ANTIBODIES TO TIP-1 AND GRP78
20170298142 ยท 2017-10-19
Inventors
Cpc classification
A61N2005/1098
HUMAN NECESSITIES
A61N5/10
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
A61B5/4848
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
A61K51/1045
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
A61B6/463
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K51/10
HUMAN NECESSITIES
A61N5/10
HUMAN NECESSITIES
Abstract
The present invention is directed towards isolated antibodies that bind to GRP78.
Claims
1. An isolated antibody that binds to 78-kDa glucose-regulated protein (GRP78), wherein the antibody comprises a heavy chain variable domain comprising a CDR1, CDR2, and a CDR3, wherein the heavy chain variable domain CDR1 comprises SEQ ID NO: 15, the heavy chain variable region domain CDR2 comprises SEQ ID NO:16, and the heavy chain variable region domain CDR3 comprises SEQ ID NO:17; and a light chain variable domain comprising a CDR1, CDR2, and CDR3, wherein the light chain variable domain CDR1 comprises SEQ ID NO:18, the light chain variable region domain CDR2 comprises SEQ ID NO:19, and the light chain variable region domain CDR3 comprises SEQ ID NO:20.
2. The antibody of claim 1, wherein the antibody recognizes an epitope within an amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO:4.
3. The antibody of claim 1, wherein the antibody is selected from the group consisting of a humanized antibody, a single chain variable fragment (scFv) antibody, an antibody fragment, or a chimeric antibody.
4. The antibody of claim 1, wherein the antibody is conjugated directly or indirectly to a payload selected from the group consisting of a therapeutic agent, an imaging agent, or a combination thereof.
5. A method of enhancing radiotherapy in a subject using an antibody that binds to 78-kDa glucose-regulated protein (GRP78), wherein the antibody is conjugated directly or indirectly to a payload selected from the group consisting of a therapeutic agent, an imaging agent, or a combination thereof, the method comprising administering a pharmacologically effective amount of antibody to the subject, such that radiotherapy is enhanced.
6. The method of claim 5, further comprising administering ionizing radiation to the subject.
7. The method of claim 5, further comprising imaging the subject.
8. The method of claim 5, wherein, the therapeutic agent is an antineoplastic agent.
9. A method of imaging cancer in a subject, using an antibody that binds to 78-kDa glucose-regulated protein (GRP78), wherein the antibody is conjugated to an imaging agent, the method comprising administering the conjugated GRP78 to the subject, and imaging cancer in a subject.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0008] The application file contains at least one drawing executed in color. Copies of this patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION OF THE INVENTION
[0036] The present invention encompasses antibodies that recognize tumor cells. The antibodies may be used to provide tumor-specific delivery, for instance, of drugs or therapeutic agents, as well as enhancing the efficacy of radiotherapy. In particular, the present invention provides for antibodies that bind to GRP78 and TIP-1. Advantageously, these antibodies specifically bind tumor cells and not normal cells.
[0037] In an exemplary embodiment, antibodies of the invention specifically bind to epitopes exposed on irradiated tumor related cells. For instance, antibodies of the invention may bind to extracellular, transmembrane or intracellular epitopes on irradiated tumor related cells.
I. Antibodies
[0038] The present invention encompasses antibodies that recognize tumor cells. In an aspect, antibodies useful herein include those antibodies which have been isolated, characterized, purified, are functional and have been recovered (obtained) for use in a functional therapeutic composition which is administered to a living patient.
[0039] The term antibody refers to an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, or polypeptide through at least one antigen recognition site. As used herein, an antibody encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2. Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity.
[0040] An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), or the antibody need not be of any particular class. As long as the protein retains the ability specifically to bind its intended target, it is included within the term antibody.
[0041] Also included within the definition antibody for example are single chain forms, generally designated Fv or scFv, regions, of antibodies with this specificity. These scFvs comprise heavy and light chain variable regions connected by a linker. In most instances, but not all, the linker may be a peptide. A linker peptide is preferably from about 10 to 25 amino acids in length. Preferably, a linker peptide is rich in glycine, as well as serine or threonine. ScFvs can be used to facilitate phage display or can be used for flow cytometry, immunohistochemistry, or as targeting domains. Methods of making and using scFvs are known in the art.
[0042] The basic structural unit of an antibody useful herein comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one light' (about 25 kDa) and one heavy chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
[0043] Depending on the antibody amino acid sequence of the constant domain of its heavy chains, immunoglobulins can be assigned to different classes. In mammals, heavy-chains are classified as alpha, delta, epsilon, gamma, or mu, and define the antibody's isotype as IgA, IgD, IgE, IgG, and IgM, respectively. Several of these isotypes may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. Light chains are classified as kappa and lambda.
[0044] The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known. Within light and heavy chains, the variable and constant regions are joined by a J region of about 12 or more amino acids, with the heavy chain also including a D region of about 10 more amino acids. The variable regions of each light/heavy chain pair form the antibody binding site. Thus, an intact antibody has two binding sites. The chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarily determining regions (hereinafter referred to as CDRs.) The CDRs from the two chains are aligned by the framework regions, enabling binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4 respectively. The assignment of amino acids to each domain is in accordance with known conventions (See, Kabat Sequences of Proteins of Immunological Interest National Institutes of Health, Bethesda, Md., 1987 and 1991; Chothia, et al, J. Mol. Bio. (1987) 196: 901-917; Chothia, et al., Nature (1989) 342: 878-883).
[0045] In some embodiments, the antibodies of the invention may be monoclonal antibodies. Monoclonal antibody refers to an antibody that is derived from a single copy or clone. A monoclonal antibody is not limited to antibodies produced through hybridoma technology. Monoclonal antibodies may be produced using e.g., hybridoma techniques well known in the art, as well as recombinant technologies, phage display technologies, synthetic technologies or combinations of such technologies and other technologies readily known in the art. A monoclonal antibody may encompass not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity and the ability to bind to an antigen. Furthermore, the monoclonal antibody may be labeled with a detectable label, immobilized on a solid phase and/or conjugated with a heterologous compound (e.g., an enzyme or toxin) according to methods known in the art.
[0046] Preferably, but not necessarily, the antibodies useful in the discovery are produced recombinantly, as manipulation of the typically murine or other non-human antibodies with the appropriate specificity is required in order to convert them to humanized form. Antibodies may or may not be glycosylated, though glycosylated antibodies are preferred. Antibodies are properly cross-linked via disulfide bonds, as is known.
[0047] Antibodies useful herein include those which are isolated, characterized, purified, functional and have been recovered (obtained) from a process for their preparation and thus available for use herein in a useful form in a therapeutically and medicinally sufficient amount.
[0048] In an aspect, antibodies of the invention are generated with appropriate specificity by standard techniques of immunization of mammals, forming hybridomas from the antibody-producing cells of said mammals or otherwise immortalizing them, and culturing the hybridomas or immortalized cells to assess them for the appropriate specificity. In the present case, such antibodies may be generated by immunizing a human, rabbit, rat or mouse, for example, with a peptide representing an epitope encompassing a region of the GRP78 or TIP-1 protein coding sequences or an appropriate subregion thereof. Materials for recombinant manipulation may be obtained by retrieving the nucleotide sequences encoding the desired antibody from the hybridoma or other cell that produces it. These nucleotide sequences may then be manipulated and isolated, characterized, purified and recovered to provide them in humanized form, if desired.
(a) Antibodies that Bind to GRP78
[0049] One aspect of the present invention encompasses an antibody that binds to GRP78.
(i) Heavy Chain Sequence
[0050] In one embodiment, such an antibody is encoded by a heavy chain variable region nucleic acid sequence that comprises at least about 60% homology to SEQ ID NO:5. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO: 5. In one embodiment, the heavy chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:5. In a preferred embodiment, the heavy chain variable region nucleic acid sequence encodes the amino acid sequence of SEQ ID NO:6.
[0051] In other embodiments, an isolated antibody of the present invention comprises a heavy chain variable region amino acid sequence with at least about 60% homology to SEQ ID NO: 6. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO: 6. In one embodiment, the heavy chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:6.
[0052] In certain embodiments, an antibody that binds to GRP78 is an isolated antibody that comprises at least one heavy chain variable domain complementary determining region (CDR) sequence. Typically, a heavy chain variable domain comprises three CDR sequences (CDR1, CDR2, and CDR3), separated by framework regions. In one embodiment, an antibody of the invention comprises a heavy chain CDR1 region that comprises at least five contiguous amino acids of SEQ ID NO: 15 (SFTGYFMN). For instance, the heavy chain CDR1 region may comprise 6, 7, or 8 contiguous amino acids of SEQ ID NO: 15. In another embodiment, an antibody of the invention comprises a heavy chain CDR1 region comprising SEQ ID NO:15.
[0053] In other embodiments, an antibody of the invention comprises a heavy chain CDR2 region that comprises at least five contiguous amino acids of SEQ ID NO: 16 (IGRIDPYNGNIFYNQ). For instance, the heavy chain CDR2 region may comprise 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 contiguous amino acids of SEQ ID NO: 16. In another embodiment, an antibody of the invention comprises a heavy chain CDR2 region comprising SEQ ID NO:16.
[0054] In yet another embodiment, an antibody of the invention comprises a heavy chain CDR3 region that comprises at least five contiguous amino acids of SEQ ID NO: 17 (AVYYCGRSYGNY). For instance, the heavy chain CDR3 region may comprise 6, 7, 8, 9, 10, 11, or 12 contiguous amino acids of SEQ ID NO: 17. In another embodiment, an antibody of the invention comprises a heavy chain CDR3 region comprising SEQ ID NO:17.
