2-chloro-7-methyl-4-(3- (trifluoromethyl)bicyclo[1.1.1]pentan-1- yl)pyrido[2,3-d]pyrimidine 2,4-dichloro-7- methylpyrido[2,3- d]pyrimidine (PharmaBlock Hatfield, PA, USA) 114 embedded image 7-chloro-2,3-dimethyl-5-(3- (trifluoromethyl)bicyclo[1.1.1]pentan-1- yl)pyrido[3,4-b]pyrazine 5,7-dichloro-2,3- dimethyl- pyrido[3,4- b]pyrazine 115 embedded image 7-chloro-2-methyl-5-[3- (trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]pyrido[3,4- b]pyrazine 5,7-dichloro-2- methyl-pyrido[3,4- b]pyrazine 116 embedded image 7-chloro-2-methyl-5-[3- (trifluoromethyl)-1- bicyclo[1.1.1]pentanyl]-1,6- naphthyridine 5,7-dichloro-2- methyl-1,6- naphthyridine

Intermediate 108; 2-chloro-7-methyl-4-(3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)pteridine

(940) ##STR01876##

(941) Intermediate 108 was prepared substantially as described in Method 20. To a 40 mL vial was added bis(di-tert-butyl(4-dimethylaminophenyl)phosphine)-dichloro-palladium(ii) (99 mg, 0.140 mmol) and 2,4-dichloro-7-dimethylpteridine (300 mg, 1.395 mmol, WuXi). The vial was evacuated and filled with N.sub.2 3 times. 3.5 mL THF was added at rt, followed with (3-(trifluoromethyl)bicyclo[1.1.1]pentan-1-yl)zinc(II) chloride (3671 μL, 1.395 mmol, 1.0 equiv., see Method 20, step 1). The solution gradually turned purple and was stirred at 45° C. overnight. The reaction was quenched with NH.sub.4Cl and EtOAc and extracted into EtOAc. The combined organic extracts were dried over MgSO4, filtered and concentrated to give the crude product. The crude material was purified by column chromatography to yield the desired product. m/z (ESI, +ve ion); 315.0 (M+H).sup.+.

Method 21

Intermediate 73; 4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)piperidine

(942) ##STR01877##

Step 1; Tert-butyl 4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)piperidine-1-carboxylate

(943) To a 100-mL round-bottomed flask was added tert-butyl 3-(1-methyl-1H-pyrazol-4-yl)-4-oxopiperidine-1-carboxylate (1 g, 1.647 mmol)) in DCM (40 mL) and DAST (2.2 mL, 16.47 mmol) at 0° C. The reaction mixture was warmed to room temperature, stirred for 48 h, quenched with 10% sodium bicarbonate (50 mL) and extracted with DCM (30 mL). The organic extract was dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated in vacuo to give the crude material as an orange oil. The crude material was purified by silica gel chromatography eluting with 50% EtOAc in hexane, to provide tert-butyl 4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)piperidine-1-carboxylate (500 mg, 1.1 mmol, 64.5% yield) as yellow oil.

Step 2; 4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)piperidine hydrochloride

(944) To a 10-mL round-bottomed flask was added tert-butyl 4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)piperidine-1-carboxylate (60 mg, 0.199 mmol)) in DCM (4 mL). The mixture was cooled to 0° C. and HCl in dioxane (0.5 mL, 2.000 mmol) was added. The reaction mixture was warmed to room temperature, stirred for 2h, then concentrated in vacuo to give the crude product which was washed with diethyl ether to provide 4,4-difluoro-3-(1-methyl-1H-pyrazol-4-yl)piperidine hydrochloride (25 mg, 0.124 mmol, 62.4% yield) as white solid (hygroscopic). .sup.1H NMR (400 MHz, DMSO-d6); δ ppm 9.36 (d, J=25.1 Hz, 2H), 7.73 (s, 1H), 7.41 (s, 1H), 3.82 (s, 4H), 3.57 (s, 2H), 3.18 (d, J=5.1 Hz, 1H), 2.39 (d, J=11.9 Hz, 2H).

Method 22

Intermediate 74; (2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)zinc(II) bromide

(945) ##STR01878##

Step 1; 4-(4-bromotetrahydro-2H-pyran-2-yl)-1-methyl-1H-pyrazole

(946) To a 100 mL flask was charged 1-methyl-1H-pyrazole-4-carbaldehyde (1.03 g, 9.35 mmol), 3-buten-1-ol (0.708 g, 0.842 mL, 9.82 mmol) and DCM (18.7 mL). To the flask was added hydrogen bromide-acetic acid (6.88 g, 5.08 mL, 28.1 mmol) in one portion. After 1 h, the crude reaction was carefully quenched with saturated NaHCO.sub.3 solution and washed with EtOAc. The combined organic layer was dried over Na.sub.2SO.sub.4 and was filtered, and concentrated. The resulting crude material was purified by silica gel chromatography, eluting with 0% to 40% EtOAc/EtOH (3:1) in heptane, to provide 4-(4-bromotetrahydro-2H-pyran-2-yl)-1-methyl-1H-pyrazole (1.31 g, 5.33 mmol, 57% yield) as a light yellow oil as an ˜3:1 mixture of cis/trans diastereomers. A second silica gel column provided the pure cis (0.85 g) and trans (0.27) isomers. If desired, the major (cis) diastereomers can be separated by SFC (Chiralpak AY-H 2×25 cm, 5 μm columns; mobile phase=10% EtOH, F=60 mL/min).

(947) Major diastereomer (cis isomers); .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.46 (s, 1H), 7.36 (s, 1H), 4.36 (dd, J=11.3, 2.1 Hz, 1H), 4.25 (tt, J=11.9, 4.5 Hz, 1H), 4.08 (ddd, J=12.0, 4.8, 1.8 Hz, 1H), 3.89 (s, 3H), 3.58 (td, J=12.1, 2.3 Hz, 1H), 2.52 (ddt, J=12.9, 4.3, 2.1, 2.1 Hz, 1H), 2.12-2.26 (m, 3H). m/z (ESI, +ve ion); 245.0 [M+H].sup.+.

(948) Minor diastereomer (trans isomers); .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.46 (s, 1H), 7.35 (s, 1H), 4.93 (dd, J=10.0, 2.9 Hz, 1H), 4.79 (quin, J=3.1 Hz, 1H), 4.12 (td, J=11.6, 2.1 Hz, 1H), 3.92-3.99 (m, 1H), 3.89 (s, 3H), 2.16-2.29 (m, 3H), 1.93-2.02 (m, 1H). m/z (ESI, +ve ion); 245.0 [M+H].sup.+.

Step 2; (2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)zinc(II) bromide

(949) To an oven-dried 50 mL flask was added Zn (0.320 g, 4.90 mmol), which was evacuated and backfilled with N.sub.2 3 times and the flask was capped with a rubber septum. Then a thermocouple probe was inserted and lithium chloride solution 0.5 M in anhydrous THF (3.26 mL, 1.632 mmol) was added. 1,2-dibromoethane (0.015 g, 7.03 μL, 0.082 mmol) was then added and the mixture was heated to an internal temp of 50° C. and held for 20 min. The flask was removed from the heating block and cooled to room temperature. Chlorotrimethylsilane (8.86 mg, 10.36 μL, 0.082 mmol) was added and the mixture was heated to an internal temperature of 50° C. and the temperature was held for 20 min. The flask was removed from the heating block and cooled to room temperature. Diiodine (8.28 mg, 0.033 mmol) was added as a solution in THF 0.1 mL, and the mixture was heated to an internal temperature of 50° C. and the temperature held for 20 min. While still hot, 4-bromotetrahydro-2H-pyran-2-yl)-1-methyl-1H-pyrazole (3:1 cis/trans mixture, 0.4 g, 1.632 mmol) was added as a THF solution (1.5 mL) and the resulting mixture was stirred at 50° C. overnight. The reaction solution was cooled to room temperature as the zinc powder was allowed to settle to provide a yellow solution of (2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)zinc(II) bromide.

(950) TABLE-US-00018 TABLE 12 Intermediates 75-77 were prepared following the procedure described in Method 22, as follows: Int # Structure Name Starting Material 75 embedded image (2-(2-methylpyridin- 4-yl)tetrahydro-2H- pyran-4-yl)zinc(II) bromide 2- methylisonicotinalde- hyde 76 0embedded image (2-(2- methoxypyridin-4- yl)tetrahydro-2H- pyran-4-yl)zinc(II) bromide 2- methoxyisonicotinalde- hyde 77 embedded image (2-(2- methylpyrimidin-5- yl)tetrahydro-2H- pyran-4-yl)zinc(II) bromide 2-methylpyrimidine- 5-carbaldehyde 78 embedded image (2-methyl-6-(1- methyl-1H-pyrazol-4- pyran-4-yl)zinc(II) yl)tetrahydro-2H- bromide 1-methyl-1H- pyrazole-4- carbaldehyde

Method 23

Intermediate 79; 1-methyl-4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydro-2H-pyran-2-yl)-1H-pyrazole

(951) ##STR01883##

(952) Step 1; To a 20 mL scintillation vial was charged 1-methyl-1H-pyrazole-4-carbaldehyde (200 mg, 1.816 mmol), which was purged with N.sub.2. Then (2-hydroxyethyl)acetylene (191 mg, 206 μl, 2.72 mmol) and DCM (3.6 mL) were added. To the vial was added trifluoromethane sulfonic acid (327 mg, 194 μl, 2.180 mmol) slowly at 0° C. The reaction was warmed to room temperature after 5 min. After 5 h, additional trifluoromethane sulfonic acid (327 mg, 194 μl, 2.180 mmol) was added. After another 18 h, the crude reaction was carefully quenched with saturated NaHCO.sub.3 solution and washed with DCM. The combined organic layers were dried over Na.sub.2SO.sub.4, filtered, and concentrated. The resulting crude material was absorbed onto a plug of silica gel and purified by chromatography through a Redi-Sep pre-packed silica gel column (40 g), eluting with 0% to 70% EtOAc in heptane, to provide 6-(1-methyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl trifluoromethanesulfonate (227 mg, 0.727 mmol, 40% yield) as a light yellow oil. m/z (ESI, +ve ion); 313.0 [M+H].sup.+. .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.49 (s, 1H), 7.37 (s, 1H), 5.96 (dt, J=2.6, 1.4 Hz, 1H), 5.34 (q, J=2.6 Hz, 1H), 3.98-4.04 (m, 1H), 3.92 (s, 3H), 3.85 (ddd, J=11.5, 6.4, 5.2 Hz, 1H), 2.45-2.60 (m, 2H).

Step 2; 1-methyl-4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydro-2H-pyran-2-yl)-1H-pyrazole

(953) To a 20 mL scintillation vial was charged 6-(1-methyl-1H-pyrazol-4-yl)-3,6-dihydro-2H-pyran-4-yl trifluoromethanesulfonate (227 mg, 0.727 mmol), [1,1′-bis(diphenylphosphino)ferrocene]-dichloropalladium(ii), complex with DCM (59.4 mg, 0.073 mmol), bis(pinacolato)diboron (277 mg, 1.09 mmol) and potassium acetate (285 mg, 2.91 mmol). The flask was purged with N.sub.2 and 1,4-dioxane (2.9 mL) was added. The reaction was heated to 90° C. for 2 h and the reaction was cooled to room temperature. The reaction mixture was diluted with EtOAc and filtered through a plug of silica gel. The crude material purified by silica gel chromatography eluting with 0% to 100% EtOAc in heptane, to provide 1-methyl-4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydro-2H-pyran-2-yl)-1H-pyrazole (87 mg, 0.30 mmol, 41% yield) as a red oil. m/z (ESI, +ve ion); 291.2 [M+H].sup.+. .sup.1H NMR (500 MHz, Chloroform-d) δ ppm 7.48 (s, 1H), 7.36 (s, 1H), 6.61 (q, J=1.9 Hz, 1H), 5.20 (q, J=2.6 Hz, 1H), 3.89-3.93 (m, 1H), 3.89 (s, 3H), 3.71-3.78 (m, 1H), 2.28-2.39 (m, 1H), 2.17-2.27 (m, 1H), 1.30 (s, 12H).

(954) TABLE-US-00019 TABLE 13 Intermediates 80-82 were prepared following the procedure described in Method 23, as follows: Int # Structure Name Starting Material 80 embedded image 1-cyclopropyl-4-(4- (4,4,5,5- tetramethyl-1,3,2- dioxaborolan-2-yl)- 5,6-dihydro-2H- pyran-2-yl)-1H- pyrazole 1-cyclopropyl-1H- pyrazole-4-carbaldehyde 81 embedded image 2-methyl-4-(4- (4,4,5,5- tetramethyl-1,3,2- dioxaborolan-2-yl)- 5,6-dihydro-2H- pyran-2-yl)pyridine 2- methylisonicotinaldehyde 82 embedded image 2-methyl-5-(4- (4,4,5,5- tetramethyl-1,3,2- dioxaborolan-2-yl)- 5,6-dihydro-2H- pyran-2- yl)pyrimidine 2-methylpyrimidine-5- carbaldehyde

Method 24

Intermediate 83; 2-chloro-4-(3-methoxyazetidin-1-yl)-6,7-dimethylpteridine

(955) ##STR01887##

(956) To a 10 mL vial containing 3-methoxyazetidine (0.026 g, 0.3 mmol) in DMF (1 mL) was added 2,4-dichloro-6,7-dimethylpteridine (Intermediate 3) (0.069 g, 0.3 mmol) and diisopropylethylamine (0.209 mL, 1.200 mmol). The mixture was heated at 95° C. for 7 h then cooled to rt. Conversion to the desired product (LCMS analysis) was high and the mixture was used without purification.

(957) TABLE-US-00020 TABLE 14 Intermediates 84-92 were prepared following the procedure described in Method 24, as follow1: Int. Starting Starting # Structure Name Material 1 Material 2 84 embedded image 2-chloro-4-(3- fluoroazetidin-1-yl)- 6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 3- fluoroazetidine 85 embedded image 2-chloro-6,7- dimethyl-4-(3- (trifluoromethyl) azetidin-1-yl)pteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 3- (trifluoromethyl) azetidine 86 0embedded image 2-chloro-4-((1R,5S)- 6,6-difluoro-3- azabicyclo[3.1.0] hexan-3-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) (1R,5S)-6,6- difluoro-3- azabicyclo [3.1.0]hexane 87 embedded image 2-chloro-4-(4,4- difluoropiperidin-1- yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 4,4- difluoropiperidine 88 embedded image 2-chloro-4-(4,4- dimethylpiperidin-1- yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 4,4- dimethylpiperidine 89 embedded image 2-chloro-4-(3,3- difluoropiperidin-1- yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 3,3- difluoropiperidine 90 embedded image 2-chloro-4-(3- fluoropiperidin-1- yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 3- fluoropiperidine 91 embedded image 2-chloro-4-(3,3- difluoropyrrolidin-1- yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 3,3- difluoropyrrolidine 92 embedded image 2-chloro-4-(3,3- dimethylpyrrolidin- 1-yl)-6,7- dimethylpteridine 2,4-dichloro-6,7- dimethylpteridine (Intermediate 3) 3,3- dimethylpyrrolidine

Method 25

Intermediate 93; 2-chloro-4-((3,3-difluorocyclobutyl)methoxy)-6,7-dimethylpyrido[2,3-d]pyrimidine

(958) ##STR01897##

(959) To a 10 mL vial was added 2,4-dichloro-6,7-dimethylpyrido[2,3-d]pyrimidine (49.8 mg, 0.218 mmol) and (3,3-difluorocyclobutyl)methanol (32.0 mg, 0.262 mmol) in tetrahydrofuran (1091 μL). The mixture was cooled to 0° C. and potassium t-butoxide (262 μL, 0.262 mmol) solution was added. After stirring for 1 h the solution was quenched with H.sub.2O (10 mL) extracted with EtOAc and the organic layer dried over Na.sub.2SO.sub.4 and concentrated under vacuum. The crude product, 2-chloro-4-((3,3-difluorocyclobutyl)methoxy)-6,7-dimethylpyrido[2,3-d]pyrimidine, was used in subsequent steps without further purification.

