Methods and compositions for targeted two-dimensional western blot analysis for early cancer detection and cancer diagnosis up to ten years in advance of clinical symptoms of malignant disease

09804165 ยท 2017-10-31

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention includes methods for detecting benign to malignant transformation of a cancer in a subject, comprising the steps of: collecting a sample from the subject prior to electrophoretic protein separation; activating electrophoretically separated ENOX2 transcript variants with an ENOX2 electron donor; and detecting the presence of the one or more activated ENOX2 transcript variants using a pan-ENOX2 detectable binding reagent, wherein the presence of one or more activated ENOX2 transcript variants in the sample is indicative of the malignant transformation of the cancer, whereby a 10 to 100 fold increase in detection sensitivity is obtained for the one or more activated ENOX2 transcript variants when compared to an equivalent non-activated ENOX2 transcript variant.

Claims

1. A method for detecting benign to malignant transformation of a cancer in a subject, comprising the steps of: collecting a sample from the subject prior to electrophoretic protein separation; activating electrophoretically separated ENOX2 transcript variants with an ENOX2 electron donor; and detecting the presence of the one or more activated ENOX2 transcript variants using a pan-ENOX2 detectable binding reagent, wherein the presence of one or more activated ENOX2 transcript variants in the sample is indicative of the malignant transformation of the cancer, whereby a 10 to 100 fold increase in detection sensitivity is obtained for the one or more activated ENOX2 transcript variants when compared to an equivalent non-activated ENOX2 transcript variant.

2. The method of claim 1, wherein the ENOX2 electron donor required to activate the ENOX2 transcript variants is selected from at least one of a reduced pyridine nucleotide, NADH, NAD(P)H, or a synthetic substrate that is an ENOX2 electron donor, and detecting the one or more activated ENOX2 transcript variants on the 2D blot, wherein the final concentration of NADH or NAD(P)H is in the range 10 M to 50 M.

3. The method of claim 1, further comprises performing two dimensional (2D) electrophoretic protein separation and blotting onto a film or paper.

4. The method of claim 1, wherein the pan-ENOX2 detectable binding reagent comprises SEQ ID NO:11.

5. The method of claim 1, wherein the sample is a blood, serum, plasma, urine, cerebrospinal fluid or a body fluid.

6. The method of claim 1, wherein the pan-ENOX2 detectable binding reagent comprises an anti-ENOX2 scFv fusion protein that is: non-aggregating at between 4 C. and 40 C.; comprises a small side chain (Gly/Ser) of amino acid residues containing two cysteines (C) spaced as either CXXXXC or CXXXXXC; and is capable of forming an interchain disulfide bond with the protein disulfide-thiol interchange functional motif of ENOX2.

7. The method of claim 4, wherein the pan-ENOX2 detectable binding reagent comprises an scFv of SEQ ID NO:1, wherein the stability, binding efficiency, and shelf life of the scFv of SEQ ID NO:11 is improved by storing in 50% glycerol to prevent aggregation.

8. The method of claim 1, wherein the step of concentrating the blood, serum, or plasma sample is defined further as concentrating the one or more ENOX2 transcript variants using a nickel-agarose substrate to bind and concentrate the one or more ENOX2 transcript variants.

9. The method of claim 1, further comprises detecting the cancer and/or determining a tissue of origin of a human cancer at least one year in advance of clinical symptoms.

10. The method of claim 1, further comprises determining a tissue of origin of one or more cancers of unknown primary (CUP).

11. The method of claim 1, further comprises screening for at least one of: early cancer in populations with family cancer histories, environmental exposures, or in a general population.

12. The method of claim 1, further comprises determining a tissue of origin of the one or more activated ENOX2 transcript variants based on the presence of ENOX2 transcript variants as set forth in Table 1.

13. The method of claim 1, further comprises resolving proteins at 53 and/or 79 to 85 kDa as total protein loading controls.

14. The method of claim 1, further comprises distinguishing between distant metastases and multiple primary cancers based on the presence of the one or more activated ENOX2 transcript variants.

15. The method of claim 1, further comprises detecting stage 0 and stage 1 cancers and determining the tissue of origin of the cancer.

16. The method of claim 1, wherein an incidence of false positives and confirmed false negatives of the predicted cancer is less than 1%.

17. The method of claim 1, wherein the sensitivity of the method for detecting the cancer is greater than 97%.

18. The method of claim 1, further comprises monitoring the reemergence of the cancer, therein the presence of 2 million or less cancer cells is detectable based on the reemergence of the one or more activated ENOX2 transcript variants.

19. The method of claim 1, wherein the tissue of origin of the cancer detected is selected from at least one of bladder, blood cell, lymphomas, leukemias, multiple myelomas and myelomas breast, cervical, colorectal, esophageal, gastric, hepatocellular, lung, non-small cell, melanoma, mesothelioma, ovarian, pancreatic, prostate, renal cell (kidney), sarcoma, squamous cell, testicular germ cell, thyroid follicular, thyroid papillary, or uterine.

20. A calibrated method of quantitation of ENOX2 transcript variants on a western blot comprising: subjecting a sample from the subject concentrated sample to electrophoretic protein separation; western blotting the electrophoretically separated proteins onto a protein capture film or paper; activating one or more ENOX2 transcript variants on the protein capture film or paper with a reduced ENOX2 substrate; and detecting the presence of the one or more activated ENOX2 transcript variants using a pan-ENOX2 detectable binding reagent, wherein a 10 to 100 fold increase in detection sensitivity for ENOX2 is obtained when compared to the non-activated ENOX2, wherein the amount of one or more activated ENOX2 transcript variants is calibrated based on a spot diameter and an intensity of the ENOX2 transcript variant on the protein capture film or paper when compared to a known amount of the one or more ENOX2 transcript variants.

21. The method of claim 20, wherein the spot diameter is compared to a standard curve of recombinant ENOX2.

22. The method of claim 20, wherein the spot diameter and the log of the mass of ENOX2 are linearly correlated.

23. The method of claim 20, wherein the quantitation is achieved by a combination of spot diameter and ENOX2 activity.

24. The method of claim 20, wherein the sample is a blood, serum, plasma, urine, cerebrospinal fluid or a body fluid.

25. The method of claim 20, wherein the quantitation is achieved by cutting out ENOX2 antibody reactive spots and quantitating the amount of ENOX2 using elution and reaction with silver tetroxide to form silver nanoparticles and quantitating the nanoparticles by light scattering using an UV-vis spectrophotometer or a light scattering spectrophotometer by comparison to a corresponding spot that is free of ENOX2.

26. The method of claim 25, wherein a spot percentage above background greater than 7% confirms the presence of an ENOX2 transcript variant in the spot.

27. The method of claim 20, further comprises detecting and determining a tissue of origin in the spot of a human cancer at least one year in advance of clinical symptoms.

28. A method for determining the tissue of origin of a cancer in a subject comprising: subjecting proteins in a sample from the subject to a two-dimensional (2D) molecular weight and isoelectric point electrophoretic protein separation; transferring the proteins to a protein capture film or paper; activating the electrophoretically separated ENOX2 transcript variants with an ENOX2 electron donor on the protein capture film or paper; detecting the activated ENOX2 transcript variants; and determining the tissue of origin of the cancer based on the presence of one or more activated ENOX2 transcript variants selected from Bladder, Blood Cell, Breast, Cervical, Colorectal, Esophageal, Gastric, Hepatocellular, Leukemias, Lung Non-Small Cell, Lung Small Cell, Lymphomas, Melanoma, Mesothelioma, Myeloma, Ovarian, Pancreatic, Prostate, Renal Cell (Kidney), Sarcoma, Squamous Cell, Testicular Germ Cell, Thyroid Follicular, or Thyroid Papillary, wherein activation of the one or more ENOX2 transcript variants in situ increases the detection sensitivity by 10 to 100 fold when compared to non-activated ENOX2 transcript variants.

29. The method of claim 28, wherein the ENOX2 electron donor required to activate the ENOX2 transcript variants is selected from at least one of a reduced pyridine nucleotide, NADH, NAD(P)H, or a synthetic substrate that is an ENOX2 electron donor, and detecting the one or more activated ENOX2 transcript variants on the 2D blot, wherein the final concentration of NADH or NAD(P)H is in the range 10 M to 50 M.

30. The method of claim 28, further comprising the steps of performing two dimensional (2D) electrophoretic protein separation and blotting onto a film or paper, wherein the ENOX2 electron donor is selected from at least one of a reduced pyridine nucleotide, NADH, NAD(P)H, or a synthetic substrate that is an ENOX2 electron donor, and detecting the one or more activated ENOX2 transcript variants on the 2D blot, wherein the final concentration of NADH or NAD(P)H is in the range 10 M to 50 M.

31. The method of claim 28, wherein the pan-ENOX2 detectable binding reagent comprises SEQ ID NO:11.

32. The method of claim 28, wherein the sample is a blood, serum, plasma, urine, cerebrospinal fluid or a body fluid.

33. The method of claim 28, wherein the pan-ENOX2 detectable binding reagent comprises an anti-ENOX2 scFv fusion protein is: non-aggregating at between 4 C. and 40 C.: comprises a small side chain (Gly/Ser) amino acid residues containing two cysteines (C) spaced as either CXXXXC or CXXXXXC; and is capable of forming an interchain disulfide bond with the protein disulfide-thiol interchange functional motif of ENOX2.

34. The method of claim 28, wherein the pan-ENOX2 detectable binding reagent comprises an scFv of SEQ ID NO:11, wherein the stability, binding efficiency, and shelf life of the scFv of SEQ ID NO:1 is improved by storing in 50% glycerol to prevent aggregation.

35. The method of claim 28, wherein the step of concentrating the blood, serum, or plasma sample is defined further as concentrating the one or more ENOX2 transcript variants using a nickel-agarose substrate to bind and concentrate the one or more ENOX2 transcript variants.

36. The method of claim 28, further comprises detecting the cancer and/or determining a tissue of origin of a human cancer at least one year in advance of clinical symptoms.

37. A blot comprising one or more electrophoretically separated proteins from a concentrated sample from a subject, wherein the blot is exposed to a pan-ENOX2 detecting reagent and to a reducing substrate for ENOX2 that activates the ENOX2 transcript variants on the blot, wherein the blot is analyzed for the present of one or more activated ENOX2 transcript variants from the following Table 1, wherein the presence of the one or more activated ENOX2 transcript variants is used to detect and determine a tissue of origin of a human cancer at least one year in advance of clinical symptoms, and the activation of the one or more ENOX2 transcript variants in situ increases the detection sensitivity by 10 to 100 fold when compared to non-activated ENOX2 transcript variants.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) For a more complete understanding of the features and advantages of the present invention, reference is now made to the detailed description of the invention along with the accompanying figures and in which:

(2) FIG. 1 is a graph that demonstrates a two-fold increase in spot size and density of different amounts of ENOX2 in the assay as determined by 2-D gel electrophoresis/western blot analysis comparing incubation in the presence of 15 M NADH in the assay compared to no NADH.

(3) FIG. 2 is a graph that depicts the relationship of ENOX2 activity and concentration of NADH. Maximum activity was achieved at about 500 M NADH with a kM of approximately 0.8 M (see FIG. 3 for determination of kM).

(4) FIG. 3 is graph that shows a double reciprocal Lineweaver-Burke plot of ENOX2 activity (nanomoles/min/mg protein) V versus mM substrate concentration S yielding a kM of approximately 0.8 mM. The ordinate intercept being the same or similar for with and without antibody demonstrate that the antibody competes with the NADH substrate for the active site providing evidence for the substrate and antibody combining site being in the same region of the ENOX2 sequence.

(5) FIG. 4 is graph that shows a representation of ENOX2 activity as a function of time to illustrate five maxima of the ENOX2 activity cycle of pooled cancer sera. As quantitated in Table 1, inhibition occurs at maximum 4 within the 22 min activity cycle. Thus, antibody binding must occur exclusively during maximum 4 since maximum 5 is the first maximum to be inhibited. Antibody addition at maximum 5 had no effect nor did antibody addition before maximum 4.

(6) FIG. 5 is graph that depicts early detection of malignant mesothelioma in asbestos workers up to 10 years in advance of clinical symptoms. Serial assays of seven male subjects, median age of diagnosis 67 years, beginning 168 to 96 months before diagnosis of asbestos-induced malignant mesothelioma are represented. Solid symbolsboth protein 1 and protein 2 characteristic of malignant mesothelioma, evident. Open symbolsneither protein 1 nor protein 2 evident. Shaded symbolsonly protein 1 evident.

(7) FIG. 6 is a schematic representation of the utility of the ENOX2 family of cancer-specific, cell surface proteins for early diagnosis and early intervention of cancer. Cancer site-specific transcript variants of ENOX2 are shed into the serum to permit early detection and diagnosis. The ENOX2 proteins of origin at the cell surface act as terminal oxidases of plasma membrane electron transport functions essential to the unregulated growth of cancer. When the ENOX2 proteins are inhibited, as for example through EGCg/Capsicum synergies, the unregulated growth ceases and the cancer cells undergo programmed cell death (apoptosis).

(8) FIG. 7 provides a 2-Dimensional gel/western blot of ENOX2 transcript variants comparing pooled non-cancer (left panels) and pooled cancer representing major carcinomas plus leukemias and lymphomas (right panels) patient sera. The approximate location of unreactive (at background) albumin is labeled for comparison. ENOX2 reactive proteins are restricted to quadrants I and IV. Detection use recombinant ScFv-S (S-tag peptide: His-Glu-Ala-Ala-Lys-Phe-Gln-Arg-Glu-His) antibody linked with alkaline phosphatase. The approximately 10 ENOX2 transcript variants of the pooled cancer sera are absent from non-cancer (A) and are cancer site-specific.