[0055] A heavy chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO: 15 and a CDR2 of SEQ ID NO:16. In another embodiment, a heavy chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:15 and a CDR3 of SEQ ID NO: 17. In yet another embodiment, a heavy chain variable region of an antibody of the present invention may comprise a CDR2 of SEQ ID NO: 16 and a CDR3 of SEQ ID NO:17. In still another embodiment, a heavy chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:15, a CDR2 of SEQ ID NO:16, and a CDR3 of SEQ ID NO:17.
[0056] In each of the above embodiments, a CDR sequence may have one, two, or three amino acid substitutions. These substitutions may be conservative or non-conservative, providing the antibody specifically recognizes GRP78.
(ii) Light Chain Sequence
[0057] In an embodiment, such an antibody is encoded by a light chain variable region nucleic acid sequence that comprises at least about 60% homology to SEQ ID NO:7. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO: 7. In one embodiment, the light chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:7. In a preferred embodiment, the light chain variable region nucleic acid sequence encodes the amino acid sequence of SEQ ID NO:8.
[0058] In other embodiments, an isolated antibody of the present invention comprises a light chain variable region amino acid sequence with at least about 60% homology to SEQ ID NO: 8. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO: 8. In one embodiment, the heavy chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:8.
[0059] In certain embodiments, an antibody that binds to GRP78 is an isolated antibody that comprises at least one light chain variable domain complementary determining region (CDR) sequence. Typically, a light chain variable domain comprises three CDR sequences (CDR1, CDR2, and CDR3), separated by framework regions. In one embodiment, an antibody of the invention comprises a light chain CDR1 region that comprises at least five contiguous amino acids of SEQ ID NO: 18 (GETITINCRA). For instance, the light chain CDR1 region may comprise 6, 7, 8, 9, or 10 contiguous amino acids of SEQ ID NO: 18. In another embodiment, an antibody of the invention comprises a light chain CDR1 region that comprises SEQ ID NO:18.
[0060] In an alternative embodiment, an antibody of the invention comprises a light chain CDR2 region that comprises at least five contiguous amino acids of SEQ ID NO: 19 (KPGKTNKLLIYF). For instance, the light chain CDR2 region may comprise 6, 7, 8, 9, 10, 11, or 12 contiguous amino acids of SEQ ID NO: 19. In another embodiment, an antibody of the invention comprises a light chain CDR2 region that comprises SEQ ID NO:19.
[0061] In yet another embodiment, an antibody of the invention comprises a light chain CDR3 region that comprises at least five contiguous amino acids of SEQ ID NO: 20 (EPEDFAMYFCQQHNE). For instance, the light chain CDR3 region may comprise 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 contiguous amino acids of SEQ ID NO: 20. In another embodiment, an antibody of the invention comprises a light chain CDR3 region that comprises SEQ ID NO:20.
[0062] A light chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO: 18 and a CDR2 of SEQ ID NO:19. In another embodiment, a light chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:18 and a CDR3 of SEQ ID NO: 20. In yet another embodiment, a light chain variable region of an antibody of the present invention may comprise a CDR2 of SEQ ID NO: 19 and a CDR3 of SEQ ID NO:20. In still another embodiment, a light chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:18, a CDR2 of SEQ ID NO:19, and a CDR3 of SEQ ID NO:20.
[0063] In each of the above embodiments, a CDR sequence may have one, two, or three amino acid substitutions. These substitutions may be conservative or non-conservative, providing the antibody specifically recognizes GRP78.
(iii) Preferred Embodiments
[0064] In preferred embodiments, an antibody of the invention is encoded by a heavy chain variable region nucleic acid sequence of SEQ ID NO:5 and a light chain variable region nucleic acid sequence of SEQ ID NO:7. In another preferred embodiment, an antibody of the invention is encoded by a heavy chain variable region nucleic acid that encodes SEQ ID NO:6 and a light chain variable region nucleic acid sequence that encodes SEQ ID NO:8. In still other preferred embodiments, an antibody of the invention comprises a heavy chain variable region of SEQ ID NO:6 and a light chain variable region of SEQ ID NO:8.
[0065] In an exemplary embodiment, an antibody of the invention may comprise a combination of CDR sequences listed in Table A below.
TABLE-US-00001 TABLE A CDR combinations comprising antibodies that recognize GRP78 Heavy Chain Variable Light Chain Variable Region SEQ ID NOs Region SEQ ID NOs Combination CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 1 15 16 17 18 19 20 2 15 16 17 19 20 3 15 16 17 18 20 4 15 16 17 18 19 5 15 16 17 20 6 15 16 17 19 7 15 16 17 18 8 15 16 17 9 15 16 18 19 20 10 15 16 19 20 11 15 16 18 20 12 15 16 18 19 13 15 16 20 14 15 16 19 15 15 16 18 16 15 16 17 15 17 18 19 20 18 15 17 19 20 19 15 17 18 20 20 15 17 18 19 21 15 17 20 22 15 17 19 23 15 17 18 24 15 17 25 16 17 18 19 20 26 16 17 19 20 27 16 17 18 20 28 16 17 18 19 29 16 17 20 30 16 17 19 31 16 17 18 32 16 17 33 15 18 19 20 34 15 19 20 35 15 18 20 36 15 18 19 37 15 20 38 15 19 39 15 18 40 15 41 16 18 19 20 42 16 19 20 43 16 18 20 44 16 18 19 45 16 20 46 16 19 47 16 18 48 16 49 17 18 19 20 50 17 19 20 51 17 18 20 52 17 18 19 53 17 20 54 17 19 55 17 18 56 17 57 18 19 20 58 19 20 59 18 20 60 18 19 61 20 62 19 63 18
(iv) GRP78 Epitopes
[0066] In one embodiment, an isolated antibody of the present invention that binds to GPR78 recognizes an epitope within the amino acid sequence of SEQ ID NO:1. For instance, a GRP78 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO:1.
[0067] In yet another embodiment, an isolated antibody of the present invention that binds to GPR78 recognizes an epitope within the amino acid sequence of SEQ ID NO:2. For instance, a GRP78 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 2.
[0068] In yet a further embodiment, an isolated antibody of the present invention that binds to GPR78 recognizes an epitope within the amino acid sequence of SEQ ID NO:3. For instance, a GRP78 antibody of the invention may recognize an epitope with 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 contiguous amino acids of SEQ ID NO:3.
[0069] In an additional embodiment, an isolated antibody of the present invention that binds to GPR78 recognizes an epitope within the amino acid sequence of SEQ ID NO:4. For instance, a GRP78 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 4.
(b) Antibodies that Bind to TIP-1
[0070] One aspect of the present invention encompasses an antibody that binds to TIP-1.
(i) Heavy Chain Sequence
[0071] In one embodiment, such an antibody is encoded by a heavy chain variable region nucleic acid sequence that comprises at least about 60% homology to SEQ ID NO:24. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO: 24. In one embodiment, the heavy chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:24. In a preferred embodiment, the heavy chain variable region nucleic acid sequence encodes the amino acid sequence of SEQ ID NO:25.
[0072] In other embodiments, an isolated antibody of the present invention comprises a heavy chain variable region amino acid sequence with at least about 60% homology to SEQ ID NO: 25. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO: 25. In one embodiment, the heavy chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:25.
[0073] In certain embodiments, an antibody that binds to TIP-1 is an isolated antibody that comprises at least one heavy chain variable domain complementary determining region (CDR) sequence. Typically, a heavy chain variable domain comprises three CDR sequences (CDR1, CDR2, and CDR3), separated by framework regions. The assignment of amino acids to each domain is in accordance with known conventions (See, Kabat Sequences of Proteins of Immunological Interest National Institutes of Health, Bethesda, Md., 1987 and 1991; Chothia, et al, J. Mol. Bio. (1987) 196: 901-917; Chothia, et al., Nature (1989) 342: 878-883).
[0074] In one embodiment, an antibody of the invention comprises a heavy chain CDR1 region that comprises at least five contiguous amino acids of SEQ ID NO: 28 (SNYWMN). For instance, the heavy chain CDR1 region may comprise 6 contiguous amino acids of SEQ ID NO: 28. In another embodiment, an antibody of the invention comprises a heavy chain CDR1 region comprising SEQ ID NO:28.
[0075] In other embodiments, an antibody of the invention comprises a heavy chain CDR2 region that comprises at least five contiguous amino acids of SEQ ID NO: 29 (QIRLKSDNYATHY). For instance, the heavy chain CDR2 region may comprise 6, 7, 8, 9, 10, 11, 12, or 13 contiguous amino acids of SEQ ID NO: 29. In another embodiment, an antibody of the invention comprises a heavy chain CDR2 region comprising SEQ ID NO:29.
[0076] In yet another embodiment, an antibody of the invention comprises a heavy chain CDR3 region that comprises at least five contiguous amino acids of SEQ ID NO: 30 (GIYYCLLYY). For instance, the heavy chain CDR3 region may comprise 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 30. In another embodiment, an antibody of the invention comprises a heavy chain CDR3 region comprising SEQ ID NO:30.
[0077] A heavy chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:28 and a CDR2 of SEQ ID NO:29. In another embodiment, a heavy chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:28 and a CDR3 of SEQ ID NO:30. In yet another embodiment, a heavy chain variable region of an antibody of the present invention may comprise a CDR2 of SEQ ID NO:29 and a CDR3 of SEQ ID NO:30. In still another embodiment, a heavy chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:28, a CDR2 of SEQ ID NO:29, and a CDR3 of SEQ ID NO:30.
[0078] In each of the above embodiments, a CDR sequence may have one, two, or three amino acid substitutions. These substitutions may be conservative or non-conservative, providing the antibody specifically recognizes TIP-1.
(ii) Light Chain Sequence
[0079] In an embodiment, such an antibody is encoded by a light chain variable region nucleic acid sequence that comprises at least about 60% homology to SEQ ID NO:26. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO:26. In one embodiment, the light chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:26. In a preferred embodiment, the light chain variable region nucleic acid sequence encodes the amino acid sequence of SEQ ID NO:27.