(960) TABLE-US-00021 TABLE 15 Intermediates 94-96 were prepared following the procedure described in Method 25, as follows: Starting Starting Int # Structure Name Material 1 Material 2 94 embedded image 2-chloro-6,7-dimethyl-4- (((cis)-3- (trifluoromethyl)cyclobutyl) methoxy)pyrido[2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine (PharmaBlock Hatfield, PA, USA) ((cis)-3- (trifluoro- methyl)cyclo- butyl)methanol 95 embedded image 2-chloro-6,7-dimethyl-4- (((1R,2R)-2- (trifluoromethyl)cyclo- propyl)methoxy)pyrido[2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine (PharmaBlock Hatfield, PA, USA) ((1R,2R)-2- (trifluoro- methyl)cyclo- propyl)methanol 96 00embedded image (S)-2-chloro-4-((2,2- dimethylcyclopropyl) methoxy)-6,7- dimethylpyrido[2,3- d]pyrimidine 2,4-dichloro-6,7- dimethylpyrido[2,3- d]pyrimidine (PharmaBlock Hatfield, PA, USA) (S)-(2,2- dimethyl- cyclopropyl) methanol

Method 26

Intermediate 97; (S)-4-(4-chloro-6,7-dimethyl-1,8-naphthyridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine

(961) ##STR01901##

(962) To a solution of 5,7-dichloro-2,3-dimethyl-1,8-naphthyridine (Intermediate 5, 0.234 g, 1.030 mmol) and DIEA 0.266 g, 0.359 mL, 2.061 mmol) in DMSO (3.4 mL) was added (S)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (Enamine, Monmouth Jct., N.J., USA) (0.207 g, 1.237 mmol). The reaction mixture was stirred at 100° C. for 7 h. After cooling, the mixture was diluted with H.sub.2O and extracted with DCM. The organic phase was separated, concentrated under vacuum and purified by silica gel chromatography (0-10% MeOH (+1% NH.sub.3) in DCM) to afford the title compound (S)-4-(4-chloro-6,7-dimethyl-1,8-naphthyridin-2-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.121 g, 0.339 mmol, 33.0%) m/z (ESI, +ive ion); 358.0 (M+H).sup.+, and the regioisomeric byproduct (S)-4-(2-chloro-6,7-dimethyl-1,8-naphthyridin-4-yl)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (0.0183 g, 0.051 mmol, 4.9% yield).

(963) TABLE-US-00022 TABLE 16 Intermediates 98-102 were prepared following the procedure described in Method 26, as follows: Int. # Structure Name Starting Material 98 02embedded image (S)-4-(4-chloro-7-methyl- 1,8-naphthyridin-2-yl)-2- (1-methyl-1H-pyrazol-4- yl)morpholine 2,4-dichloro-7- methyl-1,8- naphthyridine (Intermediate 8) 99 03embedded image (S)-4-(4-chloro-1,8- naphthyridin-2-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 2,4-dichloro-1,8- naphthyridine (Combi-Blocks, San Diego, CA, USA) 100 04embedded image (S)-4-(8-chloro-2- methylpyrido[2,3- b]pyrazin-6-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 6,8-dichloro-2- methylpyrido[2,3- b]pyrazine (WuXi Apptech, Shanghai, China) 101 05embedded image (S)-4-(8-chloro-3- methylpyrido[2,3- b]pyrazin-6-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 6,8-dichloro-3- methylpyrido[2,3- b]pyrazine (PharmaBlock Hatfield, PA, USA) 102 06embedded image (S)-4-(8-chloro-2,3- dimethylpyrido[2,3- b]pyrazin-6-yl)-2-(1- methyl-1H-pyrazol-4- yl)morpholine 6,8-dichloro-2,3- dimethylpyrido[2,3- b]pyrazine (Intermediate 2)

Method 27

Intermediate 103; (S)-4-(8-chloro-2,3-dimethylquinoxalin-6-yl)-2-(2-methylpyridin-4-yl)morpholine

(964) ##STR01907##

(965) To a 25-mL reaction vial was added 7-bromo-5-chloro-2,3-dimethylquinoxaline (0.200 g, 0.737 mmol) and (S)-2-(2-methylpyridin-4-yl)morpholine (0.131 g, 0.737 mmol) in toluene (8 mL) followed by sodium tert-butoxide (0.106 g, 1.105 mmol). The reaction mixture was degassed with nitrogen for 5 min, then RuPhos-Pd-G3 (0.062 g, 0.074 mmol) and RuPhos (0.034 g, 0.074 mmol) were added, then the reaction mixture was heated at 80° C. for 2 h. The reaction mixture was diluted with H.sub.2O (7 mL) and extracted with EtOAc (2×10 mL), the organic extracts were dried over Na.sub.2SO.sub.4 and the organic extracts were concentrated to give the crude material. Purification by silica gel chromatography (30% to 100% EtOAc in hexane) provided (S)-4-(8-chloro-2,3-dimethylquinoxalin-6-yl)-2-(2-methylpyridin-4-yl)morpholine (0.170 g, 0.461 mmol, 62.6% yield) as orange solid. m/z (ESI, +ive ion); 351.0 (M+H).sup.+.

(966) TABLE-US-00023 TABLE 17 Intermediate 104 was prepared following the procedure described in Method 27, as follows: Int. Starting Starting Material # Structure Name Material 1 2 104 08embedded image (S)-4-(8-chloro- 2,3- dimethylquinoxalin- 6-yl)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine 7-bromo-5- chloro-2,3- dimethylquinoxaline (WuXi Apptech, Shanghai, China) (S)-2-(1-methyl- 1H-pyrazol-4- yl)morpholine (Enamine, Monmouth Jct., NJ, USA)

Method 28

Intermediate 105; (S)-4-amino-6-(2,4-difluorophenyl)-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pyrimidine-5-carbaldehyde

(967) ##STR01909##

Step 1; 4-amino-2-chloro-6-(4-chloro-2-fluorophenyl)pyrimidine-5-carbaldehyde

(968) In a 100 mL round bottom flask were added dichloro[9,9-dimethyl-4,5-bis(diphenylphosphino)xanthene]palladium(ii) (0.150 g, 0.198 mmol), (4-chloro-2-fluorophenyl)boronic acid (1.73 g, 9.90 mmol), 4-amino-2,6-dichloropyrimidine-5-carbaldehyde (1.9 g, 9.90 mmol) followed by 2-methyltetrahydrofuran (24.7 mL) and potassium phosphate (5.57 ml, 22.27 mmol). The vial was flushed under nitrogen (3×) and the reaction was stirred at 70° C. for 2 h. The reaction mixture was cooled to rt, water was added, and the precipitate was filtered and washed several times with water and diethyl ether. The crude 4-amino-2-chloro-6-(4-chloro-2-fluorophenyl)pyrimidine-5-carbaldehyde (1.3 g, 4.54 mmol, 45.9% yield) was used as such in the next step without further purification. m/z (ESI, +ive ion); 270.1 (M+H).sup.+.

Step 2; (S)-4-amino-6-(2,4-difluorophenyl)-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pyrimidine-5-carbaldehyde

(969) To a solution of 4-amino-2-chloro-6-(2.4-difluorophenyl)pyrimidine-5-carbaldehyde (0.2 g, 0.742 mmol) and DIEA (0.192 g, 0.258 mL, 1.48 mmol) in DMSO (2.47 mL) was added (S)-2-(1-methyl-1H-pyrazol-4-yl)morpholine (Enamine, Monmouth Jct., N.J., USA)(0.149 g, 0.890 mmol). The reaction mixture was stirred at 80° C. for 1h, cooled to rt and water was added. The precipitate was filtered, washed several times with water and then with a small amount of diethyl ether. The resulting solid was dried under vacuum. The crude (S)-4-amino-6-(2,4-difluorophenyl)-2-(2-(1-methyl-1H-pyrazol-4-yl)morpholino)pyrimidine-5-carbaldehyde (0.177 g, 0.441 mmol, 59.5% yield) was used without further purification. m/z (ESI, +ive ion); 401.0 (M+H).sup.+.

(970) TABLE-US-00024 TABLE 18 Intermediate 106 and 107 was prepared following the procedure described in Method 28, as follows: Starting Material Int. # Structure Name (Step 2) 106 0embedded image (S)-4-amino-6-(2,4- difluorophenyl)-2-(2-(2- methylpyridin-4- yl)morpholino)pyrimidine- 5-carbaldehyde (S)-2-(2- methylpyridin-4- yl)morpholine (Intermed Ltd. Kiev, Ukraine) 107 embedded image (S)-4-amino-2-(2-(1- cyclopropyl-1H-pyrazol- 4-yl)morpholino)-6-(2,4- difluorophenyl)pyrimidine- 5-carbaldehyde (S)-2-(1-cyclopropyl- 1H-pyrazol-4- yl)morpholine (Azepine Ltd. Hampshire, UK)

Method 29

Intermediate 117; 2,4-dichloro-7-methylpteridine

(971) ##STR01912##

(972) To a suspension of 2,6-dichloropyrimidine-4,5-diamine (5.00 g, 27.9 mmol) in DCE (250 mL) was added calcium sulfate (10.0 g, 73.5 mmol) followed by a dropwise addition of 2-oxopropanal (40% in water, 5.0 ml, 32.1 mmol). The reaction was stirred at 25° C. overnight then filtered through a plug of celite and evaporated under reduced pressure to afford the desired material as a light-yellow solid. (5.3 g, 88%). MS (m/z+); 215.0 [M+1].sup.+, .sup.1H NMR (400 MHz, chloroform-d); 8.93 (1H, s), 2.91 (3H, s).

(973) TABLE-US-00025 TABLE 19 Intermediate 118 was prepared following the procedure described in Method 29, as follows: Starting Material Starting Material Int # Structure Name 1 2 118 embedded image 2,4-dichloro-6,7- bis(methyl- d3)pteridine 2,6- dichloropyrimidine- 4,5-diamine biacetyl-d6

Method 30

Intermediate 119; 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1-cyclopropyl-1H-pyrazole

(974) ##STR01914## ##STR01915##

(975) Step 1; Ethyl 1-benzyl-1H-pyrazole-4-carboxylate. To a solution of ethyl 1H-pyrazole-4-carboxylate (11.0 g, 78.5 mmol) in DMF (105 mL) was added cesium carbonate (51.2 g, 157 mmol), followed by benzyl bromide (9.3 mL, 78.4 mmol). The reaction was stirred at r.t. for 3 days. Water was added, and the product was extracted with EtOAc. The combined organic layers were washed several times with H.sub.2O, then brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated in vacuo to provide ethyl 1-benzyl-1H-pyrazole-4-carboxylate as a colorless syrup (16.7 g, 75.3 mmol, 96% yield). .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.94 (s, 1H), 7.85 (s, 1H), 7.43-7.30 (m, 3H), 7.26-7.22 (m, 2H), 5.30 (s, 2H), 4.27 (q, J=7.1 Hz, 2H), 1.32 (t, J=7.1 Hz, 3H). LC/MS (ESI.sup.+) m/z=231.1 [M+H].sup.+.

(976) Step 2; (1-benzyl-1H-pyrazol-4-yl)methanol. To a solution of ethyl 1-benzyl-1H-pyrazole-4-carboxylate (6.37 g, 27.7 mmol) in THF (69 mL) at 0° C. was added lithium aluminum hydride (2M in THF, 28 mL, 56.0 mmol) slowly. The solution was warmed to r.t. and stirred for 1 hour. The reaction was cooled to 0° C., and water (2.2 mL) was added dropwise, followed by 1M NaOH (6.0 mL) and water (2.2 mL). The solid was filtered through celite, and the filter cake was rinsed with EtOAc. The filtrate was concentrated in vacuo to provide (1-benzyl-1H-pyrazol-4-yl)methanol (4.43 g, 22.8 mmol, 85% yield) as a colorless syrup. .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.54 (s, 1H), 7.41-7.28 (m, 4H), 7.25-7.19 (m, 2H), 5.28 (s, 2H), 4.57 (s, 2H). LC/MS (ESI.sup.+) m/z=189.1 [M+H].sup.+.

(977) Step 3; 1-benzyl-1H-pyrazole-4-carbaldehyde. To a solution of (1-benzyl-1H-pyrazol-4-yl)methanol (4.43 g, 22.8 mmol) in DCM (40 mL) was added activated manganese(IV) oxide (20.7 g, 235 mmol) portionwise. The mixture stirred overnight at r.t. The solid was filtered through celite and rinsed with DCM. The filtrate was concentrated in vacuo, and the crude material was purified by silica gel chromatography eluting with 0-40% EtOAc in hexanes to provide 1-benzyl-1H-pyrazole-4-carbaldehyde-1 (3.41 g, 18.3 mmol, 76% yield) as a colorless syrup. .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 9.84 (s, 1H), 8.00 (s, 1H), 7.87 (s, 1H), 7.44-7.32 (m, 3H), 7.31-7.21 (m, 2H), 5.34 (s, 2H). LC/MS (ESI.sup.+) m/z=187.1 [M+H].sup.+.

(978) Step 4; 1-benzyl-4-(4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole. To a solution of 1-benzyl-1H-pyrazole-4-carbaldehyde (3.05 g, 16.4 mmol) and 3-buten-1-ol (1.5 mL, 17.0 mmol) in DCM (41 mL) at 0° C. was added hydrobromic acid, 33% in acetic acid (8.1 mL, 49.1 mmol) dropwise. The solution was slowly warmed to r.t. overnight. The solution was then cooled to 0° C. and slowly quenched with saturated NaHCO.sub.3 solution. The product was extracted with DCM. The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4 filtered, and concentrated in vacuo. The crude material was purified by silica gel chromatography eluting with 0-35% EtOAc in hexanes to provide 1-benzyl-4-(4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole (4.13 g, 12.9 mmol, 75% yield) as a 1:1 mixture of cis/trans diastereomers. (.sup.1H NMR reported as a 1:1 mixture of cis and trans.) .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.50 (s, 2H), 7.39-7.27 (m, 8H), 7.24-7.19 (m, 4H), 5.26 (s, 4H), 4.90 (dd, J=9.8, 3.1 Hz, 1H), 4.76 (t, J=3.4 Hz, 1H), 4.33 (dd, J=11.4, 2.0 Hz, 1H), 4.21 (tt, J=11.8, 4.5 Hz, 1H), 4.13-4.01 (m, 2H), 3.92 (dd, J=12.3, 4.7 Hz, 1H), 3.54 (td, J=12.1, 2.3 Hz, 1H), 2.48 (dt, J=14.0, 2.8 Hz, 1H), 2.25-2.18 (m, 2H), 2.18-2.12 (m, 3H), 2.11-2.03 (m, 1H), 1.99-1.87 (m, 1H). LC/MS (ESI.sup.+) m/z=320.9 [M+H].sup.+.