(9) FIGS. 8A to 8J show western blots of 2-D gel electrophoresis/western blots of sera from cancer patients analyzed individually. Cancer sites are presented in the order of decreasing molecular weight of the major transcript variant present. FIG. 8A. Cervical cancer. FIG. 8B. Ovarian cancer. FIG. 8C. Prostate cancer. FIG. 8D. Breast cancer. FIG. 8E. Non-small cell lung cancer. FIG. 8F. Small cell lung cancer. FIG. 8G. Pancreatic cancer. FIG. 8H. Colon cancer. FIG. 8I. Non-Hodgkin lymphoma. FIG. 8J. Melanoma. The approximate location of unreactive (at background) albumin (Ab) is labeled for comparison. Approximately 180 non-cancer patient sera were analyzed in parallel without evidence of proteins indicative of specific transcript variants for comparison as positive controls.

(10) FIGS 9A and 9B show analytical gel electrophoresis and immunoblots of patient sera. FIG. 9A. Sera from a patient with non-small cell lung cancer contains a 54 kDa, isoelectric point pH 5.1 transcript variant (arrow). FIG. 9B. Sera from a patient with small cell lung cancer contains a 52 kDa, isoelectric point 4.3 transcript variant (arrow). The reference spots to the right, MW 52 kDa and isoelectric point pH 4.1 are 1-antitrypsin inhibitor. Albumin and other serum proteins are unreactive.

(11) FIG. 10 shows 2-D gel electrophoretic separations and detection of ENOX2 transcript variants specific for breast cancer by western blotting of patient sera. Arrow=66 to 68 kDa breast cancer specific transcript variant. R=52 kDa, isoelectric point pH 4.1 -fetuin reference spot.

(12) FIG. 11 illustrates the log-log relationship between spot diameter and amount of ENOX2 protein loaded on the 2-D gel. Varying amounts of recombinant ENOX2 were analyzed by immunoblot. The log of the diameter of the detected ENOX2 spot was then plotted as a function of the log of the amount of ENOX2 loaded.

(13) FIG. 12 shows Western blots of mixing experiments to demonstrate efficacy of ScFV with -CXXC-XX-C linker (FIG. 12A) compared to the conventional XXXXXXX linker (FIG. 12B). Under non-reducing conditions for both (to preserve SS bonds), the ScFV recombinant antibody with the functional cysteine linker when incubated with recombinant ENOX2 showed reduced levels of 53 kDa ScFV (a) and a 46 kDa truncated ScFV from a downstream initiation site (b) predominantly by disulfide bond formation between the full length ScFV and the 72 kDa full length ENOX2 in a ratio of one ENOX2 molecule plus two ScFV molecules (one to each of the two protein disulfide isomerase binding sites of ENOX2) for a combined molecular weight of about 176 kDa. In FIG. 12B, with the conventional linker lacking cysteines, no evidence of cross-linking under identical reaction conditions was observed.

(14) FIG. 13 is particle distribution as concentration (%) of antibody based on size (nm) determined by light scattering (Agilent 7080 Particle Size Spectrophotometer) showing predominately the major contribution of unaggregated antibody when stored in 50% glycerol at 70 C.

(15) FIG. 14 is a comparison of the NADH-targeted two-dimensional western blot analysis described herein compared with a conventional two-dimensional western blot analysis as described by Hostetler el al. 2009 (Clin. Proteomics 5: 46-51) validating a 10-fold increase in sensitivity of ENOX2 transcript variant detection.

DETAILED DESCRIPTION OF THE INVENTION

(16) While the making and using of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention.

(17) To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as a, an and the are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.

(18) The field of this invention is a serum-based assay for early pan-cancer diagnosis of cancer that permits detection of cancer up to ten years in advance of clinical symptoms of malignant disease based on a specific functionalized single chain variable region recombinant antibody targeted to a cancer-specific family of cell surface ENOX2 proteins whereby molecular weights and isoelectric points of tissue of origin-specific transcript variants determined by using two-dimensional gel electrophoresis with an ENOX2-specific recombinant scFv antibody combined with NADH-targeted technology providing ten- to 100-fold enhanced sensitivity over the previously developed protocols.

(19) Ecto-Nicotinamide Adenine Dinucleotide Oxidase Disulfide Thiol Exchanger 2 (ENOX2) (GenBank accession no. AF207881; Chueh et al., 2002) also known as Tumor Associated Nicotinamide Adenine Dinucleotide Oxidase (ENOX2) is ideally suited as a target for early diagnosis as well as for early preventive intervention (FIG. 6). The proteins are expressed on the cell surface of malignancies and detectable in the serum of patients with cancer (Cho et al., 2002). ENOX2 proteins are terminal hydroquinone oxidases of plasma membrane electron transport. From the standpoint of early intervention, they are important in the growth and enlargement of tumor cells (Morre and Morre, 2003; Tang et al., 2007. Biochemistry 46:12337-12346; 2008. Oncol. Res. 16:557-567). Our approach using ENOX2, as a target for both early detection and for early interventions, is based on these properties (Cho et al., 2002: Morre and Morre, 2003; reviewed by Davies and Bozzo, 2005. Drug News Perspect 19: 223-225). While ENXO2 presence provides a non-invasive approach to cancer detection, without methodology to identify cancer site-specific ENOX2 forms, it did not offer an indication as to cancer type or location.

(20) The present invention provides a method for the analysis of a biological sample for the presence of particular isoforms of the pan-cancer antigen known as ENOX2 (for tumor-specific NADH oxidase). The present method entails 2-dimensional gel electrophoresis and immunoblotting using an antibody specific for the pan-cancer ENOX2 antigen and the various isoforms which characterize particular types of cancers. As specifically exemplified, about 30 L of sera are loaded for analysis.

(21) ENOX2 transcript variants are identified on the basis of their molecular weights and isoelectric point with detection using a ENOX2-specific monoclonal antibody (MAb) (U.S. Pat. No. 7,053,188), using single chain variable region (scFv) fragment which recognizes all cell surface NOX proteins (both age-related, normal cell and neoplasia specific NADH oxidase) or using polyclonal sera raised against ENOX2. The ECTO-NOX proteins are first enriched and concentrated from a biological sample, desirably a serum sample, by binding to nickel-agarose and then eluting. After release of the proteins from the nickel agarose by vortexing, the proteins are separated in the first dimension by isoelectric focusing and in the second dimension by polyacrylamide gel electrophoresis. As specifically exemplified herein, the isoelectric focusing step is over a pH range from 3 to 10, and size separation is over a 10% polyacrylamide gel. Most of the cancer-specific ENOX2 isoforms exhibit isoelectric points in a very narrow range between pH 3.9 and 6.3 but differ in molecular weight from 34 to 136 kDa. In the 2D gel system specifically exemplified, the cancer-specific isoforms are located in Quadrants I (relatively high molecular weight material) and IV (lower molecular weight material, notably the range of 30 to 50 kDa. IgG heavy chains (Quadrant II and IgG light chains (Quadrant III) cross react with the scFv antibody and along with reference proteins at 53 and 79 to 85 kDa serve as loading controls. The absence of all ENOX2 isoforms indicates the absence of cancer or a cumulative cancer size below the limit of detection in the assay. The presence of an ENOX2 isoform indicates the presence of cancer. The particular molecular weight present in a serum sample or a particular combination of isoforms provides an indication of the cell type or tissue of origin of the cancer. The method not only determines cancer presence, but also the method of the present invention provides diagnostic information concerning the tissue of origin. At present there are no other pan cancer (all forms of human cancer) tests with these particular capabilities. ENOX2 transcript variants with apparent molecular weights in the range of 64-69 kDa, pH in the range of 4.2-4.9 are associated with breast cancer. ENOX2 transcript variants of 52-53 kDa, pH 4.1-4.6 is associated with small cell lung cancer. An ENOX2 transcript variant of 54-56 kDa, pH 4.6-5.3 is associated with non-small cell lung cancer. Two ENOX2 transcript variants of about 72-90 kDa and 37-47 kDa, isoelectric point pH 3.7-5.0 for both, characterize ovarian cancer. ENOX2 transcript variants of 71-88 kDa, pH 5.1-6.5 are associated with prostate cancer. An ENOX2 transcript variant of about 90-100 kDa. pH 4.2-5.4 signals cervical cancer. Three ENOX2 transcript variants of about 80-96 kDa, pH 4.4-5.4; 50-65 kDa, pH 4.2-5.3; and 33-46 kDa, pH 3.8-5.2 are characteristic of colon cancer. Where a patient is suspected of having cancer, the 2D gel electrophoresis/immunological analysis of a biological sample, advantageously a serum sample will reveal both cancer presence and organ site with the present invention.

Method 1

Ten- to 100-fold Increase in Sensitivity and Specificity of the Western Blot Detection Protocol

(22) Using the present invention a ten- to 100-fold increase in sensitivity and specificity of the western blot detection protocol was derived from an observation that there was a delay time of the inhibition of NADH oxidation following exposure of serum ENOX2 to an antibody combining site inhibitory ligand. The inhibition was observed to occur at various time between 0 and 22 minutes (22 minutes is the length of the ENOX2 activity cycle; (Wang et al., 2001. Biochim. Biophys. Acta 1539:i92-204) during a 30 minute incubation. Thus, the time during each 22 min activity cycle where the EEMTE antibody combining site is available for combination with antibody is relatively brief, and in the order of less than 5 minutes. Also, the ENOX2 protein must be active in order for the antibody to gain access to the binding site during this relatively short window of opportunity.

(23) Table 2 shows the activity of ENOX2 at the five activity maxima during 5 successive 22 minutes activity cycles following antibody addition.

(24) TABLE-US-00002 nanomoles/min/mg protein Maximum Maximum Maximum Maximum Maximum 1 2 3 4 5 Cycle 1 1.00 Cycle 2 1.00 1.25 0.75 0.90 0.40 Cycle 3 0.50 0.25 0.10 0.25 0.25 Cycle 4 0.10 0.50 0.25 0.25 0.05 Cycle 5 0.10 0.05 0.30 0.00 0.30

(25) Inhibition occurs at maximum 4 within the 22 min activity cycle. Thus, antibody binding must occur exclusively during maximum 4 since maximum 5 is the first maximum to be inhibited. Antibody addition at maximum 5 had no effect nor did antibody addition before maximum 4. A corollary of the above result is that antibody will not bind or will bind only poorly to inactive ENOX2 transcript variants. Therefore, steps were initiated to render ENOX2 on western blots active during incubation with antibody.

(26) In order to maintain an active ENOX2 during western blotting with antibody, following blocking for 10 minutes with 1% milk and two rinses with TBST to remove excess milk, reduced pyridine nucleotides [NAD(P)H] were added at a concentration of 15 M during incubation with the primary scFv antibody. NADH is preferred at a final concentration in the range of 10 M. Incubation of the blot with antibody with or without shaking at any temperature between 4 C. and 40 C. for times of 1 to 16 hours depending on the concentration of NADH, the temperature and the antibody titer, preferably with incubation at 4 C. overnight (approximately 16 hours) with shaking.

(27) The cancer diagnostic system of the present invention utilizes two-dimensional polyacrylamide gel electrophoretic techniques for the separation of proteins in human sera to generate cancer-specific isoform patterns and compositions indicative of cancer presence, tumor type, disease severity and therapeutic response. The protocol is designed for the detection of at least 26 cancer-specific patterns of ENOX2 transcript variants each denoting a different tumor type representing 20 different tissue of cancer origin, which are resolved to indicate cancer presence and origin of the primary cancer. This specification illustrates the process of the transcriptresolving two-dimensional gel electrophoresis protocol and subsequent immunoanalysis to detect ENOX2 transcript variants that reflect particular cancers.

(28) Two-dimensional gel electrophoresis separates by displacement in two dimensions oriented at right angles to one another and immunoblotting identifies the ENOX2 isoforms. In the first dimension variants are separated by isoelectric point (pI) according to charge by isoelectric focusing (IEF). The variants are then separated according to molecular weight in kilodaltons (kDa) by SDS-PAGE in a second dimension. The isoforms are then blotted onto a nitrocellulose membrane for further analysis using the pan-cancer specific antibody preparation containing a functional linker that stabilizes antibody binding to the transcript variants.

(29) The opportunity to simultaneously determine both cancer presence and cancer tissue of origin emerged as a result of 2-dimensional gel electrophoretic separations where western blots with a pan ENOX2 recombinant single chain variable region (scFv) antibody carrying an S tag (FIG. 7) was employed for detection (Hostetler et al., 2009. Clin. Proteomics 5: 46-51). The antibody cross reacted with all known ENOX2 transcript variants from hematological and solid tumors of human origin but, of itself, did not differentiate among different kinds of cancers. Analyses using this antibody, when combined with two-dimensional gel electrophoretic separation, revealed specific species of ENOX2 proteins subsequently identified as transcript variants, each with a characteristic molecular weight and isoelectric point indicative of a particular form of cancer (Table 1).

Method 2

ENOX Transcript Variants of Specific Molecular Weights and Isoelectric Points are Produced Uniquely by Patients with Cancer

(30) The transcript variants are shed into the circulation and have the potential to serve as definitive, non-invasive and sensitive serum markers for early detection of both primary and recurrent cancer in at risk populations with a low incidence of both false positives, and false negatives as they are molecular signature molecules produced specifically by cancer cells and absent from non-cancer cells.

(31) As the 2-D-western blot protocol detects cancer early, well in advance of clinical symptoms, the opportunity to combine early detection with early intervention as a potentially curative prevention strategy for cancer is provided whereby elimination of the disease in its very earliest stages is uniquely possible.