[0080] In other embodiments, an isolated antibody of the present invention comprises a light chain variable region amino acid sequence with at least about 60% homology to SEQ ID NO:27. In some embodiments, an antibody comprises at least 60, 65, 70, 75, 80, 85, 90, or 95% homology with SEQ ID NO:27. In one embodiment, the heavy chain variable region nucleic acid sequence has at least about 95, 96, 97, 98, or 99% sequence homology with SEQ ID NO:27.
[0081] In certain embodiments, an antibody that binds to GRP78 is an isolated antibody that comprises at least one light chain variable domain complementary determining region (CDR) sequence. Typically, a light chain variable domain comprises three CDR sequences (CDR1, CDR2, and CDR3), separated by framework regions. The assignment of amino acids to each domain is in accordance with known conventions (See, Kabat Sequences of Proteins of Immunological Interest National Institutes of Health, Bethesda, Md., 1987 and 1991; Chothia, et al, J. Mol. Bio. (1987) 196: 901-917; Chothia, et al., Nature (1989) 342: 878-883).
[0082] In one embodiment, an antibody of the invention comprises a light chain CDR1 region that comprises at least five contiguous amino acids of SEQ ID NO: 31 (SQSLVHSNG). For instance, the light chain CDR1 region may comprise 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO:31. In another embodiment, an antibody of the invention comprises a light chain CDR1 region that comprises SEQ ID NO:31.
[0083] In an alternative embodiment, an antibody of the invention comprises a light chain CDR2 region that comprises at least five contiguous amino acids of SEQ ID NO:32 (KLLIYKVSNRF). For instance, the light chain CDR2 region may comprise 6, 7, 8, 9, 10, or 11 contiguous amino acids of SEQ ID NO:32. In another embodiment, an antibody of the invention comprises a light chain CDR2 region that comprises SEQ ID NO:32.
[0084] In yet another embodiment, an antibody of the invention comprises a light chain CDR3 region that comprises at least five contiguous amino acids of SEQ ID NO:33 (GVYFCSQST). For instance, the light chain CDR3 region may comprise 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO:33. In another embodiment, an antibody of the invention comprises a light chain CDR3 region that comprises SEQ ID NO:33.
[0085] A light chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:31 and a CDR2 of SEQ ID NO:32. In another embodiment, a light chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:31 and a CDR3 of SEQ ID NO:33. In yet another embodiment, a light chain variable region of an antibody of the present invention may comprise a CDR2 of SEQ ID NO:32 and a CDR3 of SEQ ID NO:33. In still another embodiment, a light chain variable region of an antibody of the present invention may comprise a CDR1 of SEQ ID NO:31, a CDR2 of SEQ ID NO:32, and a CDR3 of SEQ ID NO:33.
[0086] In each of the above embodiments, a CDR sequence may have one, two, or three amino acid substitutions. These substitutions may be conservative or non-conservative, providing the antibody specifically recognizes TIP-1.
(iii) Preferred Embodiments
[0087] In preferred embodiments, an antibody of the invention is encoded by a heavy chain variable region nucleic acid sequence of SEQ ID NO:24 and a light chain variable region nucleic acid sequence of SEQ ID NO:26. In another preferred embodiment, an antibody of the invention is encoded by a heavy chain variable region nucleic acid that encodes SEQ ID NO:25 and a light chain variable region nucleic acid sequence that encodes SEQ ID NO:27. In still other preferred embodiments, an antibody of the invention comprises a heavy chain variable region of SEQ ID NO:25 and a light chain variable region of SEQ ID NO:27. In an exemplary embodiment, an antibody of the invention may comprise a combination of CDR sequences listed in Table B below.
TABLE-US-00002 TABLE B CDR combinations comprising antibodies that recognize TIP-1 Heavy Chain Variable Light Chain Variable Region SEQ ID NOs Region SEQ ID NOs Combination CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 1 28 29 30 31 32 33 2 28 29 30 32 33 3 28 29 30 31 33 4 28 29 30 31 32 5 28 29 30 33 6 28 29 30 32 7 28 29 30 31 8 28 29 30 9 28 29 31 32 33 10 28 29 32 33 11 28 29 31 33 12 28 29 31 32 13 28 29 33 14 28 29 32 15 28 29 31 16 28 29 17 28 30 31 32 33 18 28 30 32 33 19 28 30 31 33 20 28 30 31 32 21 28 30 33 22 28 30 32 23 28 30 31 24 28 30 25 29 30 31 32 33 26 29 30 32 33 27 29 30 31 33 28 29 30 31 32 29 29 30 33 30 29 30 32 31 29 30 31 32 29 30 33 28 31 32 33 34 28 32 33 35 28 31 33 36 28 31 32 37 28 33 38 28 32 39 28 31 40 28 41 29 31 32 33 42 29 32 33 43 29 31 33 44 29 31 32 45 29 33 46 29 32 47 29 31 48 29 49 30 31 32 33 50 30 32 33 51 30 31 33 52 30 31 32 53 30 33 54 30 32 55 30 31 56 30 57 31 32 33 58 32 33 59 31 33 60 31 32 61 33 62 32 63 31
(iv) TIP-1 Epitopes
[0088] In one embodiment, the isolated antibody of the present invention that binds to TIP-1 recognizes an epitope within the amino acid sequence of SEQ ID NO:9. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 9.
[0089] In yet another embodiment, the isolated antibody of the present invention that binds to TIP-1 recognizes an epitope within the amino acid sequence of SEQ ID NO:10. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 10.
[0090] In yet a further embodiment, the isolated antibody of the present invention that binds to TIP-1 recognizes an epitope within the amino acid sequence of SEQ ID NO:11. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 contiguous amino acids of SEQ ID NO:11.
[0091] In an additional embodiment, the isolated antibody of the present invention that binds to TIP-1 recognizes an epitope within the amino acid sequence of SEQ ID NO:12. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 12.
[0092] Yet another embodiment provides for the isolated antibody of the present invention that binds to TIP-1, wherein the antibody recognizes an epitope within the amino acid sequence of SEQ ID NO: 13. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, 9, or 10 contiguous amino acids of SEQ ID NO: 13.
[0093] In still another embodiment, the isolated antibody of the present invention that binds to TIP-1 recognizes an epitope within the amino acid sequence of SEQ ID NO:14. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, 9, 10, 11, or 12 contiguous amino acids of SEQ ID NO:14.
[0094] In another embodiment, the isolated antibody of the present invention that binds to TIP-1 recognizes an epitope within the amino acid sequence of SEQ ID NO:21. For instance, a TIP-1 antibody of the invention may recognize an epitope with 5, 6, 7, 8, or 9 contiguous amino acids of SEQ ID NO: 21.
[0095] In yet another embodiment, an isolated antibody of the invention that binds to TIP-1 is an scFv antibody encoded by a nucleic acid sequence that encodes SEQ ID NO:22 (
[0096] In another embodiment, an isolated antibody of the invention that binds to TIP-1 is an scFv antibody encoded by a nucleic acid sequence that encodes SEQ ID NO:23 (
[0097] Each of the sequences referred to above may be found in Table C below.