(979) Step 5; 1-benzyl-4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole. The racemic product was purified by chiral SFC on a ChiralART Cel-SB column, 5 to 60% MeOH in aqueous NH.sub.4OH solution to provide 1-benzyl-4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole. .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.50 (s, 1H), 7.44-7.28 (m, 4H), 7.22 (d, J=7.1 Hz, 2H), 5.26 (s, 2H), 4.33 (dd, J=11.4, 2.2 Hz, 1H), 4.26-4.13 (m, 1H), 4.12-3.95 (m, 1H), 3.54 (tt, J=12.1, 2.2 Hz, 1H), 2.48 (ddd, J=13.1, 4.5, 2.2 Hz, 1H), 2.27-2.18 (m, 1H), 2.11 (qd, J=11.9, 5.1 Hz, 2H). LC/MS (ESI.sup.+) m/z=321.0 [M+H].sup.+.

(980) Step 6; 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole. A solution 1-benzyl-4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole (400 mg, 1.25 mmol) in EtOH (6.5 mL) and acetic acid (2.2 mL) was purged with argon via balloon and outlet for 10 minutes. Palladium hydroxide on carbon (70 mg, 0.25 mmol) was added quickly, and the solution was purged with argon via balloon and outlet for another 10 minutes. The argon balloon was replaced with a hydrogen balloon, and the reaction stirred at r.t. overnight. The catalyst was removed by filtration over celite and washed with ethanol several times. The filtrate was concentrated in vacuo. The crude material was purified by silica gel chromatography eluting with 30-100% EtOAc in hexanes to provide 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole (160 mg, 0.692 mmol, 56% yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 12.70 (s, 1H), 7.68 (s, 1H), 7.44 (s, 1H), 4.50 (td, J=12.0, 5.9 Hz, 1H), 4.37 (dd, J=11.1, 2.1 Hz, 1H), 3.91 (dd, J=11.8, 4.8 Hz, 1H), 3.51 (td, J=12.0, 2.1 Hz, 1H), 2.43 (dt, J=13.0, 2.6 Hz, 1H), 2.26-2.12 (m, 1H), 2.07-1.87 (m, 2H). LC/MS (ESI.sup.+) m/z=230.0 [M+H].sup.+.

(981) Step 7; 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1-cyclopropyl-1H-pyrazole. To a solution of 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole (150 mg, 0.649 mmol) and cyclopropylboronic acid (112 mg, 1.30 mmol) in dichloroethane (4.3 mL) at 70° C. was added a mixture of copper(II) acetate (119 mg, 0.649 mmol) and 2,2′-dipyridyl (101 mg, 0.649 mmol) in one portion. The mixture was stirred at 70° C. overnight under oxygen atmosphere. The mixture was cooled to r.t., and saturated NaHCO.sub.3was added. The product was extracted with DCM, and the combined organic layers were washed with brine, dried over Na2SO4, filtered, and concentrated in vacuo. The crude product was purified by silica gel chromatography eluting with 10-60% EtOAc in hexanes to provide 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1-cyclopropyl-1H-pyrazole (160 mg, 0.561 mmol, 86% yield) as a yellow oil. .sup.1H NMR (400 MHz, DMSO-d6) δ ppm 7.73 (s, 1H), 7.36 (s, 1H), 4.49 (tt, J=11.9, 4.4 Hz, 1H), 4.32 (dd, J=11.2, 2.0 Hz, 1H), 3.90 (ddd, J=11.8, 5.0, 1.8 Hz, 1H), 3.65 (tt, J=7.4, 3.9 Hz, 1H), 3.49 (td, J=12.0, 2.1 Hz, 1H), 2.41 (ddt, J=12.6, 4.3, 2.1 Hz, 1H), 2.17 (ddd, J=12.7, 4.5, 2.2 Hz, 1H), 2.05-1.86 (m, 2H), 1.05-0.95 (m, 2H), 0.95-0.87 (m, 2H). LC/MS (ESI.sup.+) m/z=270.8 [M+H].sup.+.

Method 31

Intermediate 120; 4-((2R,4S,6R)-4-bromo-6-methyltetrahydro-2H-pyran-2-yl)-1-cyclopropyl-1H-pyrazole

(982) ##STR01916##

(983) To iron (iii) bromide (3.20 g, 10.8 mmol) in a flame-dried 40 mL pressure vial equipped with a stir bar under argon was added a solution of 1-cyclopropylpyrazole-4-carbaldehyde (1.23 g, 9.03 mmol) and (2R)-pent-4-en-2-ol (778 mg, 9.03 mmol) in DCM (17 mL) under N.sub.2 at 0° C. The reaction mixture was warmed to r.t. and stirred overnight. Water was added (20 mL), and the mixture was stirred for 30 mins. The product was extracted with DCM, and the combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated in vacuo. The crude material was purified by silica gel chromatography eluting with 0-30% EtOAc in hexanes, followed by reverse phase chromatography eluting with 5-95% MeCN in H.sub.2O to provide 4-[(2R,4S,6R)-4-bromo-6-methyl-tetrahydropyran-2-yl]-1-cyclopropyl-pyrazole (612 mg, 2.10 mmol, 23% yield) as a clear syrup. .sup.1H NMR (400 MHz, Chloroform-d) δ ppm 7.66-7.34 (m, 2H), 4.36 (dd, J=11.4, 2.0 Hz, 1H), 4.22 (tt, J=12.1, 4.5 Hz, 1H), 3.60 (ddd, J=11.0, 6.2, 1.9 Hz, 1H), 3.54 (tt, J=7.3, 3.9 Hz, 1H), 2.45 (ddt, J=13.0, 4.4, 2.0 Hz, 1H), 2.28 (ddt, J=12.9, 4.1, 2.0 Hz, 1H), 2.06 (q, J=12.0 Hz, 1H), 1.78 (td, J=12.5, 11.0 Hz, 1H), 1.25 (d, J=6.2 Hz, 3H), 1.13-1.05 (m, 2H), 1.04-0.94 (m, 2H). LC/MS (ESI.sup.+) m/z=285.0 [M+H].sup.+

Method 32

Intermediate 121; 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1-methyl-1H-pyrazole

(984) ##STR01917##

(985) To a solution of 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole (25 mg, 0.108 mmol) in DMF (2.2 mL) was added cesium carbonate (88 mg, 0.270 mmol), followed by methyl iodide (0.0081 mL, 0.130 mmol). The reaction was stirred at r.t. overnight. Water was added, and the product was extracted with EtOAc. The combined organic layers were washed several times with H.sub.2O, then brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated in vacuo. The crude material was purified by silica gel chromatography eluting with 0-5% MeOH in DCM to provide 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1-methyl-1H-pyrazole (18 mg, 0.0734 mmol, 68% yield) as a colorless solid. .sup.1H NMR (400 MHz, DMSO-d) δ ppm 7.64 (s, 1H), 7.36 (s, 1H), 4.50 (tt, J=12.0, 4.6 Hz, 1H), 4.33 (d, J=11.3 Hz, 1H), 3.90 (dd, J=11.8, 4.8 Hz, 1H), 3.78 (s, 3H), 3.50 (td, J=11.8, 2.0 Hz, 1H), 2.41 (d, J=12.5 Hz, 1H), 2.17 (dd, J=9.9, 6.4 Hz, 1H), 2.04-1.85 (m, 2H). LC/MS (ESI.sup.+) m/z=245.0 [M+H].sup.+. The absolute configuration of the starting material 4-((2R,4S)-4-bromotetrahydro-2H-pyran-2-yl)-1H-pyrazole was elucidated by X-ray crystallography.

Method 33

Intermediate 122; 2-(2-methylpyridin-4-yl)morpholine

(986) ##STR01918##

(987) Step 1; 4-(1-ethoxyvinyl)-2-methylpyridine. A 250 mL pressure vessel was charged with 4-bromo-2-methylpyridine (6.90 mL, 58.1 mmol), 1-ethoxyvinyltributyltin (21.6 mL, 63.9 mmol, 1.1 equiv.) and toluene (100 mL) was purged N.sub.2 gas at rt for 10 min. Tetrakis(triphenylphosphine)palladium (2.04 g, 2.91 mmol, 5 mol %) was added under N.sub.2 atmosphere and the reaction mixture was purged with N.sub.2 gas for 5 min at rt. The reaction vessel was sealed and stirred at 110° C. for 16 h. When the reaction was judged complete by LCMS, the reaction mixture was cooled to rt and KF (3.72 g, 1.1 equiv.), Na.sub.2CO.sub.3 (6.78 g, 1.1 equiv.) and silica (30 g) were added. The reaction mixture was stirred for 10 min and filtered through a pad of celite. The celite bed was washed with hexane (50 mL) and the combined filtrate was concentrated under reduced pressure. The crude residue was purified by column chromatography using silica gel, eluting with 0-5% EtOAc in hexane to afford 4-(1-ethoxyvinyl)-2-methylpyridine as a colorless oil (7.46 g, 79%). .sup.1H NMR (400 MHz, DMSO-d6); δ.sub.H 8.41 (d, J=5.2 Hz, 1H), 7.35 (s, 1H), 8.41 (d, J=4.7 Hz, 1H), 5.01 (s, 1H), 4.46 (s, 1H), 3.91 (q, J=6.9 Hz, 2H), 2.47 (s, 3H), 1.35 (t, J=6.9 Hz, 3H). ESI-MS (m/z+); 164.2 [M+H].sup.+, LC-RT; 0.505 min.

(988) Step 2; 1-(2-methylpyridin-4-yl)ethan-1-one. A suspension of 5-(1-ethoxyvinyl)-2-methylpyridine (7.46 g, 45.7 mmol) in 3M HCl (30.5 mL, 91.4 mmol, 2 equiv.) was stirred at rt for 30 min. When the reaction was judged to be complete by LCMS, the reaction mixture was diluted with water (60 mL), basified to pH 11 with 5M NaOH and extracted with EtOAc (3×60 mL). The organic layer was dried (Na.sub.2SO.sub.4), filtered and concentrated under reduced pressure to afford 1-(2-methylpyridin-4-yl)ethan-1-one as a colorless oil (5.35 g, 82%). .sup.1H NMR (400 MHz, DMSO-d6); δ.sub.H 8.65 (d, J=5.0 Hz, 1H), 7.69 (s, 1H), 7.60 (d, J=4.2 Hz, 1H), 2.49 (s, 3H), 2.57 (s, 3H). ESI-MS (m/z+); 136.10 [M+H].sup.+, LC-RT; 0.202 min.

(989) Step 3; 2-bromo-1-(2-methylpyridin-4-yl)ethan-1-one. A 100 mL round bottom flask was charged with 1-(2-methylpyridin-4-yl)ethan-1-one (5.00 g, 37.0 mmol) and HBr (33% in AcOH, 21 mL). The reaction mixture was cooled to 0° C. using an ice/water bath and a solution of bromine (1.9 mL, 37.0 mmol, 1.0 equiv.) in HBr (33% in AcOH, 7 ml) was added dropwise. The reaction mixture was stirred at 40° C. for 1 h and then further stirred at 80° C. for 1 h. When the reaction was judged complete by LCMS, the reaction mixture was cooled to rt, poured in Et.sub.2O (100 mL) and stirred at rt for 30 min. The precipitate was filtered, washed with Et.sub.2O (50 mL) and dried under reduced pressure to afford 2-bromo-1-(2-methylpyridin-4-yl)ethan-1-one (HBr salt) as a yellow solid (10.7 g, 96%). ESI-MS (m/z+); 274.0 [M+H].sup.+, LC-RT; 1.459 min.

(990) Step 4; 2-(benzyl(2-hydroxyethyl)amino)-1-(2-methylpyridin-4-yl)ethan-1-one. To a solution of 2-bromo-1-(2-methylpyridin-4-yl)ethan-1-one acetate (10.7 g, 39.0 mmol) in THF (182 mL) at 0° C. was slowly added N-benzylethanolamine (5.54 mL, 39.0 mmol, 1.0 equiv.) followed by DIPEA (13.6 mL, 78.1 mmol). The reaction was slowly warmed to r.t. overnight, after which a precipitate formed. The solvent was removed in vacuo. Water was then added to the reaction mixture and the aqueous phase was extracted with EtOAc (3×100 mL). The combined organic phases were dried over Na.sub.2SO.sub.4, filtered, and concentrated in vacuo to provide 2-(benzyl(2-hydroxyethyl)amino)-1-(2-methylpyridin-4-yl)ethan-1-one (11.1 g, 100%) as a yellow solid. ESI-MS (m/z+); 285.10 [M+H].sup.+, LC-RT; 0.642 min.

(991) Step 5; 2-(benzyl(2-hydroxyethyl)amino)-1-(2-methylpyridin-4-yl)ethan-1-one. A 500 mL round bottom flask was charged with 2-(benzyl(2-hydroxyethyl)amino)-1-(2-methylpyridin-4-yl)ethan-1-one (11.10 g, 39.0 mmol, 1 equiv.) in methanol (390 mL) and was cooled to 0° C. Sodium borohydride (2.95 g, 78.1 mmol, 2.0 equiv.) was added portion wise then the reaction was gradually warmed to r.t. over 12 h. When the reaction was judged to be complete by LCMS, the solution was cooled to 0° C., and water (250 mL) was added. The product was extracted with EtOAc (3×100 mL), and the combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, filtered, and concentrated in vacuo to give the pure product 2-(benzyl(2-hydroxyethyl)amino)-1-(2-methylpyridin-4-yl)ethan-1-ol (8.45 g, 29.5 mmol, 75.6%) as a clear oil. ESI-MS (m/z+); 287.20 [M+H].sup.+, LC-RT; 0.215 min.

(992) Step 6; 2-(2-methylpyridin-4-yl)morpholine hydrochloride. A flame-dried 50 mL round bottom flask under nitrogen was charged with 4-benzyl-2-(2-methyl-4-pyridyl)morpholine (1.00 eq, 1.35 g, 5.03 mmol), Pd/C (0.252 eq, 135 mg, 1.27 mmol) and HCl (4M in dioxanes, 1.00 eq, 5.03 mmol). The reaction vial was purged with N.sub.2 then the reaction mixture was bubbled with H.sub.2 for 2 min. The needle was removed from the solution and the reaction was stirred at r.t. under positive pressure of H.sub.2 (balloon) overnight. Complete conversion was observed by TLC and LCMS. The reaction mixture was filtrated on a pad of Celite and the solvent was removed in vacuo to yield the desired 2-(2-methyl-4-pyridyl)morpholine hydrochloride (1.01 g, 4.70 mmol, 93.51%). ESI-MS (m/z+); 179.1 [M+H].sup.+, LC-RT; 0.240 min. .sup.1H NMR (DMSO-d6, 400 MHz); δ.sub.H 8.53 (1H, d, J=5.4 Hz), 7.45 (1H, s), 7.36 (1H, d, J=5.3 Hz), 4.94 (1H, d, J=11.0 Hz), 4.13 (1H, d, J=12.7 Hz), 4.00 (1H, t, J=12.3 Hz), 3.52 (1H, d, J=12.7 Hz), 3.06 (1H, t, J=12.4 Hz), 2.90 (1H, t, J=11.9 Hz), 2.54 (3H, s).