(32) FIG. 2 is a graph that depicts the relationship of ENOX2 activity and concentration of NADH. Maximum activity was achieved at about 500 M NADH with a kM of approximately 0.8 M (see FIG. 3 for determination of kM).

(33) FIG. 3 is graph that shows a double reciprocal Lineweaver-Burke plot of ENOX2 activity (nanomoles/min/mg protein) V versus mM substrate concentration S yielding a kM of approximately 0.8 mM. The ordinate intercept being the same or similar for with and without antibody demonstrate that the antibody competes with the NADH substrate for the active site providing evidence for the substrate and antibody combining site being in the same region of the ENOX2 sequence.

(34) FIG. 4 is graph that shows a representation of ENOX2 activity as a function of time to illustrate five maxima of the ENOX2 activity cycle of pooled cancer sera. As quantitated in Table 1, inhibition occurs at maximum 4 within the 22 minutes activity cycle. Thus, antibody binding must occur exclusively during maximum 4 since maximum 5 is the first maximum to be inhibited. Antibody addition at maximum 5 had no effect nor did antibody addition before maximum 4.

(35) FIG. 5 is graph that depicts early detection of malignant mesothelioma in asbestos workers up to 10 years in advance of clinical symptoms. Serial assays of seven male subjects, median age of diagnosis 67 years, beginning 168 to 96 months before diagnosis of asbestos-induced malignant mesothelioma are represented. Solid symbolsboth protein 1 and protein 2 characteristic of malignant mesothelioma, evident. Open symbolsneither protein 1 nor protein 2 evident. Shaded symbolsonly protein 1 evident.

(36) Analytical 2-D gel electrophoresis and immunoblotting of ENOX proteins from a mixed population of cancer patients (bladder, blood cell (leukemias, lymphomas, and myelomas), breast, cervical, colorectal, esophageal, gastric, hepatocellular, lung, melanoma, ovarian, pancreatic, prostate, renal cell (kidney), sarcoma, squamous cell, testicular germ cell, thyroid, and uterine (endometrial) revealed multiple species of acidic proteins of molecular weight between 34 and 100 kDa in quadrants I and IV (FIG. 7, right panels), none of which were present in sera of non-cancer patients (FIG. 7, left panels). Separation in the first dimension was by isoelectric focusing over the pH range of 3 to 10 and separation in the second dimension was by 10 percent SDS-PAGE. Isoelectric points of the ENOX2 transcript variants were in the range of 3.2 to 6.3. The principal reactive proteins other than the ENOX2 forms were a 53 kDa isoelectric point pH 4.1, mostly phosphorylated alpha-fetuin (Labeled R in FIG. 8) which served as a convenient loading control and isoelectric point reference and a 79-85 kDa, isoelectric point pH 6.8 serotransferrin which served as a second point of reference for loading and as an isoelectric point reference. The two cross reactive reference proteins are present in a majority of sera and plasma of both cancer and non-cancer subjects. Albumin and other serum proteins normally do not react when present in low amounts. On some blots, the recombinant scFv was weakly cross-reactive with heavy (ca. 52 kDa) and light (ca. 25 kDa) immunoglobulin chain proteins.

(37) FIGS. 8A to 8J show western blots of 2-D gel electrophoresis-western blots of sera from cancer patients analyzed individually. Cancer sites are presented in the order of decreasing molecular weight of the major transcript variant present. FIG. 8A. Cervical cancer. FIG. 8B. Ovarian cancer. FIG. 8C Prostate cancer. FIG. 8D. Breast cancer. FIG. 8E. Non-small cell lung cancer. FIG. 8F. Small cell lung cancer. FIG. 8G. Pancreatic cancer. FIG. 8H. Colon cancer. FIG. 8I. Non-Hodgkin lymphoma. FIG. 8J. Melanoma. The approximate location of unreactive (at background) albumin (Ab) is labeled for comparison. Approximately 180 non-cancer patient sera were analyzed in parallel without evidence of proteins indicative of specific transcript variants for comparison as positive controls.

(38) FIGS. 9A and 9B show analytical gel electrophoresis and immunoblots of patient sera. FIG. 9A. Sera from a patient with non-small cell lung cancer contains a 54 kDa, isoelectric point pH 5.1 transcript variant (arrow). FIG. 9B. Sera from a patient with small cell lung cancer contains a 52 kDa, isoelectric point 4.3 transcript variant (arrow). The reference spots to the right, MW 52 kDa and isoelectric point pH 4.1 are 1-antitrypsin inhibitor. Albumin and other serum proteins are unreactive.

(39) FIG. 10 shows 2-D gel electrophoretic separations and detection of ENOX2 transcript variants specific for breast cancer by western blotting of patient sera. Arrow=66 to 68 kDa breast cancer specific transcript variant. R=52 kDa, isoelectric point pH 4.1 -fetuin reference spot.

(40) Sera from individual patients with various forms of cancer were analyzed by 2-D gel electrophoresis and immunoblotting to assign each of the ENOX2 isoforms of FIG. 7 to a cancer of a particular tissue of origin (see Table 3). ENOX2 transcript variants with apparent molecular weights in the range of 64-69 kDa, pH in the range of 4.2-4.9 are associated with breast cancer. ENOX2 transcript variants of 52-53 kDa, pH 4.1-4.6 is associated with small cell lung cancer. An ENOX2 transcript variant of 54-56 kDa, pH 4.6-5.3 is associated with non-small cell lung cancer. Two ENOX2 transcript variants of about 72-90 kDa and 37-47 kDa, isoelectric point pH 3.7-5.0 for both, characterize ovarian cancer. ENOX2 transcript variants of 71-88 kDa, pH 5.1-6.5 are associated with prostate cancer. An ENOX2 transcript variant of about 90-100 kDa, pH 4.2-5.4 signals cervical cancer. Three ENOX2 transcript variants of about 80-96 kDa, pH 4.4-5.4; 50-65 kDa, pH 4.2-5.3; and 33-46 kDa, pH 3.8-5.2 are characteristic of colon cancer. Where a patient is suspected of having cancer, the 2D gel electrophoresis/immunological analysis of a biological sample, advantageously a serum sample, will reveal both cancer presence and organ site with the present invention.

(41) The protein sequence of ENOX2 exhibits similarity with the two reference proteins alpha-fetuin and serrotransferrin reactive with the pan ENOX2 scFv recombinant antibody. Regions of similarity are restricted to a 7 amino acid sequence (underlined) adjacent in ENOX2 to the E394EMTE398 quinone inhibitor-binding site, which serves as the antigen sequence to which the specific scFv antibodies bind.

(42) TABLE-US-00003 (SEQIDNO:1) ENOX2 EEMTETKETEESALVSunderlinedAA399-406 (SEQIDNO:2) Alpha- GTDCVAKEATEAAKCNunderlinedAA210-216 fetuin (SEQIDNO:3) Serrotrans- CLDGTRKPVEEYANCHunderlinedAA588-595 ferrin

(43) A. Sample Preparation

(44) 1. Prepare/thaw re-hydration solution (20, 1.5 mL tube labeled RB). a. Add 1% Dithiothreitol (DTT) to solution before use (0.01 g/1.0 mL).

(45) 2. Add 120 L of Rehydration Buffer to a 1.7 ml tube.

(46) 3. Add 30 L of sera to tube.

(47) 4. Vortex solution until fully mixed.

(48) 5. Remove Immobiline DryStrips from freezer (20 C., pH 3-10) and allow strips to equilibrate to RT for 5 minutes. a. Do not leave strips at RT for more than 10 minutes.

(49) 6. Record ID# from strip.

(50) 7. Load 130 L of sample to tray per 7 cm DryStrip. Ensure tray is level.

(51) 8. Place DryStrips gel-side down over sample.

(52) 9. Ensure sample is evenly spread throughout strip by carefully lifting strip in and out of sample a few times if needed.

(53) 10. If samples are concentrated in one region of the strip, redistribute sample by pipetting.

(54) 11. Remove air bubbles by gently pressing down on DryStrip with pipette tip.

(55) 12. Place lid on tray and place tray in plastic bag with ddi-H2O soaked paper towels.

(56) 13. Seal bag.

(57) 14. Allow sample to re-hydrate overnight at RT on a level surface allowing strips to absorb sample for 12-24 hours.

(58) B. Isoelectric Focusing (First Dimension)

(59) 1. Turn on IPGphor (ensure proper startup of machine).

(60) 2. Place strips on Manifold focusing tray as follows: a. Gel side up. b. positive (acidic) end towards back. c. Strips are aligned. d. Between metal strips (so electrodes fit and touch metal strip)

(61) 3. Obtain 2 Paper Wicks per strip.

(62) 4. Wet wicks with 150 L di-H2O per wick.

(63) 5. Place wicks over anodic and cathodic ends of gel (approx. 0.3 cm).

(64) 6. Place electrodes on wicks, but away from gel (be sure prong is on metal plate), and lock in place.

(65) 7. Cover strips with DryStrip Cover fluid. a. Fill strips entire lane with oil. b. Ensure strips are fully covered.

(66) 8. Close lid.

(67) 9. IEF run with IPGphor II. a. Maximum amperage: 50 Amps. b. Temperature: 20 C. c. Ensure correct assembly by checking initial voltage. d. As needed, pause run and replace wicks, continue run until dye front disappears.

(68) Run Parameters:

(69) TABLE-US-00004 Step Voltage Time/Vhrs 7 cm Strip pH 3-10 1-Stp. 250 V 250 Vhrs. (Run #1) 2-Stp. 500 V 500 Vhrs. 3-Stp. 1000 V 1000 Vhrs. 4-Grd. 4000 V 3 hrs. 5-Stp. 4000 V 25,000 Vhrs. 6-Stp. 500 V Hold

(70) C. Prepare SDS-Page Gels (for Second Dimension)

(71) 1. Prior to use, wash and scrub plates very well in soap and hot water.

(72) 2. Rinse in di-H2O.

(73) 3. Leave the plates to air dry or wipe with ethanol-soaked Kimwipes.

(74) 4. Order plates in Protean-plus Multi-Gel casting Chamber (Bio-Rad) as per manual (with a spacer between each plate and block).

(75) 5. Ensure screws are fully tightened.

(76) 6. Add gel solution.

(77) 7. Stop pouring when gel is about 1-1.5 cm from top of glass plates.

(78) 8. Gently overlay gels with ethanol.

(79) 9. Cover with Saran Wrap.

(80) 10. Allow gels to polymerize for at least one hour (best if overnight).

(81) D. Equilibration (First Dimension)

(82) 1. Remove strips from tray and place on Kimwipe to remove excess oil. 1. Place strips gel side up on Kimwipe. 2. Overlay strips with a second Kimwipe and gently blot to remove oil.

(83) 2. Place strips in equilibration plate gel side up; freeze or equilibrate. 1. Freeze: Wrap plate in plastic wrap, store at 80 C. a. Thaw strips prior to equilibration (clear when thawed). 2. Equilibrate: continue to next step.

(84) 3. Cover strips with equilibration buffer, about 1.5 mL per strip.

(85) 4. Heat up Agarose until it is liquefied.

(86) 5. Shake 20 min at RT.

(87) E. SDS-PAGE (Second Dimension)

(88) 1. Prepare left (pH 10 side) markers by adding 8 L of standards on Whatman 3MM chromatography paper cut to about 3 cm0.75 cm. Standards should be added to bottom of paper, about 1 cm high.

(89) 2. Prepare right (pH 3 side) markers by adding 8 L of standards on Whatman 3MM chromatography paper cut to approximately 3 cm0.0.75. Standards should be added to bottom of paper, about 1 cm high.

(90) 3. Pour off Equilibration Buffer.

(91) 4. Cover strips in SDS Running buffer to rinse away excess Equilibration Buffer

(92) 5. Remove SDS Running buffer from strips.

(93) 6. Repeat SDS Running buffer rinse.

(94) 7. Carefully place strips gel side out on back plate of SDS-PAGE gel.

(95) 8. Overlay strips with 1% low melting agarose once it has cooled enough to touch skin 1. Ensure no air bubbles have formed under the gel. 2. Use ruler to tap gel and remove air bubbles.

(96) 9. Insert marker's next to appropriate end of IEF strip, ensuring marker is flush to the gel on the strip.

(97) 10. Allow polymerization of agarose.

(98) 11. Continue for each strip to be loaded in 2nd dimension.

(99) 12. Place gels in Dodeca tank, HINGED SIDE DOWN

(100) 13. After all gels have been put in tank, ensure gels are covered in entirety by SDS running buffer.

(101) 14. 2nd dimension run is done at 13 C. 1. 250 V. 2. 1-1.5 hour (allow gel to run until gel front approaches tubing in lid of tank).

(102) F. Protein Transfer (for Western Blot)

(103) 1. Remove gel from Dodeca tank.

(104) 2. Cut gel to desired size.

(105) 3. Fill tray (large enough to fit gel) with transfer buffer.

(106) 4. Place sponges in transblot cell2 sponges per gel.

(107) 5. Fill tank with transfer buffer to allow sponges to saturate with transfer buffer.

(108) 6. Soak pre-cut transfer membrane.

(109) 7. Assemble transfer cassette as follows. 1. Black side down. 2. Sponge soaked in transfer buffer. 3. Filter paper. 4. Gel. 5. Nitrocellulose membraneonce placed on gel do not move membrane. 6. Filter Paper. 7. Sponge.

(110) 8. Ensure all air bubbles have been removed between gel and membrane.

(111) 9. Place tray in transblot tank, black side (gel side) of tray to black tank side.

(112) 10. Transfer at 4 C. and following conditions (transfer can be done in an ice bath if needed). 1. 90 V for 50 minutes. 2. Membrane can be left in tank overnight at 4 C. after transfer.