TABLE-US-00003 TABLEC SEQ ID NO: Sequence 1 MLLLLSAARA 2 MKLSLVAAML 3 MKLSLVAAMLLLLSAARA 4 EKNILVFDLG 5 GAGGTTCAGCTGCAGCAGTCTGGACCTGAGCTGGTGAAGCC TGGGGCTTCAGTGAAGATATCCTGCAAGGCTTCTGGTTACTC ATTTACTGGCTACTTTATGAACTGGGTGAAGCAGAGCCATGG AAAGAGCCTTGAGTGGATTGGACGTATTGATCCTTACAATGG TAATATTTTCTACAACCAGAAGTTCAAGGGCAAGGCCACATTG ACTGTGGACAAATCCTCTAGCACAGCCCACACGGAGCTCCTG AGCCTGACATCTGAGGACTCTGCAGTCTATTATTGTGGAAGG TCCTATGGTAACTATGCTTTGGACTACTGGGGTCAAGGAACC TCAGTCACCGTCTCCTCA 6 EVQLQQSGPELVKPGASVKISCKASGYSFTGYFMNWVKQSHGK SLEWIGRIDPYNGNIFYNQKFKGKATLTVDKSSSTAHTELLSLTS EDSAVYYCGRSYGNYALDYWGQGTSVTVSS 7 GATGTCCAGATAACCCAGTCTCCATCTTATCTTGCTGCATCTC CTGGAGAAACCATTACTATTAATTGCAGGGCAAGTAAGAGCA TTAGCAAATATTTAGCCTGGTATCAAGAGAAACCTGGGAAAAC TAATAAGCTTCTTATCTACTTTGGATCCACTTTGCAATCTGGG ATTCCATCAAGGTTCAGTGGCAGTGGATCTGGTACAGATTTC ACTCTCACCATCAGTAGCCTGGAGCCTGAAGATTTTGCAATG TATTTCTGTCAACAGCATAATGAATACCCGTACACGTTCGGAG GGGGGACCAAGCTGGAAATGAAA 8 DVQITQSPSYLAASPGETITINCRASKSISKYLAWYQEKPGKTNK LLIYFGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYFCQQ HNEYPYTFGGGTKLEMK 9 QNPFSEDKTD 10 IDQDPSQNPF 11 IDQDPSQNPFSEDKTD 12 EIAGLQIGDK 13 IGDKIMQVNG 14 EIAGLQIGDKIMQVNG 15 SFTGYFMN 16 IGRIDPYNGNIFYNQ 17 AVYYCGRSYGNY 18 GETITINCRA 19 KPGKTNKLLIYF 20 EPEDFAMYFCQQHNE 21 QPVTAVVQRV 22 FFGDFQREKIIIRNSFSCSFLCGPAGHGPGETAAVWGQGTTVTV SSGGGGSGGGGSGGGGSDIELTQSPSTMTASPGEKVTITCRAS SSVSYMHWYQQKPGASPKPWIYDTSKLASGVPDRFSGSGSGT SYSLTINNMEAEDAATYYCQQWNYPSTFGAGTKLEIKPAAAGAP VPYPDPLEPRAATVESCLAKPHTENSFTNVWKDDKTLDRYANY EGCLWNATGVVVCTGDETQCYGTWVPIGLAIPEN 23 FQREKIIIRNSFSCSFLCGPAGHGPGETAAVWGQGTTVTVSSGG GGSGGGGSGGGGSDIELTQSPSTMTASPGEKVTITCRASSSVS YMHWYQQKPGASPKPWIYDTSKLASGVPDRFSGSGSGTSYSL TINNMEAEDAATYYCQQWNYPSTFGAGTKLEIKPAAAGAPVPYP DPLEPRAATVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCL WNATGVVVCTGDETQCYGTWVPI 24 GAAGTGAAGCTTGAGGAGTCTGGAGGAGGCTTGGTGCAACC TGGAGGATCCATGAAACTCTCCTGTGTTGCCTCTGGATTCAC TTTCAGTAACTACTGGATGAACTGGGTCCGCCAGTCTCCAGA GAAGGGGCTTGAGTGGGTTGCTCAAATTAGATTGAAATCTGA TAATTATGCAACACATTATGCGGAGTCTGTGAAAGGGAGGTT CACCATCTCAAGAGATGATTCCAAAAGTAGTGTCTACCTGCAA ATGAACAACTTAAGGGCTGAAGACACTGGAATTTATTACTGCT TACTTTACTACGGTCCTAGCGGGACTGCTTACTGGGGCCAAG GGACTCTGGTCACTGTCTCTGCA 25 EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPE KGLEWVAQIRLKSDNYATHYAESVKGRFTISRDDSKSSVYLQMN NLRAEDTGIYYCLLYYGPSGTAYWGQGTLVTVSA 26 GATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGT CTTGGAGATCAAGCCTCCATCTCTTGCAGATCTAGTCAGAGC CTTGTACACAGTAATGGAAACACCTATTTACATTGGTACCTGC AGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTT CCAACCGATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTG GATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGG CTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGTACACATGT TCCTCGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAAC GG 27 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAED LGVYFCSQSTHVPRTFGGGTKLEIKR 28 SNYWMN 29 QIRLKSDNYATHY 30 GIYYCLLYY 31 SQSLVHSNG 32 KLLIYKVSNRF 33 GVYFCSQST
(c) Humanized Antibodies
[0098] The antibodies of the present invention may also be chimeric antibodies. Preferably, these chimeric antibodies involve the merging of a portion of a monoclonal antibody with antibody-producing DNA in living cells to produce a monoclonal antibody that has material from more than one species of animal. This procedure is well known in the art and any known method to produce chimeric antibodies is suitable for purposes of the present invention. In a preferred embodiment, the chimeric antibody comprises mouse elements conjugated to the genetic material of another species. In a particularly preferred embodiment, the chimeric antibody comprises mouse and human elements to form humanized antibodies. The process of humanization decreases the potential for the antibody to induce an immune response in a human host.
[0099] As used herein humanized antibody includes an anti-GRP78 or anti-TIP-1 antibody that is composed partially or fully of amino acid sequences derived from a human antibody germline by altering the sequence of an antibody having non-human complementarity determining regions (CDR). The simplest such alteration may consist simply of substituting the constant region of a human antibody for the murine constant region, thus resulting in a human/murine chimera which may have sufficiently low immunogenicity to be acceptable for pharmaceutical use. Preferably, however, the variable region of the antibody and even the CDR is also humanized by techniques that are by now well known in the art. The framework regions of the variable regions are substituted by the corresponding human framework regions leaving the non-human CDR substantially intact, or even replacing the CDR with sequences derived from a human genome. CDRs may also be randomly mutated such that binding activity and affinity for GRP78 or TIP-1 is maintained or enhanced in the context of fully human germline framework regions or framework regions that are substantially human. Substantially human frameworks have at least 90%, 95%, or 99% sequence identity with a known human framework sequence. Fully useful human antibodies are produced in genetically modified mice whose immune systems have been altered to correspond to human immune systems. As mentioned above, it is sufficient for use in the methods of this discovery, to employ an immunologically specific fragment of the antibody, including fragments representing single chain forms.
[0100] If desired, the design of humanized immunoglobulins may be carried out as follows. When an amino acid falls under the following category, the framework amino acid of a human immunoglobulin to be used (acceptor immunoglobulin) is replaced by a framework amino acid from a CDR-providing nonhuman immunoglobulin (donor immunoglobulin): (a) the amino acid in the human framework region of the acceptor immunoglobulin is unusual for human immunoglobulin at that position, whereas the corresponding amino acid in the donor immunoglobulin is typical for human immunoglobulin at that position; (b) the position of the amino acid is immediately adjacent to one of the CDRs; or (c) any side chain atom of a framework amino acid is within about 5-6 angstroms (center-to-center) of any atom of a CDR amino acid in a three dimensional immunoglobulin model (Queen, et al., op. cit., and Co, ct al, Proc. Natl. Acad. Sci. USA (1991) 88: 2869). When each of the amino acids in the human framework region of the acceptor immunoglobulin and a corresponding amino acid in the donor immunoglobulin is unusual for human immunoglobulin at that position, such an amino acid is replaced by an amino acid typical for human immunoglobulin at that position.
[0101] One embodiment of the present invention encompasses a humanized antibody that binds to GRP78. In particular, an embodiment of the invention encompasses a humanized antibody where amino acids in the framework region of either the heavy or light chain variable regions are humanized, leaving the CDRs intact. For instance, in one embodiment, an antibody may comprise a combination of CDRs listed in Table A, and a humanized framework region. In another embodiment, the sequence of one or more CDR regions may be humanized as well as the framework region.
[0102] In an exemplary embodiment, a humanized GRP78 antibody recognizes at least one epitope from the group consisting of SEQ ID NO:1, 2, 3, or 4.
[0103] In an alternative embodiment, the present invention encompasses a humanized antibody that binds to TIP-1. In particular, an embodiment of the invention encompasses a humanized antibody where amino acids in the framework region of either the heavy or light chain variable regions are humanized, leaving the CDRs intact. For instance, in one embodiment, an antibody may comprise a combination of CDRs listed in Table B, and a humanized framework region. In another embodiment, the sequence of one or more CDR regions may be humanized as well as the framework region.
[0104] In an exemplary embodiment, a humanized TIP-1 antibody recognizes at least one epitope from the group consisting of SEQ ID NO:9, 10, 11, 12, 13, 14, or 21.
[0105] In another alternative embodiment, the present invention encompasses a scFV antibody that binds TIP-1.
(d) Antibody Conjugates
[0106] In another aspect, an antibody of the present invention is conjugated to a therapeutic agent. In some embodiments, a scFv of the present invention is conjugated to a therapeutic agent. The therapeutic agent preferably reduces or interferes with tumor growth or otherwise reduces the effect of the tumor within the body or organism. A therapeutic agent that reduces the symptoms produced by the tumor or reduces tumor growth is suitable for the present invention.
[0107] Additionally, any therapeutic agent that reduces the symptoms associated with tumor cell growth will work for purposes of the present invention. Non-limiting examples of therapeutic agents may include drugs, therapeutic compounds, genetic materials, metals (such as radioactive isotopes), proteins, peptides, carbohydrates, lipids, steroids, nucleic acid based materials, or derivatives, analogues, or combinations thereof in their native form or derivatized with hydrophobic or charged moieties to enhance incorporation or adsorption into a cell. Such therapeutic agents may be water soluble or may be hydrophobic. Non-limiting examples of therapeutic agents may include immune-related agents, thyroid agents, respiratory products, antineoplastic agents, anti-helmintics, anti-malarials, mitotic inhibitors, hormones, anti-protozoans, anti-tuberculars, cardiovascular products, blood products, biological response modifiers, anti-fungal agents, vitamins, peptides, anti-allergic agents, anti-coagulation agents, circulatory drugs, metabolic potentiators, anti-virals, anti-anginals, antibiotics, anti-inflammatories, anti-rheumatics, narcotics, cardiac glycosides, neuromuscular blockers, sedatives, local anesthetics, general anesthetics, or radioactive atoms or ions. Non-limiting examples of therapeutic agents are included in Table D below. An isolated antibody of the present invention may be conjugated to one, two, three, four, or five therapeutic agents. Methods of conjugating an antibody to a therapeutic agent are known in the art. Generally speaking, the conjugation should not interfere with the antibody recognizing its target, and should not interfere with the active site of the target. In some instances, a scFv may be generated with a cleavable linkage between the scFv and therapeutic agent. Such a linker may allow release of the therapeutic agent at a specific cellular location.