Method 34

Intermediate 123; 2-(1-cyclopropyl-1H-pyrazol-4-yl)-6-methylmorpholine

(993) ##STR01919## ##STR01920##

(994) Step 1; To a stirred solution of 1-(1H-pyrazol-4-yl) ethan-1-one (10 g, 0.1 mol) and Cs.sub.2CO.sub.3 (48.3 g, 0.15 mol) in DMF (100 mL) was added (bromomethyl)benzene (20.3 g, 0.12 mol) drop wise at room temperature under N.sub.2. The reaction was stirred at 80° C. for 1 h. The mixture was poured into water (500 mL) and extracted with EA (100 mL×3). The organic phase was washed with brine (100 mL×2), dried over Na.sub.2SO.sub.4 and filtered. The filtration was concentrated under vacuum, the residue was purified by column chromatography on silica gel (PE:EA=5:1) to afford 1-(1-benzyl-1H-pyrazol-4-yl) ethan-1-one (16.0 g) as a light yellow solid. LCMS; (M+H).sup.+=201.1; purity=97.36% (UV 254 nm); retention time=1.542 min.

(995) Step 2; To a solution of 1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-one (3.9 g, 19.47 mmol) in 1,4-dioxane(40 mL) was added CuBr.sub.2 (7.23 g, 32.37 mmol) at rt. After addition, the reaction mixture was stirred at 85° C. for 7 h. The reaction mixture was poured into water (160 mL) and extracted with EA (80 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated. The crude product was purified by silica gel column (PE/EA, 1:10 to 1:5) to give 1-(1-benzyl-1H-pyrazol-4-yl)-2-bromoethan-1-one (2.9 g, 10.39 mmol) as a white solid. LCMS; (M+H).sup.+=280; Retention time=1.75 min.

(996) Step 3; To a solution of compound 1-(1-benzyl-1H-pyrazol-4-yl)-2-bromoethan-1-one (2.9 g, 10.39 mmol) in THF (20 mL) at room temperature was slowly added 1-(benzylamino)propan-2-ol (1.89 g, 11.44 mmol) under N.sub.2. The reaction mixture was stirred at 35° C. for 3 hour to give a yellow solution. Water (20 mL) was added drop wise to quench the reaction. The reaction mixture was extracted with EA (50 mL×3). The combined organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The combined crude material was absorbed onto a plug of silica gel and purified by chromatography through a silica gel column eluting with a silica gel column (PE/EA, 1:10 to 1:2) provide compound 2-(benzyl(2-hydroxypropyl)amino)-1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-one (2.81 g, 7.73 mmol). LCMS; (M+H).sup.+=364; Retention time=1.34 min.

(997) Step 4; To a solution of compound 2-(benzyl(2-hydroxypropyl)amino)-1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-one (2.8 g, 7.70 mmol) in methanol (28 mL) at 0° C. was added sodium tetrahydroborate (0.58 g, 15.40 mmol) portion wise. The reaction mixture was stirred at 0° C. for 30 min and then at room temperature for 2 h. Ice-cooled water (20 mL) was added drop wise to quench the reaction. The reaction mixture was extracted with EA (50 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated to give 1-(benzyl(2-(1-benzyl-1H-pyrazol-4-yl)-2-hydroxyethyl)amino)propan-2-ol(2.8 g, 7.66 mmol) as a yellow liquid compound, which was used directly for next step without further purification. LCMS; (M+H).sup.+=366; Retention time=1.42 min.

(998) Step 5; To a solution of compound 1-(benzyl(2-(1-benzyl-1H-pyrazol-4-yl)-2-hydroxyethyl)amino)propan-2-ol (2.8 g, 7.66 mmol) in 1,4-dioxane (15 mL) at room temperature was slowly added 6M HCl (15 ml). The reaction mixture was stirred at 110° C. for 4 h. 15% KOH was added drop wise to quench the reaction, adjust pH 8-9. The reaction mixture was extracted with EA (100 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated to give 4-benzyl-2-(1-benzyl-1H-pyrazol-4-yl)-6-methylmorpholine(2.39 g, 6.88 mmol) as a yellow liquid compound, which was used directly for next step without further purification. LCMS; (M+H).sup.+=348; Retention time=1.40 min.

(999) Step 6; To a solution of 4-benzyl-2-(1-benzyl-1H-pyrazol-4-yl)-6-methylmorpholine (2.39 g, 6.88 mmol) in methanol (12 mL) and 2.4 mL HCl (6 M) was added Pd(OH).sub.2/C (0.48 g), the reaction mixture was stirred at 30° C. for 16 h. The reaction mixture was filtered and the filtrate was concentrated under vacuum, the residue was adjusted ph to 9-10 by Na.sub.2CO.sub.3 aq. The aqueous phase was directly used in next step. LCMS; (M+H).sup.+=168; Retention time=0.37 min.

(1000) Step 7; To a solution of step 6 in water/1,4-dioxane(10 mL/10 mL) was added Na.sub.2CO.sub.3 (0.88 g, 8.30 mml) and BoC.sub.2O (1.58 g, 7.24 mmol). The reaction mixture was stirred at room temperature for 1 h. The reaction mixture was poured into water (20 mL) and extracted with EA (50 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated to give tert-butyl 2-methyl-6-(1H-pyrazol-4-yl)morpholine-4-carboxylate crude. The crude product was directly used in next step. LCMS; (M+H).sup.+=268; Retention time=1.57 min.

(1001) Step 8; To a solution of tert-butyl 2-methyl-6-(1H-pyrazol-4-yl)morpholine-4-carboxylate (1.77 g, 6.62 mmol) in DMF (35 mL) was added to cyclopropylboronic acid (1.71 g, 19.9 mmol), Cu(OAc).sub.2 (1.32 g, 7.27 mmol), Na.sub.2CO.sub.3 (1.40 g, 13.2 mmol), 2,2′-Dipyridyl (1.14 g, 7.30 mmol) at room temperature. The reaction mixture was stirred at 80° C. for 10 h. The mixture was poured into water (100 mL) and extracted with EA (60 mL×3). The organic phase was washed with brine (60 mL×2), dried over Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated under vacuum. The crude product was purified by silica gel column (PE/EA, 1:10 to 1:5) to give tert-butyl 2-(1-cyclopropyl-1H-pyrazol-4-yl)-6-methylmorpholine-4-carboxylate (1.6 g, 5.20 mmol) as a yellow liquid. LCMS; (M+H)+=308; Retention time=1.51 min.

(1002) Step 9; To a solution of tert-butyl 2-(1-cyclopropyl-1H-pyrazol-4-yl)-6-methylmorpholine-4-carboxylate (1.6 g, 5.20 mmol) in dichloromethane (10 mL) was added TFA (3 mL), The reaction mixture was stirred at room temperature for 1 h. The filtrate was concentrated under vacuum to give 2-(1-cyclopropyl-1H-pyrazol-4-yl)-6-methylmorpholine (1.02 g, 4.93 mmol) as a yellow liquid. LCMS; (M+H)+=208; Retention time=1.14 min.

Method 35

Intermediate 124; 2-chloro-4-(4-chloro-2,3-difluoro-phenyl)-6,7-dimethyl-pteridine

(1003) ##STR01921##

(1004) To a 20 mL microwave vial was added 2,4-dichloro-6,7-dimethyl-pteridine (500 mg, 2.18 mmol), (4-chloro-2,3-difluoro-phenyl)boronic acid (420 mg, 2.18 mmol), sodium carbonate (694 mg, 6.55 mmol), 1,4-dioxane (10 mL) and water (3 mL). The reaction mixture was degassed with nitrogen for 10 min. Pd(PPh.sub.3).sub.4 (126 mg, 0.109 mmol) was added and the reaction mixture was heated at 40° C. for 3.5 h. The mixture was cooled to r.t., diluted with DCM (50 mL) and water (10 mL). The aqueous layer was extracted with DCM (2×20 mL). Combined organic layers were washed with brine (10 mL), dried over Na.sub.2SO.sub.4, and concentrated in vacuo. The crude residue was purified by silica gel chromatography (40 g SilicaSep column) using EtOAc and hexanes (50-60%) to obtain 2-chloro-4-(4-chloro-2,3-difluoro-phenyl)-6,7-dimethyl-pteridine (176 mg, 0.516 mmol, 24%) as a brown solid. ESI-MS (m/z+); 342.0 [M+H].sup.+, LC-RT; 3.579 min. .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 7.53-7.46 (m, 1H), 7.43-7.35 (m, 1H), 2.86 (s, 3H), 2.75 (s, 3H). .sup.19F NMR (376 MHz, CDCl.sub.3) δ ppm−130.92 (s), −137.18 (s).

(1005) TABLE-US-00026 TABLE 20 Intermediate 125 was prepared following the procedure described in Method 35 using the starting materials indicated: Starting Starting Int # Structure Name Material 1 Material 2 125 embedded image 2-chloro-4-(4-chloro- 2,5-difluoro-phenyl)- 6,7-dimethyl-pteridine 2,4-dichloro-6,7- dimethyl- pteridine (intermediate 3) (4-chloro-2,5- difluoro- phenyl)boronic acid

Method 36

Intermediate 126; 2-chloro-6,7-dimethyl-4-(6-(trifluoromethyl)pyridin-3-yl)pteridine

(1006) ##STR01923##

(1007) To a 20 mL sealed tube was added 2,4-dichloro-6,7-dimethylpteridine (2 eq, 1.2 g, 5.24 mmol) and 2-trifluoromethyl-pyridine-5-boronic acid (1 eq, 500 mg, 2.62 mmol), 1,4-dioxane (24.0 mL) and water (4.0 mL). Potassium carbonate (6 eq, 2.18 g, 15.8 mmol) was added and the reaction mixture was degassed with nitrogen for 10 min. RuPhos Pd G3 (0.1 eq, 200 mg, 283 μmol) was added and the reaction mixture was heated at 50° C. for 1 h. The mixture was cooled down to r.t., diluted with water (50.0 mL) and extracted with EtOAc (3×100 mL). The organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated in vacuo. The crude material was purified by silica gel chromatography (120 g cartridge) using hexanes and EtOAc (50-60%) to afford 2-chloro-6,7-dimethyl-4-(6-(trifluoromethyl)pyridin-3-yl)pteridine as a brown solid (867 mg, 65% yield). .sup.1H NMR (400 MHz, CDCl.sub.3) δ ppm 9.88 (s, 1H), 8.94 (d, J=8.3 Hz, 1H), 7.91 (d, J=8.2 Hz, 1H), 2.89 (s, 3H), 2.83 (s, 3H). .sup.19F NMR (376 MHz, Chloroform-d) δ ppm−68.2 (s). m/z (ESI.sup.+); 340.0 [M+H].sup.+.

Method 43

Intermediate 109; (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)morpholine

(1008) ##STR01924##

(1009) Step 1; To a 3-L round-bottomed flask was added 1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-one (70.0 g, 350 mmol) in dichloromethane (2000 mL) and ethanol (550 mL) and pyridinium tribromide (117 g, 367 mmol) were added portion-wise at RT. The reaction mixture was stirred at RT for 4 h, then the reaction mixture was diluted with 1 N sodium sulfate solution (1.5 Lit) and extracted with CH.sub.2CL.sub.2 (2×1500 mL), and the organic extracts were dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated in vacuo to give the crude product as an off-white solid. This crude product was directly used for the next step. .sup.1H NMR (400 MHz, DMSO-d6); δ ppm 8.65 (s, 1H), 8.05 (s, 1H), 7.28-7.38 (m, 5H), 5.39 s, 2H), 4.60 (s, 2H).

(1010) ##STR01925##

(1011) Step 2; To a 3-L round-bottomed flask was added 1-(1-benzyl-1H-pyrazol-4-yl)-2-bromoethan-1-one (203.0 g, 727 mmol) in tetrahydrofuran (2000 mL) and the reaction mixture was cooled to 0° C., then 2-(benzylamino)ethan-1-ol (176 g, 1164 mmol) was added and the reaction mixture was stirred at 0° C. for 30 min, then allowed to stir at RT for 5 h. The reaction mixture was diluted with water (1500 mL) and extracted with EtOAc (2×1500 mL), and the organic extracts were dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated in vacuo to give the crude material 2-(benzyl(2-hydroxyethyl)amino)-1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-one (240 g, 687 mmol, 94% yield) as a light yellow oil. This crude product was directly used for the next step. .sup.1H NMR (400 MHz, DMSO-d6); δ ppm 8.57 (s, 1H), 7.97 (s, 1H), 7.20-7.31 (m, 10H), 5.36 (s, 2H), 4.44 (t, J=5.2 Hz, 1H), 3.68 (d, J=3.1 Hz, 2H), 3.46-3.50 (m, 4H), 2.60 (t, J=6.2 Hz, 2H).

(1012) ##STR01926##

(1013) Step 3; To a 3-L round-bottomed flask was added 2-(benzyl(2-hydroxyethyl)amino)-1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-one (240.0 g, 687 mmol) in methanol (2500 mL) and the reaction mixture was cooled to 0° C. Sodium borohydride (52.0 g, 1374 mmol) was added portion wise and the reaction mixture was stirred at 0° C., then allowed to warm to RT and stirred for 3 h. The solvent was evaporated under reduced pressure, the crude material was diluted with water (700 mL) and extracted with CH.sub.2CL.sub.2 (2×500 mL), and the organic extracts were dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated in vacuo to give the crude material (2-(benzyl(2-hydroxyethyl)amino)-1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-ol (236 g, 672 mmol, 98% yield) as a light colourless oil. The crude product was directly used for the next step. .sup.1H NMR (300 MHz, DMSO-d6); δ ppm 7.62 (s, 1H), 7.19-7.35 (m, 11H), 5.26 (s, 2H), 4.82 (d, J=3.8 Hz, 1H), 4.61-4.64 (m, 1H), 4.37 (t, J=5.4 Hz, 1H), 3.68 (d, J=3.5 Hz, 2H), 3.40-3.46 (m, 2H), 2.64 (m, 4H).

(1014) ##STR01927##

(1015) Step 4; To a 3-L round-bottomed flask was added 2-(benzyl(2-hydroxyethyl)amino)-1-(1-benzyl-1H-pyrazol-4-yl)ethan-1-ol (236.0 g, 672 mmol) in 6N HCl (2000 mL, 1.20E+04 mmol) at RT and the reaction mixture was heated at 110° C. for 3 h, then cooled to RT. The solvent was evaporated under reduced pressure to give the crude material. The crude material was dissolved in water (300 mL) and basified with 10% sodium bicarbonate solution up to pH 9 and extracted with ethyl acetate (2×800 mL), and the organic extracts were dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated in vacuo to give the crude material. The crude material was absorbed onto a plug of silica gel and purified by chromatography through a pre-packed silica gel column (330 g), eluting with a gradient of 5% to 80% EtOAc in hexane, to provide 4-benzyl-2-(1-benzyl-1H-pyrazol-4-yl)morpholine (152 g, 456 mmol, 67.9% yield) as light brown oil. .sup.1H NMR (300 MHz, DMSO-d6); δ ppm 7.74 (s, 1H), 7.19-7.39 (m, 11H), 5.25 (s, 2H), 4.43-4.46 (dd, J=11.1, 2.3 Hz, 1H), 3.78-3.81 (dd, J=11.7, 2.4 Hz, 1H), 3.49-3.61 (m, 3H), 2.79 (dd, J=12.2, 2.4 Hz, 1H), 2.57-2.65 (m, 1H), 2.05-2.17 (m, 2H).