(113) G. Immunological Analysis for Western Blot Using scFv with S-Tag Linked to Alkaline Phosphatase or Alkaline Phosphatase Linked Anti S-Tag so as to Amplify Signal

(114) 1. Remove membrane from transfer.

(115) 2. Rinse membrane in 1% milk (enough to cover membrane) and block, 10 minutes, RT.

(116) 3. Prepare antibody solution (According to Titer instructions on Ab).

(117) 4. Remove blocking solution (save at 4 C.).

(118) 5. Place membrane into container with antibody solution.

(119) 6. Incubate at 4 C. overnight (usually 8-12 hours).

(120) H. Development of Western Blot and Scanning

(121) 1. Remove 1 antibody.

(122) 2. Wash membrane 4 times. 1. Cover membrane with TBST. 2. Gently shake at RT for 5 minutes.

(123) 3. Cover membrane with Western Blue.

(124) 4. Allow to develop until reference spots reach maximum intensity.

(125) 5. Stop develop by rinsing with di-H2O.

(126) 6. Dry membrane.

(127) 7. Scan membrane.

(128) Solutions Used for First Dimension

(129) I. Rehydration Buffer pH 7 (25 mL):

(130) TABLE-US-00005 Molar Mass Final Chemical Amount Added (g/mol) Value Urea 10.51 g 60.06 7M Thiourea 3.81 g 76.12 2M CHAPS 0.5 g 614.88 2% asb-14 0.125 g 434.68 0.5% 40% Ampholytes 330 L N/A 0.5% IPG Buffer 125 L N/A 0.5% ddi-H.sub.2O To 25 mL 18.02 N/A Bromophenol Blue 3 mg 669.96 0.012% Dissolve Urea in minimal ddi-H.sub.2O (do not heat over 30 C.) Dissolve Thiourea in Urea/ddi-H.sub.2O solution, and then add remaining chemicals. Q.S. with ddi-H.sub.2O to 25 mL and aliquot to 1 mL tubes and store at 80 C. Add 1% DTT - 10 mg (0.01 g) before use.

(131) Solutions Used for Second Dimension

(132) Tris Buffer (1.5 M, pH 8.8) (1 L):

(133) TABLE-US-00006 Amount Molar Mass Final Chemical Added (g/mol) Value Trizma 181.65 g 121.14 1.5M HCL pH to 8.8 36.46 N/A ddi-H.sub.2O To 1 L 18.02 N/A Dissolve Trizma in 750 mL ddi-H.sub.2O and adjust pH to 8.8 with HCl. Q.S. to final volume of 1 L with ddi-H.sub.2O and store at 4 C.

(134) Equilibration Buffer (400 mL):

(135) TABLE-US-00007 Molar Mass Final Chemical Amount Added (g/mol) Value Tris-Buffer 134 mL N/A 0.5M {1.5M, pH 8.8} Urea 144.14 g 60.06 6M Glycerol 120 mL (150 g) 92.09 30% SDS 10 g 288.38 2.5% ddi-H.sub.2O To 400 ml 18.02 N/A Bromophenol Trace amount 669.96 N/A Blue Q.S. to final volume of 4 L with ddi-H.sub.2O. Add Bromophenol Blue (add with pipette tip to give trace of blue). Aliquot to 15 mL tubes and store at 20 C.

(136) Acrylamide Gel (20 cm20 cm; 1-mm Thick)

(137) TABLE-US-00008 Tris Buffer 1.5M, 30% ddi- 10% # pH 8.8 Acrylamide H.sub.2O APS TEMED Gel % gels (mL) (mL) (mL) (mL) (mL) 10 6 100 133.33 166.67 4 0.4 8 125 166.67 208.33 5 0.5 10 150 200 250 6 0.6 12 175 233.33 291.67 7 0.7 Formulations for Protean II gels.

(138) 10% Alkaline Phosphatase Substrate (APS)

(139) TABLE-US-00009 Molar Mass Chemical Amount Added (g/mol) Final Value APS 2 g 228.18 10% ddi-H.sub.2O To 20 mL 18.02 N/A Q.S. to final volume of 20 mL with ddi-H.sub.2O.

(140) Agarose Solution (1%):

(141) TABLE-US-00010 Molar Mass Chemical Amount Added (g/mol) Final Value Agarose 1.5 g N/A 1% SDS-Running Buffer 150 mL N/A N/A Bromophenol Blue Trace Amount 669.96 N/A Combine agarose and SDS-Run Buffer. Microwave to heat and dissolve. Add Bromophenol Blue (add with pipette tip to give trace of blue).

(142) 10 SDS Running Buffer (4 L):

(143) TABLE-US-00011 Molar Mass Chemical Amount Added (g/mol) Final Value Trizma 121.2 g 121.14 0.25M Glyeine 576 g 75.07 1.92M SDS 40 g 288.38 1% ddi-H.sub.2O To 4 L 18.02 N/A Q.S. to final volume of 4 L with ddi-H.sub.2O.

(144) Solutions for Western Blot

(145) Western Transfer Buffer (4 L):

(146) TABLE-US-00012 Molar Mass Chemical Amount Added (g/mol) Final Value Trizma 121.2 g 121.14 0.025M Glyeine 576 g 75.07 0.192M Methanol 480 mL 32.04 0.12% SDS 3 g 288.38 .075% di-H.sub.2O To 4 L 18.02 N/A Q.S. to final volume of 4 L with di-H.sub.2O.

(147) Blocking Buffer (5% BSA)

(148) TABLE-US-00013 Molar Mass Chemical Mass (g/mol) Final Value BSA 5 g 66500 5% N.sub.3Na 0.2 g 65.01 0.2% TBST To 100 mL 18.02 N/A Q.S. to final volume of 100 mL with TBST.

(149) 10 Tris Buffered Saline with Tween-20 (TBST) (4 L)

(150) TABLE-US-00014 Molar Mass Chemical Amount Added (g/mol) Final Value Trizma 48.4 g 121.14 100 mM NaCl 350.6 g 58.44 1.5M Tween 20 20.6 g 1227.54 0.5% HCl pH to 7.5 36.46 N/A ddi-H.sub.2O To 4 L 18.02 N/A Add Trizma and NaCl to 3.5 L ddi-H.sub.2O. pH to 7.5 by HCl Add Tween 20. Q.S. to 4 L ddi-H.sub.2O.

Method 3

2-D Gel Electrophoresis Western Blot Early Detection Protocol

(151) Serum was prepared from 5 ml of blood collected by venipuncture (with tourniquet) in standard B & D 13100 (7 ml) vacutainer clot tubes (or equivalent) with or without hemoguard closure. After approximately 30 minutes at room temperature to allow for clotting, the clot was pelleted by centrifugation for 5 to 10 minutes at 2,500 to 3,000 rpm. Clot-free serum was decanted into a clean tube, labeled and analyzed fresh or stored frozen.

(152) For western blot analysis, 30 L of sera was added to 120 L of Rehydration Buffer (7M urea, 2 M thiourea, 2% (w/v) CHAPS [(3-[(3-cholamidopropyl)dimethylammonio]-1-propane-sulfonate), a nondenaturing zwitterionic detergent], 0.5% (w/v) ASB-14 (amidosulfobetaine-14, a zwitterionic detergent), 0.5% (v/v) ampholytes pH 3-10 (Bio-Rad), 0.5% (v/v) immobilized pH gradient (IPG) buffer pH 3-10 (Amersham-Pharmacia Biotech) and 65 mM dithiothreitol). The samples were quickly vortexed to mix sera with Rehydration Buffer. Four to six mg of protein were loaded for analysis. The samples were electrophoresed in the first dimension by using a commercial flatbed electrophoresis system (Ettan IPGphor 3, Amersham-Pharmacia Biotech) with IPG dry strips (Amersham). A linear pH range of 3 to 10 on 7 cm IPG strips was used. The IPG strips were rehydrated with the samples overnight at room temperature. The strips were then focused at 50 mA per strip and at increasing voltage of 250 V for 250 Vhrs, 500 V for 500 Vhrs, 1,000 V for 1,000 Vhrs and 4,000 V for 3 hours. The samples were then focused at a constant 4,000 V for 28,000 Volt-hours. After isoelectric focusing, the IPG strips were re-equilibrated for 20 minutes in 2.5% (w/v) SDS, 6 M urea, 30% (v/v) glycerol, 100 mM Tris-HCl (pH 8.8). The strips were placed onto linear SDS-PAGE gels (10% (w/v) polyacrylamide) and electrophoresed at a constant 250 V for 75 minutes. The samples were then transferred to nitrocellulose membranes by electroblotting using the Bio-Rad Trans-Blot Electrophoretic Transfer Cell. The membranes were blocked using milk protein (1% low fat dry milk) at room temperature for 10 minutes. Detection was with recombinant anti-ENOX2 single chain variable region of antibody (scFv) that was alkaline phosphatase-linked overnight at 4 C. After washing, detection was performed with Western Blue nitrotetrazolium (NBT) substrate (Promega, Madison, Wis.; Cat. No. 53841) at room temperature. Images were scanned and processed using Adobe Photoshop. Quantitation utilized an algorithm developed for this purpose. Reactive proteins appeared reddish blue. For interpretative purposes, the blots were divided into quadrants I-IV with unreactive serum albumin at the center (FIG. 7).

EXAMPLES

Example 1

(153) Two-fold increase in spot size and density of different amounts of ENOX2 in the assay as determined by 2-D gel electrophoresis/western blot analysis comparing incubation in the presence of 15 M NADH in the assay compared to no NADH (FIG. 1).

Example 2

(154) Analyses of sera from 1,626 cancer patients with confirmed diagnoses of cancer (Table 1, repeated from the Summary of the Invention) showing non-lapping patterns of number of transcript variants (protein 1 to protein 3), molecular weights and isoelectric points that distinguish 26 different cancers and 20 different tissues of origin.

(155) TABLE-US-00015 TABLE 1 repeated from the Summary of the Invention: Ranges for Molecular Weight (MW) and Isoelectric Point (Pi) Determined for Sera of Patients Diagnosed with 24 Different Cancers Representing 20 Different Tissues of Origin RANGES Protein 1 Protein 2 Protein 3 MW Pi MW Pi MW Pi Cancers N (kDa) (pH) (kDa) (pH) (kDa) (pH) Bladder 37 63-66 .sup.4.2-5.6.sup.1 42-48 .sup.4.1-4.8.sup.1 *Blood (117) 34-47 3.5-4.6 Cell (Total) Breast 682 64-69 4.2-4.9 Cervical 47 90-100 4.2-5.4 Colorectal 125 80-96 4.4-5.4 50-65 4.2-5.3 33-46 3.8-5.2 Esophageal 26 42-47 4.6-5.2 Gastric 26 120-188 4.7-5.5 50-62 4.5-5.6 45-53 2.4-3.6 Hepatocellular 31 58-70 4.5-5.0 34-40 4.1-5.2 Leukemias 36 34-45 3.5-4.5 *Lung, Non- 55 53 4.7-5.3 Small Cell **Lung, Non- 270 54-56 4.6-5.3 Small Cell Lung, Small 27 52-53 4.1-4.6 Cell Lymphomas 56 43-45 3.5-4.5 Melanoma 51 37-41 4.6-5.3 Mesothclioma 27 60-68 3.8-4.1 38-44 3.8-4.6 Myelomas 25 40-45 3.9-4.6 Ovarian 115 72-90 3.7-5.0 37-47 3.7-5.0 Pancreatic 75 48-51 3.9-5.4 Prostate 361 71-88 5.1-6.5 Renal Cell 31 69-73 4.7-5.4 54-61 4.1-5.2 38-43 3.7-4.3 (Kidney) Sarcoma 29 50-55 5.2-5.6 37-45 4.3-4.9 Squamous 51 57-68 5.0-5.4 Cell Testicular 25 61-62 5.0-5.4 40-45 4.4-4.7 Germ Cell Thyroid 25 48-56 4.7-5.1 37-42 4.5-5.2 Follicular Thyroid 27 56-67 4.5-5.0 37-44 3.2-3.6 Papillary ***Uterine 26 63-66 .sup.4.2-4.9.sup.2 41-48 .sup.4.4-5.6.sup.2 (Endometrial) **Uterine 57 67-71 4.2-5.1 41-48 3.7-5.4 (Endometrial) Total 2460 *Blood cell cancers include lymphomas, leukemias and myelomas already represented in the totals. **Non-Small Cell Lung cancers are in two subsets to avoid molecular weight overlap with small cell lung cancer. ***Uterine cancers are in two subsets based on molecular weight to avoid overlap with bladder cancer (see footnotes 1 and 2). 1. Isoelectric point pH of Protein 1 Protein 2. 2. Isoelectric point pH of Protein 1 < Protein 2.

Example 3

(156) The ONCOblot test correctly identified cancers as to tissue of origin with both state 0 and Stage I cancers (Table 3). Often referred to as cancer in situ, with stage 0 and stage I cancers, the disease has not spread beyond the tissue of origin. Thus, the ONCOblot Cancer Test signals cancer earlier than Circulating Tumor Cell tests that detect only cancer cells in the blood.

(157) TABLE-US-00016 TABLE 3 The tissue of origin stage 0 and stage I cancers analyzed Stage 0 Cancers n Stage I Cancers n Bladder 2 Bladder 1 Blood Cell 3 Blood Cell 1 Breast 6 Breast 16 Cervix 3 Colorectal 5 Hepatocellular (Ampullary) 1 Lung 1 Lung 1 Melanoma 1 Renal Cell 2 Squamous Cell (Vulvar) 2 Uterine 1

Example 4

(158) A 64 year old male was followed longitudinally for 16 years by using archived serum samples. The starting PSA was 0.8 ng/mL. No clinical symptoms were recorded until year 16 when prostate cancer was confirmed by biopsy. ENOX2 was first detected in year 8 with a PSA of 4 ng/ml 8 years in advance of clinical symptoms.