TABLE-US-00004 TABLE D Non-limiting Examples of Therapeutic Agents Therapeutic Agent Non-limiting examples Immune-related immune serums, antitoxins, antivenoms bacterial agents vaccines, viral vaccines, rabies prophylaxis products thyroid agents iodine products and anti-thyroid agents respiratory products xanthine derivatives theophylline and aminophylline antineoplastic agents platinum compounds (e.g., spiroplatin, cisplatin, and carboplatin), methotrexate, fluorouracil, adriamycin, mitomycin, ansamitocin, bleomycin, cytosine arabinoside, arabinosyl adenine, mercaptopolylysine, vincristine, busulfan, chlorambucil, melphalan (e.g., PAM, L-PAM or phenylalanine mustard), mercaptopurine, mitotane, procarbazine hydrochloride dactinomycin (actinomycin D), daunorubicin hydrochloride, doxorubicin hydrochloride, paclitaxel and other taxenes, rapamycin, manumycin A, TNP-470, plicamycin (mithramycin), aminoglutethimide, estramustine phosphate sodium, flutamide, leuprolide acetate, megestrol acetate, tamoxifen citrate, testolactone, trilostane, amsacrine (m-AMSA), asparaginase (L- asparaginase) Erwina asparaginase, interferon -2a, interferon -2b, teniposide (VM-26), vinblastine sulfate (VLB), vincristine sulfate, bleomycin sulfate, hydroxyurea, procarbazine, and dacarbazine anti-helmintics pyrantel pamoate, piperazine, tetrachloroethylene, thiabendazole, niclosamide antimalarials Chloroquine, amodiaquine, antifolate drugs, proguanil (chloroguanide), mefloquine, quinine, halofantrine, artemesinin and derivaties, primaquine, doxycycline, tetracycline, and clindamycin mitotic inhibitors etoposide, colchicine, and the vinca alkaloids hormones androgens, progestins, estrogens and antiestrogens, growth hormone, melanocyte stimulating hormone, estradiol, beclomethasone dipropionate, betamethasone, betamethasone acetate and betamethasone sodium phosphate, vetamethasone disodium phosphate, vetamethasone sodium phosphate, cortisone acetate, dexamethasone, dexamethasone acetate, dexamethasone sodium phosphate, flunisolide, hydrocortisone, hydrocortisone acetate, hydrocortisone cypionate, hydrocortisone sodium phosphate, hydrocortisone sodium succinate, methylprednisolone, methylprednisolone acetate, methylprednisolone sodium succinate, paramethasone acetate, prednisolone, prednisolone acetate, prednisolone sodium phosphate, prednisolone tebutate, prednisone, triamcinolone, triamcinolone acetonide, triamcinolone diacetate, triamcinolone hexacetonide, fludrocortisone acetate, oxytocin, vassopressin, glucagon and their derivatives antiprotozoans chloroquine, hydroxychloroquine, metronidazole, quinine and meglumine antimonite antituberculars para-aminosalicylic acid, isoniazid, capreomycin sulfate cycloserine, ethambutol hydrochloride ethionamide, pyrazinamide, rifampin, and streptomycin sulfate cardiovascular chelating agents and mercurial diuretics and cardiac products glycosides blood products parenteral iron, hemin, hematoporphyrins and their derivatives biological response muramyldipeptide, muramyltripeptide, microbial modifiers cell wall components, lymphokines (e.g., bacterial endotoxin such as lipopolysaccharide, macrophage activation factor), sub-units of bacteria (such as Mycobacteria, Corynebacteria), the synthetic dipeptide N-acetyl-muramyl-L-alanyl-D- isoglutamine anti-fungal agents ketoconazole, nystatin, griseofulvin, flucytosine (5- fc), miconazole, amphotericin B, ricin, cyclosporins, and -lactam antibiotics (e.g., sulfazecin) vitamins cyanocobalamin neinoic acid, retinoids and derivatives such as retinol palmitate, and - tocopherol peptides manganese super oxide dismutase; enzymes such as alkaline phosphatase anti-allergic agents Amelexanox anti-coagulation phenprocoumon and heparin agents circulatory drugs Propranolol metabolic Glutathione potentiators antivirals acyclovir, amantadine azidothymidine (AZT, DDI, Foscarnet, or Zidovudine), ribavirin and vidarabine monohydrate (adenine arabinoside, ara-A) antianginals diltiazem, nifedipine, verapamil, erythritol tetranitrate, isosorbide dinitrate, nitroglycerin (glyceryl trinitrate) and pentaerythritol tetranitrate antibiotics dapsone, chloramphenicol, neomycin, cefaclor, cefadroxil, cephalexin, cephradine erythromycin, clindamycin, lincomycin, amoxicillin, ampicillin, bacampicillin, carbenicillin, dicloxacillin, cyclacillin, picloxacillin, hetacillin, methicillin, nafcillin, oxacillin, penicillin including penicillin G and penicillin V, ticarcillin rifampin, aminoglycosides and tetracycline antiinflammatories diflunisal, ibuprofen, indomethacin, meclofenamate, mefenamic acid, naproxen, oxyphenbutazone, phenylbutazone, piroxicam, sulindac, tolmetin, aspirin and salicylates antirheumatics Adalimumab, azathioprine, chloroquine and hydroxychloroquine (antimalarials), cyclosporine (Cyclosporin A), D-penicillamine, etanercept, gold salts (sodium aurothiomalate, auranofin), infliximab, leflunomide, methotrexate, minocycline (a tetracycline antibiotic), sulfasalazine narcotics Paregoric, opiates, codeine, heroin, methadone, morphine and opium cardiac glycosides deslanoside, digitoxin, digoxin, digitalin and digitalis neuromuscular atracurium mesylate, gallamine triethiodide, blockers hexafluorenium bromide, metocurine iodide, pancuronium bromide, succinylcholine chloride (suxamethonium chloride), tubocurarine chloride and vecuronium bromide sedatives amobarbital, amobarbital sodium, aprobarbital, (hypnotics) butabarbital sodium, chloral hydrate, ethchlorvynol, ethinamate, flurazepam hydrochloride, glutethimide, methotrimeprazine hydrochloride, methyprylon, midazolam hydrochloride, paraldehyde, pentobarbital, pentobarbital sodium, phenobarbital sodium, secobarbital sodium, talbutal, temazepam and triazolam local anesthetics bupivacaine hydrochloride, chloroprocaine hydrochloride, etidocaine hydrochloride, lidocaine hydrochloride, mepivacaine hydrochloride, procaine hydrochloride and tetracaine hydrochloride general anesthetics droperidol, etomidate, fentanyl citrate with droperidol, ketamine hydrochloride, methohexital sodium and thiopental sodium radioactive particles strontium, iodide rhenium, yttrium, and or ions radiopharmaceuticals, such as radioactive iodine, copper and phosphorus product
II. Method of Use
[0108] In another aspect, an isolated antibody of the present invention, as described above, may be used in treating and preventing cancer and associated diseases in a subject. The antibodies of the present invention may be conjugated to radioisotopes or chemotherapeutic compounds in order to provide specific delivery of radiation and chemotherapy to the site of a tumor. Further, the antibodies of the present invention may be part of a combination therapy. Preferably, a combination therapy would include the use of the antibody of the present invention along with a radiation therapy or chemotherapy course of treatment. It has also been suggested that monoclonal antibodies, such as those described herein, may increase the susceptibility of tumor cells to the effects of chemotherapy or radiation. In preferred embodiments, the antibodies of the invention may be used to enhance the efficacy of cancer radiotherapy.
[0109] In yet another aspect, the present invention provides a method of imaging a cancer. As such, an antibody of the invention may be conjugated to an imaging agent. For instance, an scFv may be conjugated to an imaging agent. Suitable imaging agents may include, but are not limited to, imaging/tracking agents that may be used for microscopy, e.g. fluorescent microscopy, confocal microscopy, or electron microscopy, magnetic resonance imaging, tomography, such as gamma (SPECT/CT, planar) and positron emission tomography (PET/CT), radiography, or ultrasound. Imaging/tracking agents may be detectable in situ, in vivo, ex vivo, and in vitro. In general, imaging/tracking agents may include luminescent molecules, chemiluminescent molecules, fluorochromes, fluorescent quenching agents, colored molecules, radioisotopes, scintillants, massive labels (for detection via mass changes), biotin, avidin, streptavidin, protein A, protein G, antibodies or fragments thereof, Grb2, polyhistidine, Ni2+, Flag tags, myc tags, heavy metals, enzymes, alkaline phosphatase, peroxidase, luciferase, electron donors/acceptors, acridinium esters, and colorimetric substrates. The skilled artisan would readily recognize other useful labels that are not mentioned above, which may be employed in the operation of the present invention.
[0110] The antibodies are as described in Section I above. The subject, the cancer, and the administration of the antibodies are described below.
(a) Subject
[0111] A method of the invention may be used to detect or treat a tumor in a subject that is a human, a livestock animal, a companion animal, a lab animal, or a zoological animal. In one embodiment, the subject may be a rodent, e.g. a mouse, a rat, a guinea pig, etc. In another embodiment, the subject may be a livestock animal. Non-limiting examples of suitable livestock animals may include pigs, cows, horses, goats, sheep, llamas and alpacas. In yet another embodiment, the subject may be a companion animal. Non-limiting examples of companion animals may include pets such as dogs, cats, rabbits, and birds. In yet another embodiment, the subject may be a zoological animal. As used herein, a zoological animal refers to an animal that may be found in a zoo. Such animals may include non-human primates, large cats, wolves, and bears. In preferred embodiments, the animal is a laboratory animal. Non-limiting examples of a laboratory animal may include rodents, canines, felines, and non-human primates. In certain embodiments, the animal is a rodent. Non-limiting examples of rodents may include mice, rats, guinea pigs, etc. The genotype of the sterile animal can and may vary depending on the intended use of the animal. In embodiments where the animal is a mouse, the mouse may be a C57BL/6 mouse, a Balb/c mouse, a 129sv mouse, a GL261 tumor bearing mouse, a D54 tumor bearing mouse, or any other laboratory strain.