(1016) ##STR01928##

(1017) Step 5; Chiral Separation. The enantiomers were separated via supercritical fluid chromatography. (S)-4-benzyl-2-(1-benzyl-1H-pyrazol-4-yl)morpholine was collected as the first eluting product.

(1018) ##STR01929##

(1019) Step 6; To a 50-mL round-bottomed flask was added (S)-4-benzyl-2-(1-benzyl-1H-pyrazol-4-yl)morpholine (70 g, 210 mmol) in ethanol (7 mL) and HCl (12.76 mL, 420 mmol) and 10% Palladium hydroxide on carbon (36.9 g, 52.5 mmol) were added and the reaction mixture was stirred under 5 kg hydrogen gas atmosphere. The mixture was filtered through celite and washed with ethanol. The filtrate was concentrated to give (S)-2-(1H-pyrazol-4-yl)morpholine dihydrochloride (40 g, 177 mmol, 84% yield). .sup.1H NMR (400 MHz, DMSO-d6); δ ppm 9.86 (s, 1H), 9.70 (s, 1H), 7.68 (d, J=2.8 Hz, 2H), 4.81 (dt, J=11.2, 2.7 Hz, 1H), 4.00 (dd, J=12.6, 4.0 Hz, 1H), 3.91 (tt, J=12.4, 2.7 Hz, 1H), 3.34 (d, J=12.6 Hz, 1H), 3.20 (d, J=12.6 Hz, 1H), 3.03 (dq, J=22.6, 11.3 Hz, 2H)

(1020) ##STR01930##

(1021) Step 7; To a 1-L round-bottomed flask was added (S)-2-(1H-pyrazol-4-yl)morpholine dihydrochloride (40.0 g, 177 mmol) in dichloromethane (800 mL) followed by triethylamine (99 mL, 708 mmol) dropwise at RT. The reaction mixture was cooled to 0° C. then Boc-anhydride (41.1 mL, 177 mmol) was added dropwise at 0° C. and the reaction mixture was stirred at 0° C. for 1 h. The reaction mixture was then diluted with saturated sodium bicarbonate (150 mL) and extracted with CH.sub.2CL.sub.2 (2×200 mL), and the organic extracts were dried over Na.sub.2SO.sub.4. The solution was filtered and concentrated in vacuo to give the crude material. The crude material was absorbed onto a plug of silica gel and purified by chromatography through a pre-packed silica gel column (80 g), eluting with a gradient of 5% to 100% EtOAc in hexane, to provide tert-butyl (S)-2-(1H-pyrazol-4-yl)morpholine-4-carboxylate (35.0 g, 138 mmol, 78% yield) as light brown oil, with tert-butyl (S)-2-(1-(tert-butoxycarbonyl)-1H-pyrazol-4-yl)morpholine-4-carboxylate (9.2 g, 26.0 mmol, 14.71% yield) as a light brown oil side product. .sup.1H NMR (400 MHz, Methanol-d4); δ ppm 7.64 (d, J=36.8 Hz, 2H), 4.50 (dd, J=10.3, 2.8 Hz, 1H), 3.83-4.19 (m, 3H), 3.63 (td, J=11.4, 2.8 Hz, 1H), 3.06 (s, 2H), 1.48 (d, J=1.0 Hz, 9H).

(1022) ##STR01931##

(1023) Step 8; To a 100-mL sealed tube was added tert-butyl (S)-2-(1H-pyrazol-4-yl)morpholine-4-carboxylate (2.50 g, 9.87 mmol) and cyclopropylboronic acid (1.865 g, 21.71 mmol) in 1,2-dichloroethane (40 mL) followed by sodium carbonate (2,301 g, 21.71 mmol), 2,2′-bipyridine (1.696 g, 10.86 mmol) and copper (II) acetate (1.972 g, 10.86 mmol). The reaction mixture was heated at 65° C. for 18 h, then cooled to RT and the solution was filtered through a celite bed and washed with DCM (200 mL), The organic layer was washed with 1 N HCl (50 mL), then the solvent was evaporated under reduced pressure to give the crude material. The crude material was absorbed onto a plug of silica gel and purified by chromatography through a pre-packed silica gel column (40 g), eluting with a gradient of 5% to 80% EtOAc in hexane, to provide tert-butyl (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)morpholine-4-carboxylate (1.65 g, 5.62 mmol, 57.0% yield) as colourless oil. .sup.1H NMR (400 MHz, Methanol-d4); δ ppm 7.71 (s, 1H), 7.48 (d, J=0.8 Hz, 1H), 4.44 (dd, J=10.3, 2.9 Hz, 1H), 3.84-3.99 (m, 3H), 3.59-3.66 (m, 2H), 3.04 (s, 2H), 1.49 (s, 9H), 1.03-1.08 (m 4H)

(1024) ##STR01932##

(1025) Step 9; To a 100-mL round-bottomed flask was added tert-butyl (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)morpholine-4-carboxylate (1.650 g, 5.62 mmol) in methanol (10 mL). HCl in methanol (14.06 mL, 56.2 mmol) was added dropwise at RT and the reaction mixture was stirred at RT for 2 h, then the solvent was evaporated under reduced pressure to give (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)morpholine hydrochloride (1.28 g, 5.57 mmol, 99% yield) as a colourless oil. The salt was then stirred in methanol, and MP carbonate was added. The mixture was left to stir at RT for 30 min, then was filtered and concentrated to yield the freebase (S)-2-(1-cyclopropyl-1H-pyrazol-4-yl)morpholine.

BIOLOGICAL EVALUATION

(1026) Provided in this section is the biological evaluation of the specific examples provided herein. See Examples A1-A4, Tables 19-22, and FIGS. 1-3.

Example A1

In Vitro Measurement of Triggering Receptor Expressed on Myeloid Cells 2 Activity Using Cellular Phosphorylation of Spleen Tyrosine Kinase (“Syk”) Assays Used for Examples 1-305

(1027) Pharmacological measurements of TREM2 signaling through DAP12 were made with TREM2 and DAP12 overexpressing HEK293 cells stable cell lines that had been single-cell cloned (“TREM2/DAP12-HEK”). The readout of the TREM2 signaling utilized Perkin Elmer AlphaScreen/AlphaLISA technology monitoring the phosphorylation levels of the Syk kinase. TREM2/DAP12-HEK cell lines were cultured in DMEM-F12 (Corning 10-092-CM) supplemented with 1× Penicillin/Streptomycin (Corning 30-002-CI), 1× GlutaMAX (Gibco 35050-061), and 10% Fetal Bovine Serum (Life Technologies 10099) referred to as “HEK Culture Medium”. Suspensions of TREM2/DAP12-HEK cells were prepared in HEK Culture Medium and dispensed into 384-well poly-D-lysine coated microplates (Corning 354661) at a density of 20,000 cells/well using a Multidrop Combi peristaltic microplate dispenser (Thermo), 25 μL volume of cell suspension/well. Plates containing cells were then incubated for 20 hours in a humidified cell culture incubator at 37° C. with 5% CO.sub.2 (Thermo). After incubation, culture medium was removed from all wells of each microplate and replaced with 20 μL of “Assay Buffer” comprised of DMEM-F12 (Corning 10-092-CM) supplemented with 1× Penicillin/Streptomycin (Corning 30-002-CI) and 0.1% Pluronic F-68 Polyol (MP Biomedical 092750049) using a Bravo 384-well pipette-based liquid handling system (Agilent). Assay Buffer contained diluted test articles (in 1% final DMSO concentration for compounds) or 100 nM anti-human/mouse TREM2 antibody (R&D Systems MAB17291) as a positive control, or 100 nM or rat IgG2B isotype Ab as a negative control (R&D Systems MAB0061). The plates were incubated with test articles and controls for 45 minutes at room temperature and then the medium was aspirated/removed from each well of the plates. A Multidrop Combi peristaltic liquid handler (Thermo) was used to dispense 15 μL/well of “Cell Lysis Immunoassay Buffer”. The Cell Lysis Immunoassay Buffer contained M-PER Mammalian Protein Extraction Reagent (Pierce/ThermoFisher 78505), 1× Halt Phosphatase Inhibitor Cocktail (ThermoFisher #78427), 0.1875 nM anti-phospho-Syk (Tyr525/526) (C87C1) rabbit mAb (Cell Signaling Technologies catalog #2710), and 1.5 nM biotinylated Mouse anti-human Syk (4D10) antibody (BD Biosciences, catalog #624008). Plates were incubated for 1 hour at room temperature after the addition of the Cell Lysis Immunoassay Buffer. The Multidrop Combi liquid handler was used to dispense 15 μL of AlphaScreen Acceptor Bead Solution containing 7.5 μg/mL anti-rabbit IgG (Fc specific) AlphaLISA Acceptor Beads (Perkin Elmer AL104R) in 1× Immunoassay buffer (Perkin Elmer AL000F) to each well of the microplates. The plates were incubated for 2 hours at room temperature. Following the incubation with the AlphaLISA Acceptor Bead Solution, a Multidrop Combi liquid handler (Thermo) was used to dispense 15 μL of AlphaScreen Donor Bead Solution containing 30 μg/mL of AlphaScreen Streptavidin Donor beads (Perkin Elmer 6760002B) in 1× Immunoassay buffer (Perkin Elmer AL000F) to each well of the microplates. Microplates were incubated for 2 hours protected from light sources as the AlphaScreen reagents are light sensitive. Once the final incubation was completed, an AlphaScreen signal was acquired from the donor and acceptor beads using an Envision high throughput multi-modal microplate reader (Perkin Elmer) calibrated to the plate type with the AlphaScreen mirror and filter-set in 384-well mode, 680 nanometer excitation wavelength. The total measurement time per well was 550 milliseconds with a 180 millisecond excitation time.

(1028) After reading the AlphaScreen signal for each well of the microplates, on a plate-by-plate basis, each raw test article well value (x) was normalized to a Percent of Control (“POC”) value using the following formula; POC=((x−μ.sub.n)/(μ.sub.p−μ.sub.n))*100 where (μ.sub.n) is the mean negative control well signal for the given plate and (μ.sub.p) is the mean positive control TREM2 antibody signal for the given plate. Each plate contained 12 of each type of control wells that were used to generate the mean values. For concentration response curve analysis with test articles tested at various concentrations, the % of activation values were analyzed with 4 Parameter Logistic or Sigmoidal Dose-Response Models using GeneData Screener (GeneData, AG) or GraphPad Prism 7 (Graphpad Software, Inc.). The potency of the test item was expressed as EC50 corresponding to the test item concentration able to activate the phospho-Syk AlphaScreen signal to 50% of the maximal response.

(1029) For pharmacological assessment of TREM2 signaling in cellular systems natively expressing TREM2, human monocyte-derived macrophages were utilized. CD14.sup.+ monocytes positively selected from large-scale apheresis on healthy human donors (Lonza) were differentiated into macrophages in low-attachment bioprocess bags (Saint-Gobain Performance Plastics) for 9 days in RPMI-1640 medium (Gibco 11875093) supplemented with 10% Fetal Bovine Serum (Gibco 10082139), 10 mM HEPES (Gibco 15630080), 1× Penicillin-Streptomycin (Gibco 15140122), 1× Non-essential amino acids (Gibco 11140050), 1 mM Sodium Pyruvate (Gibco 11360070), 1× GlutaMAX (Gibco 35050-061), and 50 ng/mL M-CSF (Promocell C-60442A). After differentiation, macrophages were harvested and cryopreserved in BamBanker (Wako/GC LYMPHOTEC 302-14681/CS-02-001) in addition to undergoing quality control for expression of cell surface markers including TREM2 using flow cytometry. Batches utilized for phospho-Syk assays were approximately 80-90% TREM2.sup.+ by flow cytometry.

(1030) After cryorecovering macrophages, live cell suspensions of 100,000 cells/mL in “Macrophage pSyk Assay Medium” were prepared, composed of RPMI-1640 with GlutaMAX medium (Gibco 61870036) supplemented with 10% Fetal Bovine Serum (Gibco 10082139), 10 mM HEPES (Gibco 15630080), 1× Penicillin-Streptomycin (Gibco 15140122), 1× Non-essential amino acids (Gibco 11140050), 1 mM Sodium Pyruvate (Gibco 11360070), and 10 ng/mL M-CSF (Promocell C-60442A). A Multidrop Combi peristatic liquid handling instrument (Thermo) was used to dispense 50 μL/well of cell suspension (5,000 cells/well) into poly-d-lysine coated 384-well plates (Corning 354661). After a 30 minute incubation at room temperature, plates were incubated in a humidified cell culture incubator at 37° C. with 5% CO.sub.2 (Thermo) for 16 hours. To initiate the assay with test articles, medium in each well of the assay plates was aspirated and replaced with 20 μL Assay Buffer containing diluted test articles (in 1% final DMSO concentration for compounds) or Assay Buffer containing 1% DMSO for as a negative control. The remainder of the macrophage AlphaScreen phospho-Syk assay followed the procedure detailed above for the HEK cell lines.

(1031) After reading the AlphaScreen signal for each well of the microplates containing macrophages, on a plate-by-plate basis, each raw test article well value (x) was background subtracted from the mean negative control well signal for the given plate. Each plate contained 12-24 negative control wells that were used to generate the mean value for background subtraction. For concentration response curve analysis with the test articles tested at various concentrations, the values were analyzed with a 4 Parameter Logistic curve fit using GraphPad Prism 7 (Graphpad Software, Inc.). The potency of each test item was expressed as EC50 corresponding to the test item concentration able to activate the background subtracted phospho-Syk AlphaScreen signal to 50% of the maximal response.

(1032) The results presented in Table 19 have been generated with the in vitro assay described above for Examples 1-305. This assay may be used to test any of the compounds described herein to assess and characterize a compound's ability to act as an agonist of TREM2.

(1033) Compounds designated as “A” demonstrated an EC50 of ≤0.05 μM. Compounds designated as “B” demonstrated an EC50>0.05 μM and ≤0.5 μM. Compounds designated as “C” demonstrated an EC50>0.5 μM and ≤3.0 μM. Compounds designated as “D” demonstrated an EC50>3.0 μM and ≤100 μM. Compounds designated as “−” had not been tested as of the filing of the present application, but can be tested using the methods described herein.

(1034) Compounds designated as “++++” demonstrated an Emax>250. Compounds designated as “+++” demonstrated an Emax>150 and ≤250. Compounds designated as “++” demonstrated an Emax>100 and ≤150. Compounds designated as “+” demonstrated an Emax>45 and ≤100. Compounds designated as “−” had not been tested as of the filing of the present application, but can be tested using the methods described herein.