Example 5

(159) Malignant mesothelioma is an aggressive, almost uniformly fatal cancer caused primarily by exposure to asbestos. Sequential serum samples collected from asbestos-exposed individuals prior to the development of frank mesothelioma were assayed for ENOX2 presence by 2-D gel-immunoblot analysis to determine how long in advance of clinical symptoms mesothelioma-specific transcript variants could be detected. Two mesothelioma-specific transcript variants were detected in the sera of asbestos-exposed individuals 4 to 10 years prior to clinical diagnosis of malignant mesothelioma (average 6.2 years). Either one or both ENOX2 protein transcript variants indicative of malignant mesothelioma were absent in 14 of 15 subjects diagnosed with benign pleural plaques either with or without accompanying asbestosis.

Example 6

(160) Analysis of patient sera with cancer of unknown primary (CUP). The 2-D gel from a patient with cancer where the primary tumor was unknown revealed the presence of 80 and 42.5 kDa, both with transcript variants of isoelectric points of pH 4.2 and 4.1 to indicate that the primary cancer was ovarian cancer, which was confirmed later by biopsy.

Example 7

(161) Successful validation and quantitation of ENOX2 presence in 1,587 ONCOblot analyses comparing 20 different tissues of origin (Table 1).

Example 8

(162) Early detection of cancer in a healthy population of young adults in advance of clinical symptoms. Seta from 100 subjects (50 male and 50 female) between the ages of 20 and 39 years were analyzed for ENOX2 presence by the technology described herein. In the age group 20-29 years, none of the 25 females and only one (colorectal) of the 25 males exhibited ENOX2 proteins indicative of cancer presence. Similarly, in the age group 30-39 years, one (blood cell) of the 25 females and one (prostate) of the 25 males exhibited ENOX2 proteins. Therefore, the overall incidence of ENOX2 presence within all 100 serum samples was 3%. The overall incidence of newly diagnoses cancers within a population of men and women between 20 and 29 years old is approximately 2% (Howlander et al. SEER Cancer Statistics Review, 1975-2012, Nation Cancer Institute, Bethesda, Md.).

Method 4

Generation of Functionalized Recombinant Antibody with Protein Disulfide-Thiol Interchange Functional Motif Represented in Linker

(163) To further enhance the affinity and specificity of the binding of the recombinant antibody to ENOX2 on western blots a linker was designed to specifically mimic the protein disulfide-thiol interchange functional motif of the ENOX2 family of proteins.

(164) Monoclonal antibody generated against ENOX2 NADH oxidase tumor cell specific was produced in sp-2 myeloma cells; however, the monoclonal antibody slowed the growth of sp-2 myeloma cells that were used for fusion with spleen cells after 72 hours. This phenomenon made it difficult to produce antibody in quantity. To overcome this problem, the coding sequences of the antigen-binding variable region of the heavy chain and the light chain (Fv region) of the antibody cDNA were cloned and linked into one chimeric gene, upstream of the S-tag coding sequence. The Fv portion of an antibody, consisting of variable heavy (VH) and variable light (VL) domains, can maintain the binding specificity and affinity of the original antibody (Glockshuber et al. 1900. Biochemistry 29:1262-1367).

(165) For a recombinant antibody, cDNAs encoding the variable regions of immunoglobulin heavy chain (VH) and light chain (VI), were cloned using degenerative primers. Mammalian immunoglobulins of light and heavy chain contain conserved regions adjacent to the hypervariable complementary defining regions (CDRs). Degenerate oligoprimer sets allow these regions to be amplified using PCR (Jones et al. 1991. Bio/Technology 9:88-89; Daugherty et al. 1991. Nucleic Acids Research 19:2471-2476). Recombinant DNA techniques have facilitated the stabilization of variable fragments by covalently linking the two fragments by a polypeptide linker (Huston et al. 1988. Proc. Natl. Acad. Sci. USA 85:5879-5883). Either VL or VH can provide the NH2-terminal domain of the single chain variable fragment (scFv). The linker should be designed to resist proteolysis and to minimize protein aggregation. Linker length and sequences contribute and control flexibility and interaction with scFv and antigen. The preferred linker was uniquely comprised as a functional linker between heavy and light chain portions of the ScFv fusion protein comprised primarily of amino acids with small side chains (Gly/Ser) containing, in addition, two cysteine residues (C) spaced as either CXXXXC or CXXXXXC; that forms interchain disulfide bonds with the protein disulfide-thiol interchange functional motif of ENOX2.

(166) Total RNA was isolated from the hybridoma cells producing ENOX2-specific monoclonal antibodies by the following procedure modified from Chomczynski et al. (1987) Anal. Biochem. 162:156-159 and Gough (1988) Anal. Biochem 176:93-95. Cells were harvested from medium and pelleted by centrifugation at 450 g for 10 minutes. Pellets were gently resuspended with 10 volumes of ice cold PBS and centrifuged again. The supernatant was discarded and cells were resuspended with an equal volume of PBS. Denaturing solution (0.36 ml of 2-mercaptoethanol/50 ml of guanidinium stock solution-4M guanidinium thiocyanate, 25 mM sodium citrate, pH 7.0, 0.5% sarkosyl) 10 ml per 1 g of cell pellet was added prior to use and mixed gently. Sodium acetate (pH 4.0, 1 ml of 2M), 10 ml of phenol saturated water and 2 ml of chloroform:isoamyl alcohol (24:1) mixtures were sequentially added after each addition. The solution was mixed thoroughly by inversion. The solution was vigorously shaken for 10 seconds, chilled on ice for 15 minutes and then centrifuged 12,000 g for 30 minutes. The supernatant was transferred and an equal volume of 2-propanol was added and placed at 20 C. overnight to precipitate the RNA. The RNA was pelleted for 15 minutes at 12,000 g, and the pellet was resuspended with 2-3 ml of denaturing solution and 2 volumes of ethanol. The solution was placed at 20 C. for 2 hours, and then centrifuged at 12,000 g for 15 minutes. The RNA pellet was washed with 70% ethanol and then 100% ethanol. The pellet was resuspended with RNase-free water (DEPC-treated water) alter centrifugation at 12,000 g tor 5 minutes. The amount of isolated RNA was measured spectrophotometrically and calculated from the absorbance at 280 nm and 260 nm.

(167) A poly(A)mRNA isolation kit was purchased from Stratagene. Total RNA was applied to an oligo(dT) cellulose column after heating the total RNA at 65 C. for 5 minutes. Before applying, the RNA samples were mixed with 500 L of 10 sample butter (10 mM Tris-HCl, pH 7.5, 1 mM EDTA, 5 M NaCl). The RNA samples were pushed through the column at a rate of 1 drop every 2 seconds. The eluates were pooled and reapplied to the column and purified again. Preheated elution buffer (65 C.) was applied, and mRNA was eluted and collected in 1.5 ml of centrifuge tubes on ice. The amount of mRNA was determined at OD260 (1 OD unit=40 g of RNA). The amounts of total RNA and mRNA obtained from 410 e 8 cells were 1328 g and 28 g, respectively.

(168) Next, mRNA (1-2 g) dissolved in DEPC-treated water was used for cDNA synthesis. mRNA isolated on three different dates was pooled for first-strand cDNA synthesis. The cDNA synthesis kit was purchased from Pharmacia Biotech. The mRNA (1.5 g/5 L of DEPC-treated water) was heated at 65 C. for 10 minutes and cooled immediately on ice. The primed first strand mix containing Murine Leukemia Virus (MuLV) reverse transcriptase (11 L) and appropriate buffers for the reaction were mixed with the mRNA sample. DTT solution (1 L of 0.1 M) and RNase-free water (16 L) also were added to the solution. The mixture was incubated for 1 hour at 37 C.

(169) Degenerate primers for light chain and heavy chain (Novagen, Madison, Wis.) were used for PCR. PCR synthesis was carried out in 100 L reaction volumes in 0.5 ml microcentrifuge tubes by using Robocycler (Stratagene, La Jolla, Calif.). All PCR syntheses included 2 L of sense and anti-sense primers (20 picomoles/L), 1 L of first-strand cDNA as a template. 2 L of 10 mM of dNTPs, 1 l of Vent polymerase (2 units/L), 10 L of 10 PCR buffer (100 mM Tris-HCl, pH 8.8 at 25 C., 500 mM KCl, 15 mM MgCl2, 1% Triton X-100), 82 L of H2O. Triton X-100 is t-octylphenoxypolyethoxyethanol. All PCR profiles consisted of 1 min of denaturation at 94 C., 1 minute of annealing at 55 C., and 1 minute of extension at 72 C. This sequence was repeated 30 times with a 6-minute extension at 72 C. in the final cycle. PCR products were purified with QIAEX II gel extraction kit from Qiagen, Valencia, Calif. PCR amplification products for heavy and light chain coding sequences were analyzed by agarose gel electrophoresis and were about 340 base pair (bp) long and 325 bp long, respectively.

(170) Total RNA or DNA was analyzed by agarose gel electrophoresis (1% agarose gels). Agarose (0.5 g in 50 ml of Tris-acetate-EDTA (TAE) buffer, 40 mM Tris-acetate, 1 mM EDTA) was heated for 2 minutes in a microwave to melt and evenly disperse the agarose. The solution was cooled at room temperature, and ethidium bromide (0.5 g/ml) was added and poured into the apparatus. Each sample was mixed with 6 gel loading buffer (0.25% bromophenol blue, 0.25% xylene cyanol FF, 40% (w/v) sucrose in water). TAE buffer was used as the running buffer. Voltage (10 v/cm) was applied for 60-90 minutes.

(171) According to the proper size for heavy and light chain cDNAs, the bands were excised from the gels under UV illumination, and excised gels were placed in 1 ml syringes fitted with 18-gauge needles. Gels were crushed to a 1.5 ml Eppendorf tube. The barrel of each syringe was washed with 200 L buffer-saturated phenol (pH 7.90.2). The mixture was thoroughly centrifuged and frozen at 70 C. for 10 minutes. The mixture was centrifuged for 5 minutes, and the top aqueous phase was transferred to a new tube. The aqueous phase was extracted again with phenol/chloroform (1:1). After centrifuging for 5 minutes, the top aqueous phase was transferred to a clean tube, and chloroform extraction was performed. Sodium acetate (10 volumes of 3 M) and 2.5 volumes of ice-cold ethanol were added to the top aqueous phase to precipitate DNA at 20 C. overnight.

(172) Purified heavy and light chain cDNAs were ligated into plasmid pSTBlue-1 vector and transfected into NovaBlue competent cells (Stratagene). Colonies containing heavy and light chain DNAs were screened by blue and white colony selection and confirmed by PCR analysis. Heavy and light chain DNAs were isolated and sequenced using standard techniques.

(173) PCR amplification and the assembly of single scFv gene was according to Davis et al. (1991) Bio/Technology 9:165-169. Plasmid pSTBlue-1 carrying VH and VL genes were combined with all four oligonucleotide primers in a single PCR synthesis. Following first PCR synthesis, one tenth of the first PCR product was removed and added to a second PCR reaction mixture containing only the primer a (VH sense primer) and primer d (VL Antisense primer). The product of the second PCR synthesis yielded single scFv gene. The single scFv gene was ligated to plasmid pT-Adv (Clontech, Palo Alto, Calif.). pT-Adv carrying scFv gene was used for DNA sequencing.

(174) The complete functionalized scFv gene was assembled from the VH, VL and linker sequences to yield an scFv cDNA with a high degree of efficacy and sensitivity.

(175) Total RNA or DNA was analyzed by agarose gel electrophoresis (1% agarose gels). Agarose (0.5 g in 50 ml of TAE buffer, 40 mM Tris-acetate, 1 mM EDTA) was heated for 2 minutes in a microwave to melt and evenly disperse the agarose. The solution was cooled at room temperature, and ethidium bromide (0.5 g/ml) was added and poured into the apparatus. Each sample was mixed with 6 gel loading buffer (0.25% bromophenol blue, 0.25% xylene cyanol FF, 40% (w/v) sucrose in water). TAE buffer was used as the running buffer. Voltage (10 v/cm) was applied for 60-90 minutes.

(176) According to the proper size for heavy and light chain cDNAs, the bands were excised from the gels under UV illumination, and excised gels were placed in 1 ml syringes fitted with 18-gauge needles. Gels were crushed to a 1.5 ml Eppendorf tube. The barrel of each syringe was washed with 200 L of buffer-saturated phenol (pH 7.9.+/.0.2). The mixture was thoroughly centrifugal and frozen at 70 C. for 10 minutes. The mixture was centrifuged for 5 minutes, and the top aqueous phase was transferred to a new tube. The aqueous phase was extracted again with phenol/chloroform (1:1). After centrifuging for 5 minutes, the top aqueous phase was transferred to a clean tube, and chloroform extraction was performed. Sodium acetate (10 volumes of 3 M) and 2.5 volumes of ice-cold ethanol were added to the top aqueous phase to precipitate DNA at 20 C. overnight.

(177) Purified heavy and light chain cDNAs were ligated into plasmid pSTBlue-1 vector and transfected into NovaBlue competent cells (Stratagene). Colonies containing heavy and light chain DNAs were screened by blue and white colony selection and confirmed by PCR analysis. Heavy and light chain DNAs were isolated and sequenced using standard techniques.

(178) PCR amplification and the assembly of single scFv gene was according to Davis et al. (1991) Bio/Technology 9:165-169. Plasmid pSTBlue-1 carrying VH and VL genes were combined with all four oligonucleotide primers in a single PCR synthesis. Following first PCR synthesis, one tenth of the first PCR product was removed and added to a second PCR reaction mixture containing only the primer a (VH sense primer) and primer d (VL Antisense primer). The product of the second PCR synthesis yielded single scFv gene. The single scFv gene was ligated to plasmid pT-Adv (Clontech, Palo Alto. Calif.). pT-Adv carrying scFv gene was used tor DNA sequencing.