(b) Tumor
[0112] An antibody of the invention may be used to treat or recognize tumor derived from a neoplasm or a cancer. The neoplasm may be malignant or benign, the cancer may be primary or metastatic; the neoplasm or cancer may be early stage or late stage. Non-limiting examples of neoplasms or cancers that may be treated include acute lymphoblastic leukemia, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytomas (childhood cerebellar or cerebral), basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brainstem glioma, brain tumors (cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic gliomas), breast cancer, bronchial adenomas/carcinoids, Burkitt lymphoma, carcinoid tumors (childhood, gastrointestinal), carcinoma of unknown primary, central nervous system lymphoma (primary), cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, cervical cancer, childhood cancers, chronic lymphocytic leukemia, chronic myelogenous leukemia, chronic myeloproliferative disorders, colon cancer, cutaneous T-cell lymphoma, desmoplastic small round cell tumor, endometrial cancer, ependymoma, esophageal cancer, Ewing's sarcoma in the Ewing family of tumors, extracranial germ cell tumor (childhood), extragonadal germ cell tumor, extrahepatic bile duct cancer, eye cancers (intraocular melanoma, retinoblastoma), gallbladder cancer, gastric (stomach) cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, germ cell tumors (childhood extracranial, extragonadal, ovarian), gestational trophoblastic tumor, gliomas (adult, childhood brain stem, childhood cerebral astrocytoma, childhood visual pathway and hypothalamic), gastric carcinoid, hairy cell leukemia, head and neck cancer, hepatocellular (liver) cancer, Hodgkin lymphoma, hypopharyngeal cancer, hypothalamic and visual pathway glioma (childhood), intraocular melanoma, islet cell carcinoma, Kaposi sarcoma, kidney cancer (renal cell cancer), laryngeal cancer, leukemias (acute lymphoblastic, acute myeloid, chronic lymphocytic, chronic myelogenous, hairy cell), lip and oral cavity cancer, liver cancer (primary), lung cancers (non-small cell, small cell), lymphomas (AIDS-related, Burkitt, cutaneous T-cell, Hodgkin, non-Hodgkin, primary central nervous system), macroglobulinemia (Waldenstrm), malignant fibrous histiocytoma of bone/osteosarcoma, medulloblastoma (childhood), melanoma, intraocular melanoma, Merkel cell carcinoma, mesotheliomas (adult malignant, childhood), metastatic squamous neck cancer with occult primary, mouth cancer, multiple endocrine neoplasia syndrome (childhood), multiple myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplastic syndromes, myelodysplastic/myeloproliferative diseases, myelogenous leukemia (chronic), myeloid leukemias (adult acute, childhood acute), multiple myeloma, myeloproliferative disorders (chronic), nasal cavity and paranasal sinus cancer, nasopharyngeal carcinoma, neuroblastoma, non-Hodgkin lymphoma, non-small cell lung cancer, oral cancer, oropharyngeal cancer, osteosarcoma/malignant fibrous histiocytoma of bone, ovarian cancer, ovarian epithelial cancer (surface epithelial-stromal tumor), ovarian germ cell tumor, ovarian low malignant potential tumor, pancreatic cancer, pancreatic cancer (islet cell), paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytoma, pineal astrocytoma, pineal germinoma, pineoblastoma and supratentorial primitive neuroectodermal tumors (childhood), pituitary adenoma, plasma cell neoplasia, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell carcinoma (kidney cancer), renal pelvis and ureter transitional cell cancer, retinoblastoma, rhabdomyosarcoma (childhood), salivary gland cancer, sarcoma (Ewing family of tumors, Kaposi, soft tissue, uterine), Szary syndrome, skin cancers (nonmelanoma, melanoma), skin carcinoma (Merkel cell), small cell lung cancer, small intestine cancer, soft tissue sarcoma, squamous cell carcinoma, squamous neck cancer with occult primary (metastatic), stomach cancer, supratentorial primitive neuroectodermal tumor (childhood), T-Cell lymphoma (cutaneous), testicular cancer, throat cancer, thymoma (childhood), thymoma and thymic carcinoma, thyroid cancer, thyroid cancer (childhood), transitional cell cancer of the renal pelvis and ureter, trophoblastic tumor (gestational), unknown primary site (adult, childhood), ureter and renal pelvis transitional cell cancer, urethral cancer, uterine cancer (endometrial), uterine sarcoma, vaginal cancer, visual pathway and hypothalamic glioma (childhood), vulvar cancer, Waldenstrm macroglobulinemia, and Wilms tumor (childhood). In preferred embodiments, the neoplasm or cancer is non-small cell lung carcinoma.
(c) Administration
[0113] In certain aspects, a pharmacologically effective amount of an antibody of the invention, including immunologically reactive fragments, may be administered to a subject. Administration is performed using standard effective techniques, including peripherally (i.e. not by administration into the central nervous system) or locally to the central nervous system. Peripheral administration includes but is not limited to intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. Local administration, including directly into the central nervous system (CNS) includes but is not limited to via a lumbar, intraventricular or intraparenchymal catheter or using a surgically implanted controlled release formulation.
[0114] Pharmaceutical compositions for effective administration are deliberately designed to be appropriate for the selected mode of administration, and pharmaceutically acceptable excipients such as compatible dispersing agents, buffers, surfactants, preservatives, solubilizing agents, isotonicity agents, stabilizing agents and the like are used as appropriate. Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton Pa., 16Ed ISBN: 0-912734-04-3, latest edition, incorporated herein by reference in its entirety, provides a compendium of formulation techniques as are generally known to practitioners. It may be particularly useful to alter the solubility characteristics of the antibodies useful in this discovery, making them more lipophilic, for example, by encapsulating them in liposomes or by blocking polar groups.
[0115] Effective peripheral systemic delivery by intravenous or intraperitoneal or subcutaneous injection is a preferred method of administration to a living patient. Suitable vehicles for such injections are straightforward. In addition, however, administration may also be effected through the mucosal membranes by means of nasal aerosols or suppositories. Suitable formulations for such modes of administration are well known and typically include surfactants that facilitate cross-membrane transfer. Such surfactants are often derived from steroids or are cationic lipids, such as N-[1-(2,3-dioleoyl)propyl]-N,N,N-trimethyl ammonium chloride (DOTMA) or various compounds such as cholesterol hemisuccinate, phosphatidyl glycerols and the like.
[0116] The concentration of antibody in formulations to be administered is an effective amount and ranges from as low as about 0.1% by weight to as much as about 15 or about 20% by weight and will be selected primarily based on fluid volumes, viscosities, and so forth, in accordance with the particular mode of administration selected if desired. A typical composition for injection to a living patient could be made up to contain 1 mL sterile buffered water of phosphate buffered saline and about 1-1000 mg of any one of or a combination of the humanized antibody of the present discovery. The formulation could be sterile filtered after making the formulation, or otherwise made microbiologically acceptable. A typical composition for intravenous infusion could have volumes between 1-250 mL of fluid, such as sterile Ringer's solution, and 1-100 mg per ml, or more in anti-GRP78 or anti-TIP-1 antibody concentration. Therapeutic agents of the discovery can be frozen or lyophilized for storage and reconstituted in a suitable sterile carrier prior to use. Lyophilization and reconstitution may lead to varying degrees of antibody activity loss (e.g. with conventional immune globulins, IgM antibodies tend to have greater activity loss than IgG antibodies). Dosages administered are effective dosages and may have to be adjusted to compensate. The pH of the formulations generally pharmaceutical grade quality, will be selected to balance antibody stability (chemical and physical) and comfort to the patient when administered. Generally, a pH between 4 and 8 is tolerated. Doses will vary from individual to individual based on size, weight, and other physiobiological characteristics of the individual receiving the successful administration.
[0117] As used herein, the term effective amount means an amount of a substance such as a compound that leads to measurable and beneficial effects for the subject administered the substance, i.e., significant efficacy. The effective amount or dose of compound administered according to this discovery will be determined by the circumstances surrounding the case, including the compound administered, the route of administration, the status of the symptoms being treated and similar patient and administration situation considerations among other considerations.
[0118] In some embodiments, when the antibody is an anti-TIP-1 antibody labeled with .sup.64Cu, the dose administered may be about 0.01, 0.02, 0.03, 0.04, 0.05 0.06, 0.07, 0.08, 0.09, 0.1, 0.011, 0.012, 0.013, 0.013, 0.014, 0.015, 0.016, 0.017, 0.018, 0.019, 0.02, 0.021, 0.022, 0.023, 0.023, 0.024, 0.025, 0.026, 0.027, 0.028, 0.029, 0.03, 0.031, 0.032, 0.033, 0.033, 0.034, 0.035, 0.036, 0.037, 0.038, 0.039, 0.04, 0.041, 0.042, 0.043, 0.043, 0.044, 0.045, 0.046, 0.047, 0.048, 0.049, 0.05, 0.051, 0.052, 0.053, 0.053, 0.054, 0.055, 0.056, 0.057, 0.058, 0.059, 0.06, 0.061, 0.062, 0.063, 0.063, 0.064, 0.065, 0.066, 0.067, 0.068, 0.069, 0.07, 0.071, 0.072, 0.073, 0.073, 0.074, 0.075, 0.076, 0.077, 0.078, 0.079, 0.08, 0.081, 0.082, 0.083, 0.083, 0.084, 0.085, 0.086, 0.087, 0.088, 0.089, 0.09, 0.091, 0.092, 0.093, 0.093, 0.094, 0.095, 0.096, 0.097, 0.098, 0.099, or about 0.1 rem/mCi.
[0119] In some embodiments, when the antibody is an anti-GRP78 labeled with .sup.64Cu, the dose administered may be about 0.01, 0.02, 0.03, 0.04, 0.05 0.06, 0.07, 0.08, 0.09, 0.1, 0.011, 0.012, 0.013, 0.013, 0.014, 0.015, 0.016, 0.017, 0.018, 0.019, 0.02, 0.021, 0.022, 0.023, 0.023, 0.024, 0.025, 0.026, 0.027, 0.028, 0.029, 0.03, 0.031, 0.032, 0.033, 0.033, 0.034, 0.035, 0.036, 0.037, 0.038, 0.039, 0.04, 0.041, 0.042, 0.043, 0.043, 0.044, 0.045, 0.046, 0.047, 0.048, 0.049, 0.05, 0.051, 0.052, 0.053, 0.053, 0.054, 0.055, 0.056, 0.057, 0.058, 0.059, 0.06, 0.061, 0.062, 0.063, 0.063, 0.064, 0.065, 0.066, 0.067, 0.068, 0.069, 0.07, 0.071, 0.072, 0.073, 0.073, 0.074, 0.075, 0.076, 0.077, 0.078, 0.079, 0.08, 0.081, 0.082, 0.083, 0.083, 0.084, 0.085, 0.086, 0.087, 0.088, 0.089, 0.09, 0.091, 0.092, 0.093, 0.093, 0.094, 0.095, 0.096, 0.097, 0.098, 0.099, or about 0.1 rem/mCi.