(1035) TABLE-US-00027 TABLE 19 hTREM2 EC50 Data (HEK293 Cells) for Examples 1-305 provided herein. Ex # hTREM2 EC50 μM hTREM2 Emax   1 A ++++   2 A +++   3 A +++   4 B +++   5 C +++   6 B +++   7 A +++   8 A ++   9 A +++  10 A +++  11 B ++  12 C ++  13 A +  14 B ++  15 B ++  16 A +  17 A ++++  18 A +++  19 A +++  20 C +++  21 A ++++  22 A ++++  23 A ++++  24 B ++++  25 A ++++  26 A ++++  27 C ++  28 C +++  29 D −  30 C ++  31 A +++  32 A +++  33 A ++++  34 C +++  35 B +++  36 B +++  37 A +++  38 A +++  39 A +++  40 B +  41 B +  42 A ++  43 B +++  44 B +++  45 B ++  46 A +++  47 A +  48 A ++  49 A ++  50 A +++  51 A +++  52 B +++  53 A ++  54 A ++  55 A +++  56 A ++  57 C ++  58 B +++  59 B +++  60 A +++  61 A +++  62 A ++++  63 A +++  64 A +++  65 A +++  66 C ++  67 B +  68 D −  69 C +  70 C +  71 D ++  72 C +  73 B ++++  74 B ++++  75 B ++++  76 B ++++  77 A +++  78 B +++  79 A ++++  80 B ++  81 B ++  82 B +++  83 C ++++  84 A +++  85 A +++  86 A ++++  87 B ++++  88 A ++++  89 C +++  90 B +++  91 B +++  92 A +++  93 A +++  94 B +++  95 A +++  96 A ++++  97 C +  98 B ++  99 A + 100 B ++ 101 D − 102 A + 103 A ++++ 104 A +++ 105 A ++++ 106 B +++ 107 A +++ 108 B + 109 D − 110 C + 111 C + 112 A +++ 113 A ++ 114 A +++ 115 A ++ 116 A +++ 117 D − 118 C + 119 B ++ 120 B ++++ 121 B ++++ 122 C +++ 123 A +++ 124 A ++++ 125 B +++ 126 B + 127 A ++ 128 C + 129 B ++++ 130 A + 131 B +++ 132 A ++ 133 A +++ 134 B + 135 B + 136 A +++ 137 A +++ 138 A +++ 139 A +++ 140 B ++ 141 B ++ 142 D ++ 143 B +++ 144 B ++ 145 A + 146 C ++ 147 D ++++ 148 B +++ 149 B ++++ 150 B ++++ 151 B ++++ 152 A ++++ 153 B +++ 154 B ++++ 155 C ++ 156 B +++ 157 A ++++ 158 B +++ 159 B +++ 160 A ++++ 161 A +++ 162 A ++++ 163 A ++++ 164 A ++++ 165 A +++ 166 A ++++ 167 B ++++ 168 A ++++ 169 A +++ 170 A ++++ 171 A +++ 172 B ++++ 173 A +++ 174 B +++ 175 C ++ 176 A +++ 177 C +++ 178 A ++++ 179 C ++++ 180 B +++ 181 A +++ 182 A +++ 183 A ++++ 184 C +++ 185 B +++ 186 C +++ 187 A +++ 188 A +++ 189 C +++ 190 A +++ 191 B ++++ 192 A ++++ 193 B ++++ 194 C ++++ 195 A ++++ 196 A +++ 197 A ++++ 198 B +++ 199 A ++++ 200 C +++ 201 A +++ 202 C ++ 203 A +++ 204 C ++++ 205 B +++ 206 B ++++ 207 A +++ 208 A +++ 209 B +++ 210 B ++++ 211 A ++++ 212 C ++++ 213 B +++ 214 B ++++ 215 A +++ 216 A +++ 217 B +++ 218 A +++ 219 B ++++ 220 B +++ 221 C +++ 222 A ++++ 223 B ++++ 224 A +++ 225 B +++ 226 B +++ 227 A +++ 228 A +++ 229 A +++ 230 B ++++ 231 A +++ 232 A ++ 233 D +++ 234 C +++ 235 D + 236 D +++ 237 D +++ 238 D + 239 D +++ 240 D ++++ 241 A +++ 242 A +++ 243 B ++++ 244 C +++ 245 D ++++ 246 D +++ 247 B +++ 248 C +++ 249 C +++ 250 C +++ 251 C +++ 252 A +++ 253 D +++ 254 B +++ 255 C ++ 256 C ++ 257 C ++ 258 C +++ 259 A ++++ 260 C +++ 261 C +++ 262 D − 263 C +++ 264 C ++++ 265 C +++ 266 C ++++ 267 C ++ 268 C ++++ 269 D + 270 C +++ 271 D +++ 272 A ++++ 273 A +++ 274 D ++ 275 D + 276 B ++++ 277 B +++ 278 C +++ 279 C +++ 280 C +++ 281 C +++ 282 C ++ 283 C ++ 284 B + 285 B ++++ 286 A +++ 287 C +++ 288 A ++ 289 D ++ 290 B +++ 291 B ++++ 292 C +++ 293 − +++ 294 C +++ 295 A +++ 296 D − 297 D − 298 A +++ 299 A +++ 300 B +++ 301 A +++ 302 B + 303 B ++ 304 C +++ 305 B +++

Example A2

In Vitro Measurement of Triggering Receptor Expressed on Myeloid Cells 2 Activity Using Cellular Phosphorylation of Spleen Tyrosine Kinase (“Syk”) Assays Used for Examples 306-429

(1036) Measurement of TREM2 agonist potency was done using a HEK cell line expressing human TREM2 and DAP12 (HEK293T-hTREM2 cells). Binding of small molecules to, and activation of, TREM2 increases the phosphorylation of Syk. The resultant levels of Syk phosphorylation were measured using a commercial AlphaLisa reagent kit. To perform the assay, HEK-hTREM2 cells were plated at 14,000 cells per well in a 384 well plate, in 25 μL of complete growth media and incubated at 37° C., 5% CO.sub.2 for 20-24 hours. Prior to the assay, test compounds were diluted in the 384 well plates in assay buffer and allowed to equilibrate for 30 minutes. Growth media was removed from cell plates by inversion on blotting paper, and 25 μL of test compounds in assay buffer was added to cells. Cells were incubated for 45 minutes at room temperature. After 45 minutes, assay buffer was removed and 10 μL of lysis buffer was added. Plates were shaken for 20 minutes at 350 RPM at room temperature. After complete lysis, AlphaLisa reagents were added to the lysate, and fluourescence intensity was measured using a Perkin Elmer Envision plate reader. Intensities were used to generate a standard curve, and % activation was calculated. Curve fitting was performed using Prism v9 software, log(agonist) vs response—variable slope (four parameters), and EC50s were calculated from the curve fit.

(1037) The results presented in Table 20 have been generated with the in vitro assay described above for Examples 306-429. This assay may be used to test any of the compounds described herein to assess and characterize a compound's ability to act as an agonist of TREM2.

(1038) Compounds designated as “A” demonstrated an EC50 of ≤0.05 μM. Compounds designated as “B” demonstrated an EC50>0.05 μM and ≤0.5 μM. Compounds designated as “C” demonstrated an EC50>0.5 μM and ≤3.0 μM. Compounds designated as “D” demonstrated an EC50>3.0 μM and ≤100 μM. Compounds designated as “−” had not been tested as of the filing of the present application, but can be tested using the methods described herein.

(1039) TABLE-US-00028 TABLE 20 hTREM2 EC50 Data (HEK293 Cells) for Examples 306-429 provided herein. Ex # hTREM2 EC50 μM 306 B 307 B 308 B 309 B 310 B 311 B 312 A 313 A 314 A 315 A 316 B 317 A 318 A 319 A 320 − 321 B 322 A 323 A 324 B 325 A 326 A 327 A 328 A 329 − 330 A 331 C 332 A 333 C 334 A 335 A 336 B 337 A 338 C 339 B 340 B 341 A 342 A 343 B 344 A 345 − 346 A 347 A 348 A 349 A 350 C 351 − 352 A 353 B 354 A 355 B 356 A 357 A 358 A 359 A 360 A 361 B 362 A 363 A 364 A 365 B 366 A 367 B 368 B 369 A 370 B 371 A 372 A 373 A 374 A 375 A 376 C 377 B 378 B 379 B 380 A 381 A 382 A 383 B 384 A 385 B 386 A 387 A 388 B 389 A 390 − 391 A 392 A 393 B 394 A 395 A 396 B 397 A 398 A 399 A 400 A 401 A 402 A 403 B 404 A 405 B 406 C 407 A 408 A 409 B 410 A 411 A 412 B 413 A 414 A 415 B 416 B 417 B 418 − 419 B 420 A 421 C 422 A 423 B 424 A 425 A 426 A 427 A 428 B 429 C

Example A3

IP-10 EXPRESSION IN THE BRAIN AND PLASMA OF MICE AFTER ADMINISTRATION OF EXAMPLE 192 AND A TREM2 AGONIST ANTIBODY

(1040) To test TREM2 target engagement in an acute dosing paradigm using the compound of Example 192 (5-(4-chloro-2-fluorophenyl)-2,3-dimethyl-7-((2R,4S)-2-(1-methyl-1H-pyrazol-4-yl)tetrahydro-2H-pyran-4-yl)pyrido[3,4-b]pyrazine), hTREM2-CV knock-in transgenic mice were dosed using oral gavage (PO) twice a day (0 and 10 h) followed by sample collection at 24 hours. 6 animals received the compound of Example 192 at 50 mg/kg, and 6 animals received vehicle only (2% Hydroxypropyl Methylcellulose, 1% Tween-80 in PBS). In the same experiment, an anti-hTREM2 Antibody Ab-1 was dosed intraperitoneally (IP) at 100 mg/kg (control was a non-binding matched IgG isotype control). Ab-1 is a murinized version of a human TREM2 agonist antibody, first described as an engineered variant of antibody 13E7 in PCT Application Publication WO2018/195506A1. Ab-1 has an HC according to SEQ ID NO:9, an LC according to SEQ ID NO; 10, and exemplifies an anti-TREM2 antibody having the CDRs according to SEQ ID NOS; 1-6. Twenty-four hours following the zero-hour dose, mice were humanely euthanized for blood collection prior to cardiac perfusion with PBS and brain harvest. Brains were micro dissected into right and left regions of interest (including the cortex and hippocampus) for independent processing of cytokine and mRNA expression profiles. Whole blood was collected into EDTA-containing vials to prevent coagulation, and centrifuged to isolate the plasma fraction before storage at −80° C. Right and left hemisphere cortices were flash frozen in liquid nitrogen and stored at −80° C. before lysis and homogenization.

(1041) Plasma and brain lysates were analyzed for IP-10 (CXCL10) and CCL2 (MCP1) expression using a Meso Scale Discovery (MSD) multi-array reader and V-PLEX kits per manufacturer's protocols. Both IP-10 and CCL2 are chemotactic cytokines involved in the regulation of monocyte infiltration, and both appear to be upregulated in response to TREM2 engagement in microglia.

(1042) Both the compound of Example 192 and Ab-1 induced upregulation of IP-10 and CCL2 in cortical lysates compared to vehicle-treated animals (FIGS. 1 and 2). The upregulation of IP-10 was more robust, and so IP-10 levels were analyzed in plasma from the same experiment. This analysis of peripheral IP-10 levels in the plasma fraction showed no apparent cytokine upregulation, indicating a brain compartment-specific effect of the compound of Example 192. These results indicate that CNS TREM2 is responsible for increased IP-10 (FIG. 3), ruling out a peripheral IP-10 increase and transfer to the brain. These results demonstrate TREM2 brain target engagement using the compound of Example 192 in vivo.

Example A4

Nanostring Analysis of Gene Expression Profiles after Administration of Example 192 and a TREM2 Agonist Antibody in a Mouse Model

(1043) To assess the impact of TREM2 agonism on cellular processes and pathways, the right hemisphere hippocampi from the acute dosing of the compound of Example 192 and Ab-1, as described in Example A3, were analyzed for gene expression changes. Cells from frozen hippocampi were lysed, and RNA was isolated. Key gene expression profiles were analyzed using the nCounter Murine Neuroinflammation panel of 770 genes related to inflammation in the CNS. Results of individual gene expression changes relative to the mean of several housekeeper genes were grouped in pathways of interest and assigned a relative score using the nSolver analysis software.

(1044) Nanostring nSolver software includes a module for Cell Type Profiling that identifies genes linked to cell type in an experiment. Analysis using this module revealed an increase in microglia score (microglial-associated genes) with treatment with the compound of Example 192 and Ab-1, but no change in neuron or astrocyte scores, indicating microglial-specific effects of TREM2 agonism by both treatments, as expected with TREM2 activation. Table 21 reports the Cell Type Profiling scores for microglia, neuron and astrocyte genes, showing that microglia genes were upregulated by treatment with the compound of Example 192 and Ab-1. Pathway analysis was also performed. Genes associated with the adaptive immune response, innate immune response, microglia function, cytokine signalling, and cell cycle were all increased in hippocampi from animals treated with the compound of Example 192 and Ab-1. Table 22 reports the effects of the compound of Example 192 and Ab-1 on these genes, where the values reflect PC1 scores from principal component analysis of the gene set. These results support the finding of TREM2 target engagement on microglia using the compound of Example 192 and Ab-1.

(1045) TABLE-US-00029 TABLE 21 Cell Type Profiling Scores after treatment Treatment Group Gene Type Vehicle Ex 192 Ab-1 Microglia Score 6.59 (0.108) 6.82 (0.090) * 7.01 (0.097) * Neuron Score 8.82 (0.108) 8.81 (0.185)   8.76 (0.063)   Astrocyte Score 8.82 (0.044) 8.86 (0.077)   8.78 (0.044)   Data shown is mean score (standard deviation). * = p < 0.005 by Student′s T-test, two-tailed.

(1046) TABLE-US-00030 TABLE 22 Cell Type Profiling Scores after treatment Treatment Group Pathway Score Vehicle Ex 192 Ab-1 Adaptive Immune −1.01 (0.594)  0.639 (0.929) * 1.66 (0.400) * Response Innate Immune −0.984 (0.585) 0.490 (0.674) * 1.77 (0.418) * Response Microglia Function −1.04 (0.827)  0.345 (0.908) * 2.07 (0.424) * Cytokine Signaling −0.821 (0.564) 0.180 (0.514) * 1.75 (0.320) * Cell Cycle −0.789 (0.351) 0.398 (0.414) * 1.41 (0.462) * Data shown is mean score (standard deviation). * = p < 0.005 by Student′s T-test, two-tailed.