(179) The complete functionalized scFv gene was assembled from the VH, VL and linker sequences to yield a scFv cDNA by PCR as follows:

(180) DNA and Amino Acid Sequence of scFv(S)(GST) with Gly.Ser.Cys Linker [scFv(SC)]

(181) TABLE-US-00017 LinkerSequence DNA: SEQIDNO:4 5 GGCGGGGGTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTG GCAGT3. Aminoacid: SEQIDNO:5 GlyGlyGlyGlySerCytGlyGlyGlySerCytGlyGlyGlySer.

(182) DNA and Amino Acid Sequence of scFv(GST)

(183) TABLE-US-00018 GST-tag SEQIDNO:6 1 ATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCAC 51 TCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATG 101 AGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTG 151 GAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACA 201 GTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTG 251 GTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTG 301 GATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAAC 351 TCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCG 401 AAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCAT 451 CCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCC 501 AATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTG 551 AAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCA 601 TGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCC 651 AAAATCGGATCTGGTTCCGCGTGGATCCCCAGGAATTCCC

(184) TABLE-US-00019 scFvheavychain(VH) SEQIDNO:7 691 GAGGTCAAGCTGCAGGAGTCAGGAACTGAAGTGGTAAAGCCTGGGGCTTC 741 AGTGAAGTTGTCCTGCAAGGCTTCTGGCTACATCTTCACAAGTTATGATA 791 TAGACTGGGTGAGGCAGACGCCTGAACAGGGACTTGAGTGGATTGGATGG 841 ATTTTTCCTGGAGAGGGGAGTACTGAATACAATGAGAAGTTCAAGGGCAG 891 GGCCACACTGAGTGTAGACAAGTCCTCCAGCACAGCCTATATGGAGCTCA 941 CTAGGCTGACATCTGAGGACTCTGCTGTCTATTTCTGTGCTAGAGGGGAC 991 TACTATAGGCGCTACTTTGACTTGTGGGGCCAAGGGACCACGGTCACCGT 1041 CTCCTCA

(185) TABLE-US-00020 LinkerSequence DNA: SEQIDNO:4 5 GGCGGGGGTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTG GCAGT3. Aminoacid: SEQIDNO:5 GlyGlyGlyGlySerCytGlyGlyGlySerCytGlyGlyGlySer.

(186) TABLE-US-00021 scFvlightchain(VL) SEQIDNO:8 1093 GAAAATGTGCTCACCCAGTCTCCAGCAATCATGTCTGCATCTCCAGGGGA 1143 GAGGGTCACCATGACCTGCAGTGCCAGCTCAAGTATACGTTACATATATT 1193 GGTACCAACAGAAGCCTGGATCCTCCCCCAGACTCCTGATTTATGACACA 1243 TCCAACGTGGCTCCTGGAGTCCCTTTTCGCTTCAGTGGCAGTGGGTCTGG 1293 GACCTCTTATTCTCTCACAATCAACCGAATGGAGGCTGAGGATGCTGCCA 1343 CTTATTACTGCCAGGAGTGGAGTGGTTATCCGTACACGTTCGGAGGGGGG 1393 ACCAAGCTGGAGCTGAAAGCG

(187) TABLE-US-00022 DNAsequenceofscFv(SC)withGSTtag SEQIDNO:9 1 ATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCAC 51 TCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATG 101 AGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTG 151 GAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACA 201 GTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTG 251 GTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTG 301 GATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAAC 351 TCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCG 401 AAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCAT 451 CCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCC 501 AATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTG 551 AAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCA 601 TGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCC 651 AAAATCGGATCTGGTTCCGCGTGGATCCCCAGGAATTCCCGAGGTCAAGC 701 TGCAGGAGTCAGGAACTGAAGTGGTAAAGCCTGGGGCTTCAGTGAAGTTG 751 TCCTGCAAGGCTTCTGGCTACATCTTCACAAGTTATGATATAGACTGGGT 801 GAGGCAGACGCCTGAACAGGGACTTGAGTGGATTGGATGGATTTTTCCTG 851 GAGAGGGGAGTACTGAATACAATGAGAAGTTCAAGGGCAGGGCCACACTG 901 AGTGTAGACAAGTCCTCCAGCACAGCCTATATGGAGCTCACTAGGCTGAC 951 ATCTGAGGACTCTGCTGTCTATTTCTGTGCTAGAGGGGACTACTATAGGC 1001 GCTACTTTGACTTGTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGC 1051 GGGGGTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTGGCAGTGAAAATGT 1101 GCTCACCCAGTCTCCAGCAATCATGTCTGCATCTCCAGGGGAGAGGGTCA 1151 CCATGACCTGCAGTGCCAGCTCAAGTATACGTTACATATATTGGTACCAA 1201 CAGAAGCCTGGATCCTCCCCCAGACTCCTGATTTATGACACATCCAACGT 1251 GGCTCCTGGAGTCCCTTTTCGCTTCAGTGGCAGTGGGTCTGGGACCTCTT 1301 ATTCTCTCACAATCAACCGAATGGAGGCTGAGGATGCTGCCACTTATTAC 1351 TGCCAGGAGTGGAGTGGTTATCCGTACACGTTCGGAGGGGGGACCAAGCT 1401 GGAGCTGAAAGCG

(188) Translation of scFv(S)(GST) with Gly.Ser.Cys Linker DNA Sequence SEQ ID NO:10 and Amino Acid Sequence SEQ ID NO:11:

(189) TABLE-US-00023 1 atgtcccctatactaggttattggaaaattaagggccttgtgcaacccactcgacttctt 1 MSPILGYWKIKGLVQPTRLL 61 ttggaatatcttgaagaaaaatatgaagagcatttgtatgagcgcgatgaaggtgataaa 21 LEYLEEKYEEHLYERDEGDK 121 tggcgaaacaaaaagtttgaattgggtttggagtttcccaatcttccttattatattgat 41 WRNKKFELGLEFPNLPYYID 181 ggtgatgttaaattaacacagtctatggccatcatacgttatatagctgacaagcacaac 61 GDVKLTQSMAIIRYIADKHN 241 atgttgggtggttgtccaaaagagcgtgcagagatttcaatgcttgaaggagcggttttg 81 MLGGCPKERAEISMLEGAVL 301 gatattagatacggtgtttcgagaattgcatatagtaaagactttgaaactctcaaagtt 101 DIRYGVSRIAYSKDFETLKV 361 gattttcttagcaagctacctgaaatgctgaaaatgttcgaagatcgtttatgtcataaa 121 DFLSKLPEMLKMFEDRLCHK 421 acatatttaaatggtgatcatgtaacccatcctgacttcatgttgtatgacgctcttgat 141 TYLNGDHVTHPDFMLYDALD 481 gttgttttatacatggacccaatgtgcctggatgcgttcccaaaattagtttgttttaaa 161 VVLYMDPMCLDAFPKLVCFK 541 aaacgtattgaagctatcccacaaattgataagtacttgaaatccagcaagtataragca 181 KRIEAIPQIDKYLKSSKYIA 601 tggcctttgcagggctggcaagccacgtttggtggtggcgaccatcctccaaaatcggat 201 WPLQGWQATFGGGDHPPKSD 661 ctggttccgcgtggatccccaggaattcccgaggtcaagctgcaggagtcaggaactgaa 221 LVPRGSPGIPEVKLQESGTE 721 gtggtaaagcctggggcttcagtgaagttgtcctgcaaggcttctggctacatcttcaca 241 VVKPGASVKLSCKASGYIFT 781 agttatgatatagactgggtgaggcagacgcctgaacagggacttgagtggattggatgg 261 SYDIDWVRQTPEQGLEWIGW 841 atttttcctggagaggggagtactgaatacaatgagaagttcaagggcagggccacactg 281 IFPGEGSTEYNEKFKGRATL 901 agtgtagacaagtcctccagcacagcctatatggagctcactaggctgacatctgaggac 301 SVDKSSSTAYMELTRLTSED 961 tctgctgtctatttctgtgctagaggggactactataggcgctactttgacttgtggggc 321 SAVYFCARGDYYRRYFDLWG 1021 caagggaccacggtcaccgtctcctcaggcgggggtggtagctgcggcggtggatcgtgt 341 QGTTVTVSSGGGGSCGGGSC 1081 ggcggtggcagtgaaaatgtgctcacccagtctccagcaatcatgtctgcatctccaggg 361 GGGSENVLTQSPAIMSASPG 1141 gagagggtcaccatgacctgcagtgccagctcaagtatacgttacatatattggtaccaa 381 ERVTMTCSASSSIRYIYWYQ 1201 cagaagcctggatcctcccccagactcctgatttatgacacatccaacgtggctcctgga 401 QKPGSSPRLLIYDTSNVAPG 1261 gtcccttttcgcttcagtggcagtgggtctgggacctcttattctctcacaatcaaccga 421 VPFRFSGSGSGTSYSLTINR 1321 atggaggctgaggatgctgccacttattactgccaggagtggagtggttatccgtacacg 441 MEAEDAATYYCQEWSGYPYT 1381 ttcggaggggggaccaagctggagctgaaagcg 461 FGGGTKLELKA

(190) Translated Protein Sequence:

(191) TABLE-US-00024 SEQIDNO:11 1 MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID 61 GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKV 121 DFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFK 181 KRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPGIPEVKLQESGTE 241 VVKPGASVKLSCKASGYIFTSYDIDWVRQTPEQGLEWIGWIFPGEGSTEYNEKFKGRATL 301 SVDKSSSTAYMELTRLTSEDSAVYFCARGDYYRRYFDLWGQGTTVTVSSGGGGSCGGGSC linker 361 GGGSENVLTQSPAIMSASPGERVTMTCSASSSIRYIYWYQQKPGSSPRLLIYDTSNVAPG 421 VPFRFSGSGSGTSYSLTINRMEAEDAATYYCQEWSGYPYTFGGGTKLELKA

(192) Analysis of Protein Sequence:

(193) Length in amino acids: 477

(194) Molecular weight in kD: 53.52

(195) Iso-electric point (IP): 5.87

(196) Molar absorption coefficient (in L/mol/cm); all cysteine residues as disulfide bonds: 1.02E+05

(197) Molar absorption coefficient (in L/mol/cm); 50 percent of cysteine residues as disulfide bonds: 1.02E+05

(198) Molar absorption coefficient (in L/mol/cm); no disulfide bonds: 1.01E+05

(199) TABLE-US-00025 1.Primerdesign LinkerwithGly.Ser.Cys Aminoacidsequence: SEQIDNO:5 GlyGlyGlyGlySerCytGlyGlyGlySerCytGlyGlyGlySer DNAsequence: SEQIDNO:4 5-GGCGGGGGTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTG GCAGT-3

(200) Design for Primers

(201) TABLE-US-00026 1.ForwardprimerforscFv(S)heavychainforPCRamplification scFv(S)heavychainN-terminus(primer15) SEQIDNO:12 5 GGATCCCCAGGAATTCCCGAGGTCAAGCTGCAGGAGTCAGGA3 EcoRI

(202) TABLE-US-00027 2.ReverseprimerforscFv(S)heavychainforPCRamplification scFv(S)heavychainC-terminuspluslinker1 Aminoacidseq:GTTVTVSSSEQIDNO:13 heavychinC-terminus GGGGSCGGGSCGGGSSEQIDNO:14 linker 1GGGACCACGGTCACCGTCTCCTCAGGCGGGGGTGGTAGCTGCGGCGGTGG 51ATCGTGTGGCGGTGGCAGTSEQIDNO:15 1GGGACCACGGTCACCGTCTCCTCAGGCGGGGGTGGTAGCTGCGGCGGTGGATCGTGTGGC 1GTTVTVSSGGGGSCGGGSCG 61GGTGGCAGT 21GGSSEQIDNO:16

(203) TABLE-US-00028 ReverseprimerforscFv(S)heavychainforPCR amplification(primer18): SEQIDNO:17 5ACCGCCACACGATCCACCGCCGCAGCTACCACCCCC GCCTGAGGAGACGGTGACCGTGGTCCC3

(204) TABLE-US-00029 3.ForwardprimerforscFv(S)lightchainPCRamplification LinkerplusscFv(S)lightN-terminusSEQIDNO:18 Aminoacidseq:GGSCGGGSCGGGSENVLTQSP LinkerlightchainN-terminus 1 GGTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTGGCAGTGAAAATGTGCTCACCCAGTCT 1GGSCGGGSCGGGSENVLTQS 61CCASEQIDNO:19 21PSEQIDNO:20

(205) TABLE-US-00030 ForwardprimerforscFv(S)lightchainforPCR amplification(primer19): SEQIDNO:21 5 GGTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTGGC AGTGAAAATGTGCTCACCCAGTCTCCA3

(206) TABLE-US-00031 4.ReverseprimerforscFv(S)lightchainforPCR amplification(primer17) SenseDNAseq: SEQIDNO:22 5 GAACGCCAGCACATGGACAGCTGACTCGAGCGGCCGGTG3 AntisenseDNAseq: SEQIDNO:23 5 CACCGGCCGCTCGAGTCAGCTGTCCATGTGCTGGCGTTC3 XhoI

(207) Primers were ordered from Integrated DNA Technologies (Coralville, Iowa). PCR amplification of heavy chain (V.sub.H) and light chain (V.sub.L) of scFv(SC). Heavy chain and light chain of scFv(SC) were amplified by polymerase chain reaction (PCR).