[0120] The frequency of dosing may be daily or once, twice, three times or more per week or per month, as needed as to effectively treat the symptoms. The timing of administration of the treatment relative to the disease itself and duration of treatment will be determined by the circumstances surrounding the case. Treatment could begin immediately, such as at the site of the injury as administered by emergency medical personnel. Treatment could begin in a hospital or clinic itself, or at a later time after discharge from the hospital or after being seen in an outpatient clinic. Duration of treatment could range from a single dose administered on a one-time basis to a life-long course of therapeutic treatments.
[0121] Although the foregoing methods appear the most convenient and most appropriate and effective for administration of proteins such as antibodies, by suitable adaptation, other effective techniques for administration, such as intraventricular administration, transdermal administration and oral administration may be employed provided proper formulation is utilized herein.
[0122] In addition, it may be desirable to employ controlled release formulations using biodegradable films and matrices, or osmotic mini-pumps, or delivery systems based on dextran beads, alginate, or collagen.
[0123] Typical dosage levels can be determined and optimized using standard clinical techniques and will be dependent on the mode of administration.
Definitions
[0124] As used herein, antibody refers to an immunoglobulin derived molecule that specifically recognizes either GRP78 or TIP-1. An antibody of the invention may be a full length antibody (IgM, IgG, IgA, IgE) or may be an antibody fragment (Fab, F(ab')2, scFv). An antibody may be chimeric or may be humanized.
[0125] As used herein, CDR means complementary determining region. CDRs may also be referred to as hypervariable regions.
[0126] As used herein, light chain is the small polypeptide subunit of the antibody. A typical antibody comprises two light chains and two heavy chains.
[0127] As used herein, the heavy chain is the large polypeptide subunit of the antibody. The heavy chain of an antibody contains a series of immunoglobulin domains, with at least one variable domain and at least one constant domain.
[0128] Humanized, as used herein, refers to the process where monoclonal antibodies are produced using recombinant DNA to create constructs capable of expression in human cell culture. Any known techniques for producing these constructs will work for purposes of the present invention.
[0129] As used herein, single chain variable fragments or scFv or scFvs, refer to fusion proteins of the variable regions of the heavy and light chains of immunoglobulins connected via a linker. In some embodiment, the linker is a peptide of about 10 to 25 amino acids.
[0130] A therapeutic agent for purposes of the present invention, refers to an agent that reduces tumor growth, any related cancer growth, or reduces the symptoms associated with cancerous cell growth. The therapeutic agent that is preferably conjugated to the antibody of the present invention is preferably a biologic, pharmaceutical or chemical agent. A non-limiting list of therapeutic agents that may be suitable for use in the present invention is described above.
[0131] As used herein, imaging agent refers to any agent that can be used to locate and produce an image of cancerous cell growth or tumors. A non-limiting list of imagining agents that may be suitable for use in the present invention is described above.
EXAMPLES
[0132] The following examples illustrate various iterations of the invention.
Materials and Methods
[0133] Tumor model
[0134] GL261 murine glioma cancer cell line was purchased from American Type Culture Collection. D54 cells were similarly purchased commercially. Heterotopic tumor models were developed by s.c. inoculating cell suspensions (610.sup.6 cells) into nude or C57/B16 mice.
Near IR Imaging
[0135] Tumor-bearing mice were treated with anywhere from one to three once-daily doses of 3 Gy XRT or sham XRT (three per group) and injected with peptide or antibody 3 hours after the last XRT treatment. Mice were then injected with an antibody to 78-kDa glucose-regulated protein (GRP78) conjugated with AlexaFluor750 and tumors were removed 7 days after labeled antibody injection; polyclonal serum IgG antibody was used as a control. Near IR images were taken using the IVIS imaging system with an ICG filter setting at various time points after the injection.
Anti-TIP-1 and anti-GRP78 Monoclonal Antibody Production and Purification.
[0136] BALB/C mice were initially immunized with 50 mg of TIP-1 or GRP78 antigen mixed with equivalent amounts of Titermax adjuvant (CytRx Corporation) for each mouse. One month after initial immunization, mice were boosted with equivalent amounts of antigen without adjuvant two to three times at two week intervals. The mouse polyclonal antibody titer was evaluated by ELISA and Western blot methods. Mice exhibiting high immune response to either antigen were chosen as B cell donors. Spleens were removed and homogenized in RPMI 1640 culture medium free of serum and other additives. Spleen cells were combined with Sp2/0 mouse myeloma (210.sup.7 per spleen). Mixed cells were washed twice and centrifuged at 1200 rpm for 8 minutes at room temperature. Supernatant was removed, and the cell pellet was lightly agitated to loosen the cells. Approximately 1 ml PEG (polyethylene glycol 1500) (Roche) was added to fuse the cells. The fused cells were washed once with plain medium and finally re-suspended in RPMI 1640 medium supplemented with 10% fetal bovine serum (Gemini Bioproducts, CA), L-glutamine, antibiotics and HAT (Sigma), plated into 24 well tissue culture plates and incubated at 37 C. in a humidified CO.sub.2 incubator. Fifteen days after fusion, hybridoma culture supernatants were removed from individual wells and transferred to separate 96 well microtiter plates for ELISA, Western blot and antibody printing assays against TIP-1 antigen. Hybridomas that produced antibodies positive by immunoassay were chosen for sub-cloning by using limiting dilution. Resulting single-cell clones were retested by the aforementioned methods to detect antigen-positive monoclonal antibody-producing hybridomas. Positive hybridoma clones were transferred to individual flasks to expand cell number from one cell clone, and incubated with serum-free medium for antibody production. The antibodies produced by positive clones in serum-free medium were harvested twice a week for further monoclonal antibody purification. Filtered monoclonal antibody collected from serum-free medium was purified by protein A and protein G columns. The concentrated purified monoclonal antibody was assayed and stored at 20 C.
Example 1
GRP78
[0137] A monoclonal antibody against GRP78 was created, and named 2D6F9. The antibody comprised a heavy chain variable region amino acid sequence of SEQ ID NO:6 (minus the leader sequence) and a light chain variable region amino acid sequence of SEQ ID NO:8 (minus the leader sequence) (
[0138]
[0139] The distribution of .sup.64Cu-anti-GRP78 antibody 2D6F9 was measured. Mice were administered 50 g of .sup.64Cu-anti-GRP78 antibody 2D6F9 and imaged at 24 (
Example 2
TIP-1
[0140] At least three monoclonal antibodies against TIP-1 were created, and named 1A6H14, 3A415, and 2C6F3. Epitope mapping was performed to determine that 1A6H14 recognized SEQ ID NO: 9, 10, and 11 derived from human TIP-1, that 3A415 recognized SEQ ID NO: 12, 13, and 14 derived from human TIP-1, and that 2C6F3 recognized SEQ ID NO:21 derived from human TIP-1 (see Table C).
[0141] The antibodies were shown to recognize irradiated tumor cells compared to non-irradiated tumor tissue or normal tissue (either irradiated or non-irradiated). Specifically, anti-TIP-1 monoclonal antibody, 2C6F3, showed binding by flow cytometry to human glioblastoma D54 cells (WHO grade IV) (
[0142] CT/SPECT imaging with .sup.111n-DTPA was performed with the anti-TIP-1 2C6F3 monoclonal antibody. LLC (Lewis lung carcinoma) tumors were grown to approximately 1 cm.sup.3 in C57/BL mice. Two groups of mice each containing 3 mice were utilized. Group 1 mice were irradiated with 3Gy3 over 24 hours. Group 2 mice were sham non-irradiated. .sup.111In was labeled with DTPA-2C6F3 TIP-1 antibody with a final specific activity of 0.7 Ci/g.
Example 3
Dosimetry of Labeled Anti-GRP78 2D6F9 Antibody
Biodistribution in Healthy Mice
[0143] Human radiation dosimetry estimates were calculated from animal biodistribution data obtained by standard method of organ dissection and using the standard MIRD methodology. Animal biodistribution data was obtained using 30 C57 mature male mice injected with 16 Ci/100 L of .sup.64Cu-DOTA-2D6F9 antibody divided in 6 groups of 5 animals. The average animal mouse weight was 25.0 g. Animals were euthanized and organs were harvested in groups of five at the following time points: 1, 2, 6, 12, 24 and 48 hours post injection. The following organs were harvested, weighed and counted for radio-activity in a gamma counter: blood, lungs, liver, spleen, kidneys, bladder, muscle, fat, heart, brain, bone, red marrow, testes, adrenals, thyroid, pancreas, stomach, small intestines, and upper and lower large intestines. The animals were maintained in metabolic cages where urine and feces excretion were collected, weighed and counted for radio-activity. The biodistribution data are presented in Table 1.