REFERENCES

(1047) Bianchin, M. M., H. M. Capella, D. L. Chaves, M. Steindel, E. C. Grisard, G. G. Ganev, J. P. da Silva Junior, S. Neto Evaldo, M. A. Poffo, R. Walz, C. G. Carlotti Junior and A. C. Sakamoto (2004). “Nasu-Hakola disease (polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy—PLOSL); a dementia associated with bone cystic lesions. From clinical to genetic and molecular aspects.” Cell Mol Neurobiol 24(1); 1-24. Bianchin, M. M., K. C. Martin, A. C. de Souza, M. A. de Oliveira and C. R. Rieder (2010). “Nasu-Hakola disease and primary microglial dysfunction.” Nat Rev Neurol 6(9); 2 p following 523. Cantoni, C., B. Bollman, D. Licastro, M. Xie, R. Mikesell, R. Schmidt, C. M. Yuede, D. Galimberti, G. Olivecrona, R. S. Klein, A. H. Cross, K. Otero and L. Piccio (2015). “TREM2 regulates microglial cell activation in response to demyelination in vivo.” Acta Neuropathol 129(3); 429-447. Colonna, M. and O. Butovsky (2017). “Microglia Function in the Central Nervous System During Health and Neurodegeneration.” Annu Rev Immunol 35; 441-468. Cserep, C., B. Posfai, N. Lenart, R. Fekete, Z. I. Laszlo, Z. Lele, B. Orsolits, G. Molnar, S. Heindl, A. D. Schwarcz, K. Ujvari, Z. Komyei, K. Toth, E. Szabadits, B. Sperlagh, M. Baranyi, L. Csiba, T. Hortobagyi, Z. Magloczky, B. Martinecz, G. Szabo, F. Erdelyi, R. Szipocs, M. M. Tamkun, B. Gesierich, M. Duering, I. Katona, A. Liesz, G. Tamas and A. Denes (2019). “Microglia monitor and protect neuronal function via specialized somatic purinergic junctions.” Science 10.1126/science.aax6752; pp. 1-18. Dardiotis, E., V. Siokas, E. Pantazi, M. Dardioti, D. Rikos, G. Xiromerisiou, A. Markou, D. Papadimitriou, M. Speletas and G. M. Hadjigeorgiou (2017). “A novel mutation in TREM2 gene causing Nasu-Hakola disease and review of the literature.” Neurobiol Aging 53; 194.e13-194.e22. Deming, Y., F. Filipello, F. Cignarella, C. Cantoni, S. Hsu, R. Mikesell, Z. Li, J. L. Del-Aguila, U. Dube, F. G. Farias, J. Bradley, J. Budde, L. Ibanez, M. V. Fernandez, K. Blennow, H. Zetterberg, A. Heslegrave, P. M. Johansson, J. Svensson, B. Nellgard, A. Lleo, D. Alcolea, J. Clarimon, L. Rami, J. L. Molinuevo, M. Suarez-Calvet, E. Morenas-Rodriguez, G. Kleinberger, M. Ewers, O. Harari, C. Haass, T. J. Brett, B. A. Benitez, C. M. Karch, L. Piccio and C. Cruchaga (2019). “The MS4A gene cluster is a key modulator of soluble TREM2 and Alzheimer's disease risk.” Sci Transl Med 11(505) eaau2291; pp. 1-19. Doens, D. and P. L. Fernandez (2014). “Microglia receptors and their implications in the response to amyloid beta for Alzheimer's disease pathogenesis.” J Neuroinflammation 11; 48 (pp. 1-14). Domingues, H. S., C. C. Portugal, R. Socodato and J. B. Relvas (2016). “Oligodendrocyte, Astrocyte, and Microglia Crosstalk in Myelin Development, Damage, and Repair.” Front Cell Dev Biol 4; 71 (pp. 1-16). Ewers, M., N. Franzmeier, M. Suarez-Calvet, E. Morenas-Rodriguez, M. A. A. Caballero, G. Kleinberger, L. Piccio, C. Cruchaga, Y. Deming, M. Dichgans, J. Q. Trojanowski, L. M. Shaw, M. W. Weiner, C. Haass and I. Alzheimer's Disease Neuroimaging (2019). “Increased soluble TREM2 in cerebrospinal fluid is associated with reduced cognitive and clinical decline in Alzheimer's disease.” Sci Transl Med 11(507); eaav6221 (pp. 1-13). Golde, T. E., W. J. Streit and P. Chakrabarty (2013). “Alzheimer's disease risk alleles in TREM2 illuminate innate immunity in Alzheimer's disease.” Alzheimers Res Ther 5(3); 24 (pp. 1-6). Guerreiro, R., A. Wojtas, J. Bras, M. Carrasquillo, E. Rogaeva, E. Majounie, C. Cruchaga, C. Sassi, J. S. Kauwe, S. Younkin, L. Hazrati, J. Collinge, J. Pocock, T. Lashley, J. Williams, J. C. Lambert, P. Amouyel, A. Goate, R. Rademakers, K. Morgan, J. Powell, P. St George-Hyslop, A. Singleton and J. Hardy (2013). “TREM2 variants in Alzheimer's disease.” N Engl J Med 10(368); 117-127. Guerreiro R., E. Lohmann, J. M. Bris, J. R. Gibbs, J. D. Rohrer, N. Gurunlian, B. Dursun, B. Bilgic, H. Hanagasi, H. Gurvit, M. Emre, A. Singleton and J. Hardy (2013). “Using exome sequencing to reveal mutations in TREM2 presenting as a frontotemporal dementia-like syndrome without bone involvement.” JAMA Neurol 70(1); 78-84. Guo, Y., X. Wei, H. Yan, Y. Qin, S. Yan, J. Liu, Y. Zhao, F. Jiang, H. Lou (2019). “TREM2 deficiency aggravates α-synuclein-induced neurodegeneration and neuroinflammation in Parkinson's disease models.” FASEB J 33(11); 12164-12174. Hickman, S., S. Izzy, P. Sen, L. Morsett and J. El Khoury (2018). “Microglia in neurodegeneration.” Nat Neurosci 21(10); 1359-1369. Hickman, S. E. and J. El Khoury (2019). “Analysis of the Microglial Sensome.” Methods Mol Biol 2034; 305-323. Hickman, S. E., N. D. Kingery, T. K. Ohsumi, M. L. Borowsky, L. C. Wang, T. K. Means and J. El Khoury (2013). “The microglial sensome revealed by direct RNA sequencing.” Nat Neurosci 16(12); 1896-1905. Hollingworth, P., D. Harold, R. Sims, A. Gerrish, J. C. Lambert, M. M. Carrasquillo, R. Abraham, M. L. Hamshere, J. S. Pahwa, V. Moskvina, K. Dowzell, N. Jones, A. Stretton, C. Thomas, A. Richards, D. Ivanov, C. Widdowson, J. Chapman, S. Lovestone, J. Powell, P. Proitsi, M. K. Lupton, C. Brayne, D. C. Rubinsztein, M. Gill, B. Lawlor, A. Lynch, K. S. Brown, P. A. Passmore, D. Craig, B. McGuinness, S. Todd, C. Holmes, D. Mann, A. D. Smith, H. Beaumont, D. Warden, G. Wilcock, S. Love, P. G. Kehoe, N. M. Hooper, E. R. Vardy, J. Hardy, S. Mead, N. C. Fox, M. Rossor, J. Collinge, W. Maier, F. Jessen, E. Ruther, B. Schurmann, R. Heun, H. Kolsch, H. van den Bussche, I. Heuser, J. Kornhuber, J. Wiltfang, M. Dichgans, L. Frolich, H. Hampel, J. Gallacher, M. Hull, D. Rujescu, I. Giegling, A. M. Goate, J. S. Kauwe, C. Cruchaga, P. Nowotny, J. C. Morris, K. Mayo, K. Sleegers, K. Bettens, S. Engelborghs, P. P. De Deyn, C. Van Broeckhoven, G. Livingston, N. J. Bass, H. Gurling, A. McQuillin, R. Gwilliam, P. Deloukas, A. Al-Chalabi, C. E. Shaw, M. Tsolaki, A. B. Singleton, R. Guerreiro, T. W. Muhleisen, M. M. Nothen, S. Moebus, K. H. Jockel, N. Klopp, H. E. Wichmann, V. S. Pankratz, S. B. Sando, J. O. Aasly, M. Barcikowska, Z. K. Wszolek, D. W. Dickson, N. R. Graff-Radford, R. C. Petersen, I. Alzheimer's Disease Neuroimaging, C. M. van Duijn, M. M. Breteler, M. A. Ikram, A. L. DeStefano, A. L. Fitzpatrick, O. Lopez, L. J. Launer, S. Seshadri, C. consortium, C. Berr, D. Campion, J. Epelbaum, J. F. Dartigues, C. Tzourio, A. Alperovitch, M. Lathrop, E. consortium, T. M. Feulner, P. Friedrich, C. Riehle, M. Krawczak, S. Schreiber, M. Mayhaus, S. Nicolhaus, S. Wagenpfeil, S. Steinberg, H. Stefansson, K. Stefansson, J. Snaedal, S. Bjornsson, P. V. Jonsson, V. Chouraki, B. Genier-Boley, M. Hiltunen, H. Soininen, O. Combarros, D. Zelenika, M. Delepine, M. J. Bullido, F. Pasquier, I. Mateo, A. Frank-Garcia, E. Porcellini, O. Hanon, E. Coto, V. Alvarez, P. Bosco, G. Siciliano, M. Mancuso, F. Panza, V. Solfrizzi, B. Nacmias, S. Sorbi, P. Bossu, P. Piccardi, B. Arosio, G. Annoni, D. Seripa, A. Pilotto, E. Scarpini, D. Galimberti, A. Brice, D. Hannequin, F. Licastro, L. Jones, P. A. Holmans, T. Jonsson, M. Riemenschneider, K. Morgan, S. G. Younkin, M. J. Owen, M. O'Donovan, P. Amouyel and J. Williams (2011). “Common variants at ABCA7, MS4A6A/MS4A4E, EPHA1, CD33 and CD2AP are associated with Alzheimer's disease.” Nat Genet 43(5); 429-435. Hong, S., L. Dissing-Olesen and B. Stevens (2016). “New insights on the role of microglia in synaptic pruning in health and disease.” Curr Opin Neurobiol 36; 128-134. Huang, Q. Q. and R. M. Pope (2009). “The role of toll-like receptors in rheumatoid arthritis.” Curr Rheumatol Rep 11(5); 357-364. Ikegami, A., K. Haruwaka and H. Wake (2019). “Microglia; Lifelong modulator of neural circuits.” Neuropathology 39(3); 173-180. Jaitin, D. A., L. Adlung, C. A. Thaiss, A. Weiner, B. Li, H. Descamps, P. Lundgren, C. Bleriot, Z. Liu, A. Deczkowska, H. Keren-Shaul, E. David, N. Zmora, S. M. Eldar, N. Lubezky, O. Shibolet, D. A. Hill, M. A. Lazar, M. Colonna, F. Ginhoux, H. Shapiro, E. Elinav and I. Amit (2019). “Lipid-Associated Macrophages Control Metabolic Homeostasis in a Trem2-Dependent Manner.” Cell 178(3); 686-698.e14. Jay, T. R., V. E. von Saucken and G. E. Landreth (2017). “TREM2 in Neurodegenerative Diseases.” Mol Neurodegener 12(1); 56 (pp. 1-33). Jay, T. R., C. M. Miller, P. J. Cheng, L. C. Graham, S. Bemiller, M. L. Broihier, G. Xu, D. Margevicius, J. C. Karlo, G. L. Sousa, A. C. Cotleur, O. Butovsky, L. Bekris, S. M. Staugaitis, J. B. Leverenz, S. W. Pimplikar, G. E. Landreth, G. R. Howell, R. M. Ransohoff, B. T. Lamb (2015). “TREM2 deficiency eliminates TREM2.sup.+ inflammatory macrophages and ameliorates pathology in Alzheimer's disease mouse models.” J Exp Med 212(3); 287-295. Jonsson, T., H. Stefansson, S. Steinberg, I. Jonsdottir, P. V. Jonsson, J. Snaedal, S. Bjornsson, J. Huttenlocher, A. I. Levey, J. J. Lah, D. Rujescu, H. Hampel, I. Giegling, O. A. Andreassen, K. Engedal, I. Ulstein, S. Djurovic, C. Ibrahim-Verbaas, A. Hofman, M. A. Ikram, C. M. van Duijn, U. Thorsteinsdottir, A. Kong and K. Stefansson (2013). “Variant of TREM2 associated with the risk of Alzheimer's disease.” N Engl J Med 368(2); 107-116. Kang, S. S., A. Kurti, K. E. Baker, C. C. Liu, M. Colonna, J. D. Ulrich, D. M. Holtzman, G. Bu and J. D. Fryer (2018). “Behavioral and transcriptomic analysis of Trem2-null mice; not all knockout mice are created equal.” Hum Mol Genet 27(2); 211-223. Keren-Shaul, H., A. Spinrad, A. Weiner, O. Matcovitch-Natan, R. Dvir-Szternfeld, T. K. Ulland, E. David, K. Baruch, D. Lara-Astaiso, B. Toth, S. Itzkovitz, M. Colonna, M. Schwartz and I. Amit (2017). “A Unique Microglia Type Associated with Restricting Development of Alzheimer's Disease.” Cell 169(7); 1276-1290.e17. Kleinberger, G., Y. Yamanishi, M. Suarez-Calvet, E. Czirr, E. Lohmann, E. Cuyvers, H. Struyfs, N. Pettkus, A. Wenninger-Weinzierl, F. Mazaheri, S. Tahirovic, A. Lleo, D. Alcolea, J. Fortea, M. Willem, S. Lammich, J. L. Molinuevo, R. Sanchez-Valle, A. Antonell, A. Ramirez, M. T. Heneka, K. Sleegers, J. van der Zee, J. J. Martin, S. Engelborghs, A. Demirtas-Tatlidede, H. Zetterberg, C. Van Broeckhoven, H. Gurvit, T. Wyss-Coray, J. Hardy, M. Colonna and C. Haass (2014). “TREM2 mutations implicated in neurodegeneration impair cell surface transport and phagocytosis.” Sci Transl Med 6(243); 243ra286 (pp. 1-13). Kobayashi, M., H. Konishi, A. Sayo, T. Takai and H. Kiyama (2016). “TREM2/DAP12 Signal Elicits Proinflammatory Response in Microglia and Exacerbates Neuropathic Pain.” J Neurosci 36(43); 11138-11150. Kober, D. L. and T. J. Brett (2017). “TREM2-Ligand Interactions in Health and Disease.” J Mol Biol 429(11); 1607-1629. Lee, C. Y. D., A. Daggett, X. Gu, L. L. Jiang, P. Langfelder, X. Li, N. Wang, Y. Zhao, C. S. Park, Y. Cooper, I. Ferando, I Mody, G. Coppola, H. Xu and X. W. Yang (2018). “Elevated TREM2 Gene Dosage Reprograms Microglia Responsivity and Ameliorates Pathological Phenotypes in Alzheimer's Disease Models.” Neuron 97(5); 1032-1048.e5. Leyns, C. E. G., M. Gratuze, S. Narasimhan, N. Jain, L. J. Koscal, H. Jiang, M. Manis, M. Colonna, V. M. Y. Lee, J. D. Ulrich and D. M. Holtzman (2019). “TREM2 function impedes tau seeding in neuritic plaques.” Nat Neurosci 22(8); 1217-1222. Li, Q. and B. A. Barres (2018). “Microglia and macrophages in brain homeostasis and disease.” Nat Rev Immunol 18(4); 225-242. Liddelow, S. A., K. A. Guttenplan, L. E. Clarke, F. C. Bennett, C. J. Bohlen, L. Schirmer, M. L. Bennett, A. E. Munch, W. S. Chung, T. C. Peterson, D. K. Wilton, A. Frouin, B. A. Napier, N. Panicker, M. Kumar, M. S. Buckwalter, D. H. Rowitch, V. L. Dawson, T. M. Dawson, B. Stevens and B. A. Barres (2017). “Neurotoxic reactive astrocytes are induced by activated microglia.” Nature 541(7638); 481-487. Madry, C. and D. Attwell (2015). “Receptors, ion channels, and signaling mechanisms underlying microglial dynamics.” J Biol Chem 290(20); 12443-12450. Madry, H., J. Prudlo, A. Grgic and J. Freyschmidt (2007). “Nasu-Hakola disease (PLOSL); report of five cases and review of the literature.” Clin Orthop Relat Res 454; 262-269. Otero, K., M. Shinohara, H. Zhao, M. Cella, S. Gilfillan, A. Colucci, R. Faccio, F. P. Ross, S. L. Teitelbaum, H. Takayanagi and M. Colonna (2012). “TREM2 and beta-catenin regulate bone homeostasis by controlling the rate of osteoclastogenesis.” J Immunol 188(6); 2612-2621. Paloneva, J., J. Mandelin, A. Kiialainen, T. Bohling, J. Prudlo, P. Hakola, M. Haltia, Y. T. Konttinen and L. Peltonen (2003). “DAP12/TREM2 deficiency results in impaired osteoclast differentiation and osteoporotic features.” J Exp Med 198(4); 669-675. Paolicelli, R. C., G. Bolasco, F. Pagani, L. Maggi, M. Scianni, P. Panzanelli, M. Giustetto, T. A. Ferreira, E. Guiducci, L. Dumas, D. Ragozzino and C. T. Gross (2011). “Synaptic pruning by microglia is necessary for normal brain development.” Science 333(6048); 1456-1458. Parhizkar, S., T. Arzberger, M. Brendel, G. Kleinberger, M. Deussing, C. Focke, B. Nuscher, M. Xiong, A. Ghasemigharagoz, N. Katzmarski, S. Krasemann, S. F. Lichtenthaler, S. A. Muller, A. Colombo, L. S. Monasor, S. Tahirovic, J. Herms, M. Willem, N. Pettkus, O. Butovsky, P. Bartenstein, D. Edbauer, A. Rominger, A. Erturk, S. A. Grathwohl, J. J. Neher, D. M. Holtzman, M. Meyer-Luehmann and C. Haass (2019). “Loss of TREM2 function increases amyloid seeding but reduces plaque-associated ApoE.” Nat Neurosci 22(2); 191-204. Peng, Q., S. Malhotra, J. A. Torchia, W. G. Kerr, K. M. Coggeshall and M. B. Humphrey (2010). “TREM2- and DAP12-dependent activation of PI3K requires DAP10 and is inhibited by SHIP1.” Sci Signal 3(122); ra38 (pp. 1-18). Sellgren, C. M., J. Gracias, B. Watmuff, J. D. Biag, J. M. Thanos, P. B. Whittredge, T. Fu, K. Worringer, H. E. Brown, J. Wang, A. Kaykas, R. Karmacharya, C. P. Goold, S. D. Sheridan and R. H. Perlis (2019). “Increased synapse elimination by microglia in schizophrenia patient-derived models of synaptic pruning.” Nat Neurosci 22(3); 374-385. Shinozaki, Y., K. Shibata, K. Yoshida, E. Shigetomi, C. Gachet, K. Ikenaka, K. F. Tanaka and S. Koizumi (2017). “Transformation of Astrocytes to a Neuroprotective Phenotype by Microglia via P2Y1 Receptor Downregulation.” Cell Rep 19(6); 1151-1164. Shirotani, K., Y. Hori, R. Yoshizaki, E. Higuchi, M. Colonna, T. Saito, S. Hashimoto, T. Saito, T. C. Saido and N. Iwata (2019). “Aminophospholipids are signal-transducing TREM2 ligands on apoptotic cells.” Sci Rep 9(1); 7508 (pp. 1-9). Sims, R., S. J. van der Lee, A. C. Naj, C. Bellenguez, N. Badarinarayan, J. Jakobsdottir, B. W. Kunkle, A. Boland, R. Raybould, J. C. Bis, E. R. Martin, B. Grenier-Boley, S. Heilmann-Heimbach, V. Chouraki, A. B. Kuzma, K. Sleegers, M. Vronskaya, A. Ruiz, R. R. Graham, R. Olaso, P. Hoffmann, M. L. Grove, B. N. Vardarajan, M. Hiltunen, M. M. Nothen, C. C. White, K. L. Hamilton-Nelson, J. Epelbaum, W. Maier, S. H. Choi, G. W. Beecham, C. Dulary, S. Herms, A. V. Smith, C. C. Funk, C. Derbois, A. J. Forstner, S. Ahmad, H. Li, D. Bacq, D. Harold, C. L. Satizabal, O. Valladares, A. Squassina, R. Thomas, J. A. Brody, L. Qu, P. Sanchez-Juan, T. Morgan, F. J. Wolters, Y. Zhao, F. S. Garcia, N. Denning, M. Fornage, J. Malamon, M. C. D. Naranjo, E. Majounie, T. H. Mosley, B. Dombroski, D. Wallon, M. K. Lupton, J. Dupuis, P. Whitehead, L. Fratiglioni, C. Medway, X. Jian, S. Mukherjee, L. Keller, K. Brown, H. Lin, L. B. Cantwell, F. Panza, B. McGuinness, S. Moreno-Grau, J. D. Burgess, V. Solfrizzi, P. Proitsi, H. H. Adams, M. Allen, D. Seripa, P. Pastor, L. A. Cupples, N. D. Price, D. Hannequin, A. Frank-Garcia, D. Levy, P. Chakrabarty, P. Caffarra, I. Giegling, A. S. Beiser, V. Giedraitis, H. Hampel, M. E. Garcia, X. Wang, L. Lannfelt, P. Mecocci, G. Eiriksdottir, P. K. Crane, F. Pasquier, V. Boccardi, I. Henandez, R. C. Barber, M. Scherer, L. Tarraga, P. M. Adams, M. Leber, Y. Chen, M. S. Albert, S. Riedel-Heller, V. Emilsson, D. Beekly, A. Braae, R. Schmidt, D. Blacker, C. Masullo, H. Schmidt, R. S. Doody, G. Spalletta, W. T. Longstreth, Jr., T. J. Fairchild, P. Bossu, O. L. Lopez, M. P. Frosch, E. Sacchinelli, B. Ghetti, Q. Yang, R. M. Huebinger, F. Jessen, S. Li, M. I Kamboh, J. Morris, O. Sotolongo-Grau, M. J. Katz, C. Corcoran, M. Dunstan, A. Braddel, C. Thomas, A. Meggy, R. Marshall, A. Gerrish, J. Chapman, M. Aguilar, S. Taylor, M. Hill, M. D. Fairen, A. Hodges, B. Vellas, H. Soininen, I. Kloszewska, M. Daniilidou, J. Uphill, Y. Patel, J. T. Hughes, J. Lord, J. Turton, A. M. Hartmann, R. Cecchetti, C. Fenoglio, M. Serpente, M. Arcaro, C. Caltagirone, M. D. Orfei, A. Ciaramella, S. Pichler, M. Mayhaus, W. Gu, A. Lleo, J. Fortea, R. Blesa, I. S. Barber, K. Brookes, C. Cupidi, R. G. Maletta, D. Carrell, S. Sorbi, S. Moebus, M. Urbano, A. Pilotto, J. Kornhuber, P. Bosco, S. Todd, D. Craig, J. Johnston, M. Gill, B. Lawlor, A. Lynch, N. C. Fox, J. Hardy, A. Consortium, R. L. Albin, L. G. Apostolova, S. E. Arnold, S. Asthana, C. S. Atwood, C. T. Baldwin, L. L. Barnes, S. Barral, T. G. Beach, J. T. Becker, E. H. Bigio, T. D. Bird, B. F. Boeve, J. D. Bowen, A. Boxer, J. R. Burke, J. M. Burns, J. D. Buxbaum, N. J. Cairns, C. Cao, C. S. Carlson, C. M. Carlsson, R. M. Carney, M. M. Carrasquillo, S. L. Carroll, C. C. Diaz, H. C. Chui, D. G. Clark, D. H. Cribbs, E. A. Crocco, C. DeCarli, M. Dick, R. Duara, D. A. Evans, K. M. Faber, K. B. Fallon, D. W. Fardo, M. R. Farlow, S. Ferris, T. M. Foroud, D. R. Galasko, M. Gearing, D. H. Geschwind, J. R. Gilbert, N. R. Graff-Radford, R. C. Green, J. H. Growdon, R. L. Hamilton, L. E. Harrell, L. S. Honig, M. J. Huentelman, C. M. Hulette, B. T. Hyman, G. P. Jarvik, E. Abner, L. W. Jin, G. Jun, A. Karydas, J. A. Kaye, R. Kim, N. W. Kowall, J. H. Kramer, F. M. LaFerla, J. J. Lah, J. B. Leverenz, A. I. Levey, G. Li, A. P. Lieberman, K. L. Lunetta, C. G. Lyketsos, D. C. Marson, F. Martiniuk, D. C. Mash, E. Masliah, W. C. McCormick, S. M. McCurry, A. N. McDavid, A. C. McKee, M. Mesulam, B. L. Miller, C. A. Miller, J. W. Miller, J. C. Morris, J. R. Murrell, A. J. Myers, S. O'Bryant, J. M. Olichney, V. S. Pankratz, J. E. Parisi, H. L. Paulson, W. Perry, E. Peskind, A. Pierce, W. W. Poon, H. Potter, J. F. Quinn, A. Raj, M. Raskind, B. Reisberg, C. Reitz, J. M. Ringman, E. D. Roberson, E. Rogaeva, H. J. Rosen, R. N. Rosenberg, M. A. Sager, A. J. Saykin, J. A. Schneider, L. S. Schneider, W. W. Seeley, A. G. Smith, J. A. Sonnen, S. Spina, R. A. Stem, R. H. Swerdlow, R. E. Tanzi, T. A. Thornton-Wells, J. Q. Trojanowski, J. C. Troncoso, V. M. Van Deerlin, L. J. Van Eldik, H. V. Vinters, J. P. Vonsattel, S. Weintraub, K. A. Welsh-Bohmer, K. C. Wilhelmsen, J. Williamson, T. S. Wingo, R. L. Woltjer, C. B. Wright, C. E. Yu, L. Yu, F. Garzia, F. Golamaully, G. Septier, S. Engelborghs, R. Vandenberghe, P. P. De Deyn, C. M. Fernadez, Y. A. Benito, H. Thonberg, C. Forsell, L. Lilius, A. Kinhult-Stahlbom, L. Kilander, R. Brundin, L. Concari, S. Helisalmi, A. M. Koivisto, A. Haapasalo, V. Dermecourt, N. Fievet, O. Hanon, C. Dufouil, A. Brice, K. Ritchie, B. Dubois, J. J. Himali, C. D. Keene, J. Tschanz, A. L. Fitzpatrick, W. A. Kukull, M. Norton, T. Aspelund, E. B. Larson, R. Munger, J. I. Rotter, R. B. Lipton, M. J. Bullido, A. Hofman, T. J. Montine, E. Coto, E. Boerwinkle, R. C. Petersen, V. Alvarez, F. Rivadeneira, E. M. Reiman, M. Gallo, C. J. O'Donnell, J. S. Reisch, A. C. Bruni, D. R. Royall, M. Dichgans, M. Sano, D. Galimberti, P. St George-Hyslop, E. Scarpini, D. W. Tsuang, M. Mancuso, U. Bonuccelli, A. R. Winslow, A. Daniele, C. K. Wu, C. A. E. Gerad/Perades, O. Peters, B. Nacmias, M. Riemenschneider, R. Heun, C. Brayne, D. C. Rubinsztein, J. Bras, R. Guerreiro, A. Al-Chalabi, C. E. Shaw, J. Collinge, D. Mann, M. Tsolaki, J. Clarimon, R. Sussams, S. Lovestone, M. C. O'Donovan, M. J. Owen, T. W. Behrens, S. Mead, A. M. Goate, A. G. Uitterlinden, C. Holmes, C. Cruchaga, M. Ingelsson, D. A. Bennett, J. Powell, T. E. Golde, C. Graff, P. L. De Jager, K. Morgan, N. Ertekin-Taner, O. Combarros, B. M. Psaty, P. Passmore, S. G. Younkin, C. Berr, V. Gudnason, D. Rujescu, D. W. Dickson, J. F. Dartigues, A. L. DeStefano, S. Ortega-Cubero, H. Hakonarson, D. Campion, M. Boada, J. K. Kauwe, L. A. Farrer, C. Van Broeckhoven, M. A. Ikram, L. Jones, J. L. Haines, C. Tzourio, L. J. Launer, V. Escott-Price, R. Mayeux, J. F. Deleuze, N. Amin, P. A. Holmans, M. A. Pericak-Vance, P. Amouyel, C. M. van Duijn, A. Ramirez, L. S. Wang, J. C. Lambert, S. Seshadri, J. Williams and G. D. Schellenberg (2017). “Rare coding variants in PLCG2, ABI3, and TREM2 implicate microglial-mediated innate immunity in Alzheimer's disease.” Nat Genet 49(9); 1373-1384.