(208) Conditions for PCR were:

(209) TABLE-US-00032 1) PCR of heavy chain 2) PCR of light chain 10 x pfu DNA polymerase 5 l 10 x pfu DNA polymerase 5 l buffer buffer dNTP mix 1 l dNTP mix 1 l Forward primer 1 l Forward primer 1 l (Primer 15) (Primer 19) Reverse primer 1 l Reverse primer 1 l (Primer 18) (Primer 17) pGEX4T-scFv(SE) 0.2 l pGEX4T-scFv(SE) 0.2 l pfu DNA polymerase 0.25 l pfu DNA polymerase 0.25 l Taq DNA polymerase 0.2 l Taq DNA polymerase 0.2 l (10x diluted) (10x diluted) Water 41.35 l Total 50 l Total 50 l

(210) TABLE-US-00033 PCR cycle 94 C. 3 minutes 1 cycle 94 C. 30 seconds 30 cycles 64 C. 30 seconds 72 C. 2 minutes 72 C. 10 minutes 1 cycle

(211) Heavy and light chain DNAs of scFv(SC) was analyzed by agarose gel electrophoresis (0.9%). DNA bands were excised, frozen, thawed and centrifuged. scFv(SC) DNA was amplified by extending heavy chain and light chain DNAs by PCR.

(212) Conditions for PCR were:

(213) TABLE-US-00034 10 x pfu DNA polymerase 10 l buffer dNTP mix 2 l Forward primer 2 l 94 C. 3 minutes 1 cycle (Primer 15) Reverse primer 2 l (Primer 17) Heavy chain DNA 5 l 94 C. 30 seconds Light chain DNA 5 l 64 C. 30 seconds {close oversize brace} 30 cycles pfu DNA polymerase 0.5 l 72 C. 2 minutes Taq DNA polymerase 0.1 l 72 C. 10 minutes 1 cycle (10x diluted) Water 74.4 l Total 100 l

(214) The amplified scFv(SC) DNA was analyzed by agarose gel electrophoresis (0.9%). DNA bands were excised, purified by QIAquick Gel Extraction Kit (QIAGEN) and solubilized in 30 l of TE buffer.

(215) TABLE-US-00035 1) Digestion with EcoRI Digestion was 2 hr at 37 C. 10 x NE4 buffer 5 l Enzyme was heat inactivated at 65 C. scFv(SC) 25 l 15 minutes. EcoRI HF (20 Units) 1 l DBNA was precipitated by ethanol Water 19 l precipitation 50 l 2) Digestion with Xhol Digestion was 1 hr 24 min at 37 C. 10 x React 2 buffer 5 l Solution was heated at 65 C. 20 min. scFv(SC) 44 l DBNA was precipitated by ethanol Xhol (10 Units) 1 l precipitation. 50 l DNA was purified by agarose gel electrophoresis (0.9%) and purified. Concentration was 26.4 ng/l in 30 l of TE buffer.

(216) Ligation of scFv(SC) to pGEX-4T2 [pGEX4T-scFv(SC)]. scFv(SC) was ligated to pGEXT-4T2. The ligation reaction was as follows:

(217) TABLE-US-00036 Digestion with EcoRI 10 x T4 DNA ligase buffer 2 l pGEX-4T2 digested with EcoRI and Xhol (200 ng) 1.13 l scFv(SC) digested with EcoRI and Xhol (100 ng) 25 l T4 DNA ligase 1.5 l Water 11.5 l 20 l

(218) Ligation was 16 hours 50 minutes at 15 C. After ligation, E. coli BL21 (DE3) cells were transformed with pGEX4T-scFv(SC) and plated on LB/ampicillin plate. Cells were grown 37 C. for 20 hours. Screening of colonies for carrying pGEX4T-scFv(SC). Seven colonies were screened for carrying plasmid pGEX4T-scFv(SC) by PCR.

(219) TABLE-US-00037 5 x Green GoTaq DNA 30 l polymerase buffer 25 mM MgCl.sub.2 15 l dNTP mix 3 l 94 C. 2 min. 1 cycle Forward primer (Primer 15) 3 l Reverse primer (Primer 18) 3 l 94 C. 30 sec Heavy chain DNA 5 l 64 C. 30 sec {close oversize brace} 30 cycles Colony DNA 35 l 72 C. 45 sec Taq DNA polymerase 1.5 l 72 C. 10 min 1 cycle Water 59.5 l Total 150 l Reaction volume was 20 l per colony.

(220) Cells were picked from colony 1, grown in 100 ml of LB/ampicillin media and plasmid was purified using plasmid purification kit (Plasmid Midi Kit, Qiagen). scFv(SC) DNA sequence was performed by Pudue University. The sequenced DNA was analyzed by Alignment algorithm (NCBI) and showed no mutation.

(221) TABLE-US-00038 SequencedscFv(SC)DNAwithprimers15and17 >L_132420_Primer15_025.ab1146421860ABI SEQIDNO:24 AAAAAACAATGCAAAGTGGTAAAAGCCTGGGGCTTCAGTGAAGTTGTCCT GCAAGGCTTCTGGCTACATCTTCACAAGTTATGATATAGACTGGGTGAGG CAGACGCCTGAACAGGGACTTGAGTGGATTGGATGGATTTTTCCTGGAGA GGGGAGTACTGAATACAATGAGAAGTTCAAGGGCAGGGCCACACTGAGTG TAGACAAGTCCTCCAGCACAGCCTATATGGAGCTCACTAGGCTGACATCT GAGGACTCTGCTGTCTATTTCTGTGCTAGAGGGGACTACTACAGGCGCTA CTTTGACTTGTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAGGCGGGG GTGGTAGCTGCGGCGGTGGATCGTGTGGCGGTGGCAGTGAAAATGTGCTC ACCCAGTCTCCAGCAATCATGTCTGCATCTCCAGGGGAGAGGGTCACCAT GACCTGCAGTGCCAGCTCAAGTATACGTTACATATATTGGTACCAACAGA AGCCTGGATCCTCCCCCAGACTCCTGATTTATGACACATCCAACGTGGCT CCTGGAGTCCCTTTTCGCTTCAGTGGCAGTGGGTCTGGGACCTCTTATTC TCTCACAATCAACCGAATGGAGGCTGAGGATGCTGCCACTTATTACTGCC AGGAGTGGAGTGGTTATCCGTACACGTTCGGAGGGGGGACCAAGCTGGAG CTGAAAGCGAAAGAAACTGCTGCTGCTAAATTCGAACGCCAGCACATGGA CAGCTGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGC GTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACG GTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGG CGCGTCAGCGGGTGTTGGCGGGTGTCCGGGCCCCGCCATGACCCAGTCAC GTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGAAT CGCCTATTTTTATAGGGTAATGTCATGATAATAATGGTTTCTTAAACGTC AAGGGGGCACTTTTTCGGGAAATGTGCGCCGAAACCCCTAATTTGTTTTA TTTTTCAAAATCCATTTCAATTAAGTTTCCCCCTCATGGAAACAATAACC CCTGGAAAAAAGGCTTTCATTAAATATTGAAAAAAAGGAAAAAAGTTAAA AATTATTTCAAAATTTTCCCTGTGTTCCCCCCTTTATTTTCCCCTTTTTT TTGCGGGCCATTTTTTGCCCTTTTCCCTGGTTTTTTTTGCCCCCCCCCCC CAAAAAAACCCCCCTGGGGTGAAAAAAAAATAAAAAAAAAAAATGTCTTT AAAAAAAAATTTCCAATTTTTGTGGGGGGGGGGCCCCCCCAAAAGAGTTG GGGGGGTTTTTTAAACCACTTCTCCCAAAACAACATTGGGTGGAGATATT TCTTCTTCACAAAA

(222) TABLE-US-00039 >L_132420_Primer17_026.ab1149222854ABI SEQIDNO:25 GGTGGGTAAATTTAGCAGCAGCAGTTTCTTTCGCTTTCAGCTCCAGCTTG GTCCCCCCTCCGAACGTGTCCGGATAACCACTCCACTCCTGGCAGTAATA AGTGGCAGCATCCTCAGCCTCCATTCGGTTGATTGTGAGAGAATAAGAGG TCCCAGACCCACTGCCACTGAAGCGAAAAGGGACTCCAGGAGCCACGTTG GATGTGTCATAAATCAGGAGTCTGGGGGAGGATCCAGGCTTCTGTTGGTA CCAATATATGTAACGTATACTTGAGCTGGCACTGCAGGTCATGGTGACCC TCTCCCCTGGAGATGCAGACATGATTGCTGGAGACTGGGTGAGCACATTT TCACTGCCACCGCCACACGATCCACCGCCGCAGCTACCACCCCCGCCTGA GGAGACGGTGACCGTGGTCCCTTGGCCCCACAAGTCAAAGTAGCGCCTGT AGTAGTCCCCTCTAGCACAGAAATAGACAGCAGAGTCCTCAGATCTCAGC CTAGTGAGCTCCATATAGGCTGTGCTGGAGGACTTGTCTACACTCAGTGT GGCCCTGCCCTTGAACTTCTCATTGTATTCAGTACTCCCCTCTCCAGGAA AAATCCATCCAATCCACTCAAGTCCCTGTTCAGGCGTCTGCCTCACCCAG TCTATATCATAACTTGTGAAGATGTAGCCAGAAGCCTTGCAGGACAACTT CACTGAAGCCCCAGGCTTTACCACTTCAGTTCCTGACTCCTGCAGCTTGA CCTCGGGAATTCCAGAAAGGGCCTGCTTGAACTTCTCCTTTGCTTCTTCC ATATCTTTCTCATGGGCGGATCCACGCGGAACCAGATCCGATTTTGGAGG ATGGTCGCCACCACCAAACGTGGCTTGCCAGCCCTGGCAAGGCCATGCTA TATACTTGCTGGATTTCAAGTACTTATCAATTTGTGGGAATAGCTTCCTT ACGTTTTTTTAAAACAAACTAATTTTGGGAACGCATCCAGGCCCATTTGG TCCATGTATTAAAACACCATCAAAAACCTCCTACAACATGAAATTCCGGA AGGGGTTTACATAATCCCCCATTTTAAATATTGTTTTTATGACATAAAAC CAATCTTTCCAAACTTTTTTTCACATTTTCCAGGTAACCTTGGTAAAAAA AAAACCACTTTTGAAAAGTTTTTCAAAATTCTTTTTATTAAAATGCAAAT TTTCCCGAAAAAAACCCCTTATTTCTAAAAATTCCCAAAAACCCGCTCCC CTTTCCAAGCCCTTTGAAAAATTTCTTTGCCCCCCCCCTCTTTTTTGGGG AACAAAACCCCCCCCCACAAACTTGGGTTGGGGGTGGTTTTTGTGTCCAC GCCCAAATATAAAAAAACAGTATAAATTAAGATGGGGCCCCCACATATAA AAAACTGGGGGGGGTTTTTTTATATAATTTTTTAAAACACAACATCCCCC CCCCCCCCCCACATCCCACACAAAATAAAATATATAATAAAA

(223) Alignment of scFv(SC) with Sequenced DNA

(224) Expression of scFv(SC)

(225) BL21(DB3) cells carrying plasmid pGEX4T-scFv(SC) was inoculated in 10 ml of LB/carbenicillin (100 g/ml). Cells were grown for 6 hr and centrifugal at 6,000 rpm (3,700g) for 6 minutes. Supernatant was discarded and pellet was resuspended in fresh 2 ml of LB/ampicillin (100 g/ml) and transferred to two 100 ml LB/amp media in 250 ml-Erlenmyer flask. Cells were grown 3 hours at 37 C. at 250 rpm. Temperature was lowered to 25 C. and IPTG was added (0.15 mM final concentration). Cells were grown additionally 15 hours, harvested and resuspended in 20 ml of 20 mM Tris-HCl, pH 8.0 buffer. Proteins were extracted by French Pressure (3 passages at 20,000 psi). Expression of scFv(SC) was analyzed by SDS-PAGE followed by Ponceau S staining and western blot.

(226) scFv(SC) was expressed both as soluble protein and as insoluble inclusion bodies.

(227) 1D Western blot analysis of scFvSC. Reactivity of scFv(SC) toward recombinant ENOX2 was analyzed by 1 dimensional western blot. Recombinant ENOX2 was separated by SDS-PAGE and transferred to nitrocellulose membranes. Nitrocellulose membranes were incubated with scFv(SC) for 17 hours and alkaline phosphatase linked S-protein for 2 hours. Detection was with Western Blue (Promega). scFv(SC) reacted toward recombinant ENOX2. For comparison, scFv(S) was included in the western blot analysis.

(228) FIG. 12 shows Western blots of mixing studies to demonstrate efficacy of ScFV with -CXXC-XX-C linker (FIG. 12A) compared to the conventional XXXXXXX linker (FIG. 12B). Under non-reducing conditions for both (to preserve SS bonds), the ScFV recombinant antibody with the functional cysteine linker when incubated with recombinant ENOX2 showed reduced levels of 53 kDa ScFV (a) and a 46 kDa truncated ScFV from a downstream initiation site (b) predominantly by disulfide bond formation between the full length ScFV and the 72 kDa full length ENOX2 in a ratio of one ENOX2 molecule plus two ScFV molecules (one to each of the two protein disulfide isomerase binding sites of ENOX2) for a combined molecular weight of about 176 kDa. In FIG. 12B, with the conventional linker lacking cysteines, no evidence of cross-linking under identical reaction conditions was observed.