(1048) Suarez-Calvet, M., E. Morenas-Rodriguez, G. Kleinberger, K. Schlepckow, M. A. Araque Caballero, N. Franzmeier, A. Capell, K. Fellerer, B. Nuscher, E. Eren, J. Levin, Y. Deming, L. Piccio, C. M. Karch, C. Cruchaga, L. M. Shaw, J. Q. Trojanowski, M. Weiner, M. Ewers, C. Haass and I. Alzheimer's Disease Neuroimaging (2019). “Early increase of CSF sTREM2 in Alzheimer's disease is associated with tau related-neurodegeneration but not with amyloid-beta pathology.” Mol Neurodegener 14(1); 1 (pp. 1-14).

(1049) Ulland, T. K., W. M. Song, S. C. Huang, J. D. Ulrich, A. Sergushichev, W. L. Beatty, A. A. Loboda, Y. Zhou, N. J. Cairns, A. Kambal, E. Loginicheva, S. Gilfillan, M. Cella, H. W. Virgin, E. R. Unanue, Y. Wang, M. N. Artyomov, D. M. Holtzman and M. Colonna (2017). “TREM2 Maintains Microglial Metabolic Fitness in Alzheimer's Disease.” Cell 170(4); 649-663.e13.

(1050) Ulrich, J. D., D. M. Holtzman (2016). “TREM2 Function in Alzheimer's Disease and Neurodegeneration.” ACS Chem Neurosci 20(7); 420-427.

(1051) Ulrich, J. D., T. K. Ulland, M. Colonna and D. M. Holtzman (2017). “Elucidating the Role of TREM2 in Alzheimer's Disease.” Neuron 94(2); 237-248.

(1052) Wang, Y., M. Cella, K. Mallinson, J. D. Ulrich, K. L. Young, M. L. Robinette, S. Gilfillan, G. M. Krishnan, S. Sudhakar, B. H. Zinselmeyer, D. M. Holtzman, J. R. Cirrito and M. Colonna (2015). “TREM2 lipid sensing sustains the microglial response in an Alzheimer's disease model.” Cell 160(6); 1061-1071.

(1053) Wu, R., X. Li, P. Xu, L. Huang, J. Cheng, X. Huang, J. Jiang, L. J. Wu and Y. Tang (2017). “TREM2 protects against cerebral ischemia/reperfusion injury.” Mol Brain 10(1); 20 (pp. 1-13).

(1054) Yeh, F. L., Y. Wang, I. Tom, L. C. Gonzalez, M. Sheng (2016). “TREM2 Binds to Apolipoproteins, Including APOE and CLU/APOJ, and Thereby Facilitates Uptake of Amyloid-Beta by Microglia.” Neuron 91(2); 328-340.

(1055) Yuan, P., C. Condello, C. D. Keene, Y. Wang, T. D. Bird, S. M. Paul, W. Luo, M. Colonna, D. Baddeley and J. Grutzendler (2016). “TREM2 Haplodeficiency in Mice and Humans Impairs the Microglia Barrier Function Leading to Decreased Amyloid Compaction and Severe Axonal Dystrophy.” Neuron 90(4); 724-739.

(1056) All references, for example, a scientific publication or patent application publication, cited herein are incorporated herein by reference in their entirety and for all purposes to the same extent as if each reference was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.