(229) 2D Western blot analysis of scFvSC. Reactivity of scFv(SC) toward recombinant ENOX2 and transcript variant of serum of prostate cancer patient was analyzed by 2 dimensional western blot. Normal serum spiked with 6 g of recombinant and serum from prostate cancer patient were separated first by isoelectric focusing and then SDS-PAGE and then transferred to nitrocellulose membranes. Nitrocellulose membranes were incubated with scFv(SC) for 17 hours and alkaline phosphatase linked S-protein for 2 hours. Detection was with Western Blue (Promega).

Method 5

Enhancement of the Physical Stability of Concentrated Antibody Solutions

(230) An important embodiment of the present invention is to enhance the physical stability of concentrated solutions, while maintaining chemical stability and biological potency. The invention provides scFv antibodies which are at least 99% identical to SEQ ID NO:11 and have a kDa for ENOX2 protein of 710.sup.7 M and a purity of at least 95%.

(231) A major factor, however, in determining the efficacy of the scFv is its propensity to aggregate. After only ten days of storage at either 70 C. or 4 C., the binding of the purified scFv to recombinant ENOX2 protein was reduced by more than 90%. After much study, this loss of efficacy was traced solely to protein aggregation. Aggregated antibodies do not combine specifically with ENOX2 proteins during western blotting. Aggregation of the functionalized scFv antibody as determined from light scattering measurements is achieved by storage in 50% glycerol and stored at 70 C., essential ingredients in the overall protocol to achieve the desired level of sensitivity and specificity. Activity is lost rapidly by storage in the absence of glycerol.

(232) TABLE-US-00040 TABLE 4 Detection of ENOX2 transcript variants and reference proteins comparing functionalized scFv recombinant antibodies stored in the presence or absence of 50% glycerol. scFv stored in the absence of 50% glycerol scFv stored in the presence of 50% glycerol Cancer Ref. pH 4.1 Ref pH 6.8 Ref 3 Spot Ref. pH 4.1 Ref pH 6.8 Ref 3 Spot Prostate + + +/ + + + +/ Colorectal + + +/ ++ ++ + ++ Breast, Bladder + + + ++ ++ + + NSC Lung + + + ++ ++ + + Testicular + + +/ ++ ++ + + Blood Cell + + +/ ++ ++ + + Overall + + +/ ++ ++ + +

(233) With storage in the presence of 50% glycerol (right), all three reference proteins were approximately two times stronger than in the absence of glycerol (left). Transcript variants (spots) were clearer with storage in 50% glycerol (right) than in its absence (left)

(234) FIG. 13 is particle distribution as concentration (%) of antibody based on size (nm) determined by light scattering (Agilent 7080 Particle Size Spectrophotometer) showing predominately the major contribution of unaggregated antibody when stored in 50% glycerol at 70C.

(235) These three elements, addition of NADH during antibody binding, modification of the scFv linker peptide to resemble the ENOX2 protein disulfide-thiol interchange functional motif and the use of 50% glycerol to prevent scFv aggregation combine to provide an unprecedented sensitivity of the ONCOblot test to permit detection of cancers more than 10 years in advance of clinical symptoms.

Method 6

Determination of the Sensitivity and Limit of Detection of the Functionalized Antibody in the Presence of NADH

(236) The incidence of confirmed false positives and confirmed false negatives is low, less than 1% each (D. J. Morre and D. S. Gilmartin. 2015 ONCOblot Reports 1 (1):1-2). For several cancers, two or more ENOX2 transcript variants must be present within the ONCOblot Tissue of Origin Cancer Test to permit the correct identification of the tissue of origin. These include bladder, colorectal gastric, mesothelioma, ovarian, renal cell and uterine cancer. If one or more ENOX2 transcript variants are absent or below the limit of detection, the tissue of origin of the cancer may be misidentified. Of the most recent ONCOblots analyzed under the current protocol, the rate of misidentification is 2.8%. Thus, the overall accuracy of the test with clinically diagnosed cancers is at least 95%.

(237) When proteins are separated by two-dimensional (2-D) gel electrophoresis and detected by immunoblot, visualized proteins appear as small spherical or oval immunoreactive regions termed spots. The average diameter of the spot produced by an ENOX2 protein is proportional to the amount of ENOX2 protein present. To determine the limit of ENOX2 detection by ONCOblot, a standard cure of spot diameter was generated. To this end, a functional 46 kDa form of human ENOX2 was first produced in E. coli and purified to near homogeneity. Various amounts of this recombinant ENOX2 protein were then assayed by ONCOblot. The log of the resulting spot diameter was then plotted against the log of the amount of ENOX2 protein assayed (FIG. 11) and a strong linear correlation (r.sup.2=0.95) was found among the values. The practical lower limit of detection of an ENOX2 protein assayed by ONCOblot is a spot on the order of 0.25 mm, which by comparison to FIG. 11 correlated to the detection of 120 femtomoles (1.210.sup.11 molecules) of ENOX2 per assay. This value is approximately equivalent to a lower limit of 100 femtomoles of ENOX2 per assay.

(238) FIG. 11 illustrates the log-log relationship between spot diameter and amount of ENOX2 protein loaded on the 2-D gel. Varying amounts of recombinant ENOX2 were analyzed by immunoblot. The log of the diameter of the detected ENOX2 spot was then plotted as a function of the log of the amount of ENOX2 loaded.

(239) FIG. 12 shows Western blots of mixing experiments to demonstrate efficacy of ScFV with -CXXC-XX-C linker (FIG. 12A) compared to the conventional XXXXXXX linker (FIG. 12B). Under non-reducing conditions for both (to preserve SS bonds), the ScFV recombinant antibody with the functional cysteine linker when incubated with recombinant ENOX2 showed reduced levels of 53 kDa ScFV (a) and a 46 kDa truncated ScFV from a downstream initiation site (b) predominantly by disulfide bond formation between the full length ScFV and the 72 kDa full length ENOX2 in a ratio of one ENOX2 molecule plus two ScFV molecules (one to each of the two protein disulfide isomerase binding sites of ENOX2) for a combined molecular weight of about 176 kDa. In FIG. 12B, with the conventional linker lacking cysteines, no evidence of cross-linking under identical reaction conditions was observed.

(240) FIG. 13 is particle distribution as concentration (%) of antibody based on size (nm) determined by light scattering (Agilent 7080 Particle Size Spectrophotometer) showing predominately the major contribution of unaggregated antibody when stored in 50% glycerol at 70 C.

(241) ENOX2 proteins within sera of 25 Stage 0 and Stage 1 cancer patients were detected by ONCOblot (Morre, D. J and Taggart, D. J. 2015. ONCOblot Reports 1(4):1-2). The average concentration of ENOX2 within these sera samples was approximately 990 femtomoles (610.sup.11 molecules) per 150 L assay by comparison to the standard curve of FIG. 11. By definition, Stage 0 and Stage 1 cancers are typically less than 20 mm in diameter (Cancer Facts and Figures. 2014. Amer Can Soc 2-3). However, as the average size of Stage 0 or Stage 1 cancer is more likely to be 5 to 10 mm in diameter, the lower limit of detection of ENOX2 would be predicted to be produced by a 0.8 mm to 1.6 mm diameter tumor (1.2 mm average). A comparison of the lower limit of detection of recombinant ENOX2 between the previous version of the ONCOblot test (Hosteller et al., 2009. Clinical Proteomics 5: 46-51) and the current version of the test with NADH and functionalized scFv antibody is provided in FIG. 14. With NADH and the functionalized scFv antibody the lower limit of detection of recombinant ENOX2 in the protocol is about 5 g. With the functionalized test using NADH and the modified linker the limit of detection is approximately 10-fold lower (curve on the right).

(242) If the tumor cells are treated as spheres, then the number of cells in a solid tumor can be calculated by using equation 1, where V.sub.tumor is the volume of the tumor, V.sub.cell is the average volume of a cancer cell, D is the tumor diameter and d is the average diameter of a cancer cell estimated to be 10 um, then a 1.2 mm diameter cancer is calculated to contain approximately 2 million cells.

(243) # tumor cells = V tumor V cell = 4 3 ( D 2 ) 3 4 3 ( d 2 ) 3 = ( D 2 ) 3 ( d 2 ) 3 = ( D 2 d 2 ) 3 = ( D d ) 3 Equation 1

Method 7

How Early Might the Functionalized Test with NADH and Modified Linker Detect Cancer in Advance of Clinical Symptoms

(244) Evidence summarized herein has determined that the capability of the test in its present configuration is to detect cancer between 10 and 20 years in advance of clinical symptoms consistent with the 10-fold increased sensitivity provided.

(245) In order to estimate how far in advance if clinical symptoms it would be possible to detect cancer presence by the current functionalized version of the test, a study was designed to determine, by comparison to NCI Seer Cancer Statistics Review (Howlander, N. et al. SEER Cancer Statistics Review, 1875-2912, National Cancer Institute, Bethesda, Md.) estimation of how closely the current test results correlated with overall risk of being diagnosed with cancer comparing six age groups consisting of equal numbers of male and female participants. Actual diagnoses were compared to those predicted by the Seer Cancer Statistics Review of predicted risk of being diagnosed with cancer with increasing age.

(246) A total of 300 healthy volunteers without clinical evidence of cancer, 25 males and 25 females in each of six age groups, were analyzed for cancer presence by the current 2-D gel-western blot test with NADH and functionalized linker. Sera were collected by venipuncture and analyzed using IRB approved protocols and informed consent. Findings summarized in Table 5 reveal a relatively high incidence of early cancer detection with the normal healthy population consistent with cancer detection 10 to 20 years in advance of clinical symptoms (see also FIG. 5).

(247) TABLE-US-00041 TABLE 5 Incidence of early cancer detected by the current 2-D gel-Western blot test with NADH and functionalized linker in a normal population of healthy male and female volunteers. Tests positive for cancer (%) Age at time of test (y) Males Females Total 21-29 12 8 10 30-29 4 16 10 40-49 40 28 34 50-59 20 24 22 60-69 20 28 24 70-79 12 32 22 Includes both solid tissue and blood cell cancers.

(248) The overall incidence of positive test was 10% in the 21 to 29 year age group and stabilized at about 22% between 50 and 79 years. The marked increase in positive ONCOblots in the 40 to 49 year old males was due to a disproportionate number of early prostate indications within this population, a number of which would likely never develop in overt disease. Otherwise, for all age groups, the observed incidence of cancer matched closely the incidences predicted from the National Cancer Institute Seer Cancer Statistics Review (Table 6) for between 10 and 20 years rather than the previous estimates of 7 to 10 years to be provided by the 2-D gel-western blot protocol lacking the NADH/functionalized linker modified version of the present invention consistent with the 2- to 3-fold increase in sensitivity of the test over that of the original test.

(249) TABLE-US-00042 TABLE 6 Risk of being diagnosed with cancer for different age groups from the National Cancer Institute Seer Cancer Statistics Review (Howlander, N. et al. SEER Cancer Statistics Review, 1875-2912, National Cancer Institute, Bethesda, MD). Current Age +10 years +20 years +30 years Ever 20 0.46 1.52 4.13 40.73 30 1.08 3.72 9.64 40.77 40 2.70 8.75 19.44 40.55 60 13.47 26.28 34.95 37.10 70 17.16 27.91 30.61 80 16.15 20.40

(250) The findings show that the 2-D gel-western blot test as described in the present invention has the potential to detect cancer earlier than any test previously reported. Certainly, not all of the early detected cancers would be expected to develop into clinically diagnosed disease but, based on the comparisons provided, in the order of 50% would have a high probability of so doing. At least with prostate cancer, positive ONCOblot results have been recorded for subjects with PSA values as low as 0.5 ng/ml in the age group of 40 to 49 year old males as one explanation for the exceptionally high incidence of cancer indicated by the functionalized ONCOblot test.

(251) It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method, kit, reagent, or composition of the invention, and vice versa. Furthermore, compositions of the invention can be used to achieve methods of the invention.

(252) It will be understood that particular embodiments described herein are shown by way of illustration and not as limitations of the invention. The principal features of this invention can be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of this invention and are covered by the claims.

(253) All publications and patent applications mentioned in the specification are indicative of the level of skill of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

(254) The use of the word a or an when used in conjunction with the term comprising in the claims and/or the specification may mean one, but it is also consistent with the meaning of one or more, at least one, and one or more than one. The use of the term or in the claims is used to mean and/or unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and and/or. Throughout this application, the term about is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among the study subjects.

(255) As used in this specification and claim(s), the words comprising (and any form of comprising, such as comprise and comprises), having (and any form of having, such as have and has), including (and any form of including, such as includes and include) or containing (and any form of containing, such as contains and contain) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. In embodiments of any of the compositions and methods provided herein, comprising may be replaced with consisting essentially of or consisting of. As used herein, the phrase consisting essentially of requires the specified integer(s) or steps as well as those that do not materially affect the character or function of the claimed invention. As used herein, the term consisting is used to indicate the presence of the recited integer (e.g., a feature, an element, a characteristic, a property, a method/process step or a limitation) or group of integers (e.g., feature(s), element(s), characteristic(s), propertie(s), method/process steps or limitation(s)) only.

(256) The term or combinations thereof as used herein refers to all permutations and combinations of the listed items preceding the term. For example, A, B, C, or combinations thereof is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB. Continuing with this example, expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, AB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth. The skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.

(257) As used herein, words of approximation such as, without limitation, about, substantial or substantially refers to a condition that when so modified is understood to not necessarily be absolute or perfect but would be considered close enough to those of ordinary skill in the art to warrant designating the condition as being present. The extent to which the description may vary will depend on how great a change can be instituted and still have one of ordinary skilled in the art recognize the modified feature as still having the required characteristics and capabilities of the unmodified feature. In general, but subject to the preceding discussion, a numerical value herein that is modified by a word of approximation such as about may vary from the stated value by at least 1, 2, 3, 4, 5, 6, 7, 10, 12 or 15%.

(258) All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.