TABLE-US-00005 TABLE 1 Organ activity concentration from mice dissection expressed in percent injected per gram of tissue. Organ 1 hr 2 hr 6 hr 12 hr 24 hr 48 hr Blood 18.8 +/ 1.5 15.6 +/ 1.9 15.8 +/ 3.0 11.1 +/ 0.6 6.78 +/ 2.94 7.51 +/ 2.04 Lung 6.12 +/ 1.08 6.35 +/ 2.01 6.63 +/ 1.77 6.90 +/ 2.67 3.37 +/ 1.28 5.11 +/ 2.57 Liver 18.9 +/ 2.1 17.5 +/ 2.3 18.4 +/ 4.4 10.3 +/ 0.6 12.6 +/ 1.8 9.70 +/ 1.48 Spleen 11.4 +/ 2.9 9.80 +/ 2.65 12.8 +/ 2.0 7.98 +/ 0.77 7.87 +/ 1.29 5.54 +/ 1.76 Kidney 9.44 +/ 0.87 8.66 +/ 1.01 8.41 +/ 1.36 5.61 +/ 0.46 5.12 +/ 0.56 4.20 +/ 0.55 Bladder 67.6 +/ 56.1 32.6 +/ 20.2 10.8 +/ 7.4 1.60 +/ 0.15 1.90 +/ 0.85 2.11 +/ 0.45 Muscle 0.51 +/ 0.18 0.57 +/ 0.12 0.93 +/ 0.23 0.97 +/ 0.09 0.94 +/ 0.31 0.84 +/ 0.18 Fat 1.27 +/ 0.37 1.39 +/ 0.31 1.23 +/ 0.30 1.33 +/ 0.53 1.34 +/ 0.45 1.05 +/ 0.35 Heart 3.95 +/ 1.05 4.11 +/ 0.75 4.35 +/ 0.57 3.01 +/ 0.34 1.81 +/ 0.76 2.30 +/ 0.62 Brain 0.64 +/ 0.18 0.54 +/ 0.07 0.53 +/ 0.08 0.42 +/ 0.13 0.25 +/ 0.08 0.30 +/ 0.08 Bone 2.60 +/ 0.35 2.72 +/ 0.56 2.55 +/ 0.58 1.73 +/ 0.17 1.52 +/ 0.40 1.68 +/ 0.46 Marrow 6.75 +/ 1.06 6.50 +/ 4.02 5.67 +/ 2.19 3.84 +/ 1.55 3.85 +/ 0.82 10.2 +/ 5.4 Testes 1.36 +/ 0.22 1.63 +/ 0.17 1.77 +/ 0.41 1.45 +/ 0.09 1.12 +/ 0.36 1.15 +/ 0.26 Adrenals 5.11 +/ 0.36 4.50 +/ 1.27 5.06 +/ 1.54 3.36 +/ 0.75 2.69 +/ 0.55 3.40 +/ 1.71 Thyroid 4.00 +/ 1.20 4.04 +/ 1.43 3.52 +/ 0.96 3.81 +/ 1.29 2.11 +/ 1.40 1.42 +/ 0.49 Pancreas 1.36 +/ 0.12 1.26 +/ 0.30 1.78 +/ 0.61 1.47 +/ 0.12 1.17 +/ 0.54 1.25 +/ 0.28 Stomach 1.40 +/ 0.08 1.41 +/ 0.29 1.38 +/ 0.33 1.13 +/ 0.23 1.19 +/ 0.48 1.09 +/ 0.25 Small 1.95 +/ 0.20 1.92 +/ 0.33 1.95 +/ 0.28 1.69 +/ 0.18 1.55 +/ 0.48 1.60 +/ 0.22 Intestines Upper L. 1.86 +/ 0.40 2.11 +/ 0.34 1.66 +/ 0.23 1.53 +/ 0.17 1.58 +/ 0.47 1.46 +/ 0.24 Intestines Lower L. 0.92 +/ 0.12 1.71 +/ 0.18 1.96 +/ 0.46 1.50 +/ 0.17 1.66 +/ 0.46 1.74 +/ 0.21 Intestines
[0144] Residence times
[0145] The residence time represents the cumulative presence time of radioactivity in any given organ and is expressed in units of time (either seconds, minutes or hours). Multiplying these values by unit of radioactivity leads to the number of radio-active decays occurring in any given organ and is therefore proportional to radiation dose. Using the above animal biodistribution data, the organ residence times (in hour) for each harvested organ were calculated by numerical integration of the time activity data expressed in percent injected dose per gram of tissue. The following initial organ activity content immediately after injection was assumed to be: 5.9% in the lungs, 2.9% in the liver, 1.5% in the spleen and kidneys, 3.7% in the bone, and 72% in the blood. It was assumed that no biological excretion occurred beyond the last measured time point and that radio-activity only decreased due to physical decay. The animal organ residence times were then scaled to human organ weight by the relative organ mass scaling method. Organ residence times are presented in Table 2. The cumulative urine and feces activity (in percent injected) were plotted as a function of time and an uptake function was fitted to the data (F(t)=AO (1-exp(-A1 t)), see
TABLE-US-00006 TABLE 2 Organ residence times extrapolated to human expressed in hours. Organ Residence Time (hr) Blood 4.58 Lung 0.41 Liver 1.65 Spleen 0.11 Kidney 0.12 Muscle 1.53 Fat 0.59 Heart 0.061 Brain 0.036 Bone 1.40 Red Marrow 0.38 Testes 0.0035 Adrenals 0.0038 Thyroid 0.0040 Pancreas 0.0083 Stomach 0.012 Small Intestines 0.074 Upper L. 0.023 Intestines Lower L. 0.023 Intestines Bladder Wall 0.032
Radiation Dosimetry
[0146] The residence times of Table 2 were entered in the program OLINDA/EXM for .sup.64Cu and using the standard MIRD adult male model. The following additional assumptions were made: 10% of the blood residence time was assigned to the heart left ventricle; the bone activity was assigned in equal part to the cortical and trabecular bone source organs. Organ radiation dose estimates for the adult male model are presented in Table 3. The error bars on the dose estimates were assumed to be in proportion of the organ residence times uncertainties.
TABLE-US-00007 TABLE 3 Extrapolated human radiation dose estimates for .sup.64Cu-DOTA-2C6F3 antibody per unit of administered activity. Radiation doses can be converted to the SI units of mGy/MBq by dividing by 3.7. Dose Organ (rad/mCi) Adrenals 0.0926 Brain 0.0141 Breasts 0.0139 Gallbladder 0.0378 LLI Wall 0.0347 Small Intestines 0.0426 Stomach 0.0258 ULI Wall 0.0343 Heart muscle 0.217 Kidneys 0.137 Liver 0.295 Lungs 0.134 Muscle 0.0274 Ovaries 0.0193 Pancreas 0.051 Red Marrow 0.107 Bones 0.0232 Skin 0.0105 Spleen 0.192 Testes 0.0342 Thymus 0.0207 Thyroid 0.063 Urinary Bladder 0.321 Uterus 0.0228 Total Body 0.039 Effective Dose 0.083 (rem/mCi)
[0147] Although the calculated doses are for the human male model, dose to female organs (breasts, uterus and ovaries) are also provided in italic. The radiation doses above include contribution from beta (both minus and plus) and gamma rays emitted from .sup.64Cu, and include contribution from activity within one organ to itself and from neighboring organs. Due to the nature and energy of the beta particles, the self-organ dose contribution from the beta particles dominates the dose contributions. The largest radiation dose is observed in the liver and urinary bladder wall with values of 0.295 and 0.321 rad per mCi injected. The effective dose is calculated at 0.083 rem/mCi. Based on RDRC limit of 5 rem to any organ, this indicates a 16 mCi maximum injection.
Example 4
Dosimetry of Labeled Anti-TIP1 2C6F3 Antibody
Biodistribution in Healthy Mice
[0148] Human radiation dosimetry estimates were calculated from animal biodistribution data obtained by standard method of organ dissection and using the standard MIRD methodology. Animal biodistribution data was obtained using 30 C57 mature male mice injected with 24 Ci/100 L of [.sup.64Cu]-DOTA-2C6F3 antibody divided in 6 groups of 5 animals. The average animal mouse weight was 23.3 g. Animals were euthanized and organs were harvested in groups of five at the following time points: 1, 2, 6, 12, 24 and 48 hours post injection. The following organs were harvested, weighed and counted for radio-activity in a gamma counter: blood, lungs, liver, spleen, kidneys, bladder, muscle, fat, heart, brain, bone, red marrow, testes, adrenals, thyroid, pancreas, stomach, small intestines, upper and lower large intestines. The animals were maintained in metabolic cages where urine and feces excretion were collected, weighed and counted for radioactivity. The biodistribution data are presented in Table 4.
TABLE-US-00008 TABLE 4 Organ activity concentration from mice dissection expressed in percent injected per gram of tissue. Organ 1 hr 2 hr 6 hr 12 hr 24 hr 48 hr Blood 11.3 1.3 9.02 1.32 8.52 1.14 5.80 1.21 3.85 0.58 4.62 0.68 Lung 5.06 1.35 3.99 1.26 4.48 1.07 4.04 1.82 2.46 1.36 3.20 0.53 Liver 49.0 7.83 38.3 5.8 42.7 2.36 28.7 5.7 25.1 2.7 18.0 4.6 Spleen 56.5 12.4 36.7 13.9 45.6 15.9 33.7 6.9 24.0 4.9 18.8 7.9 Kidney 6.17 0.69 5.65 0.72 6.11 1.00 4.93 1.34 3.76 0.37 4.42 0.48 Bladder 36.0 28.8 32.6 26.4 8.40 7.04 2.74 0.66 1.97 0.67 2.31 0.72 Muscle 0.40 0.14 0.68 0.80 0.46 0.05 0.59 0.17 0.51 0.09 0.75 0.35 Fat 0.62 0.22 0.93 0.29 1.10 0.25 0.80 0.17 1.08 0.43 0.67 0.07 Heart 2.58 0.57 2.51 0.94 2.32 0.64 1.85 0.39 1.37 0.16 1.75 0.31 Brain 0.45 0.26 0.30 0.07 0.31 0.09 0.25 0.11 0.20 0.04 0.25 0.05 Bone 1.63 0.32 1.52 0.31 1.42 0.25 0.98 0.30 1.16 0.63 0.96 0.13 Marrow 3.67 1.42 3.64 1.58 2.47 1.26 0.96 0.51 0.89 0.23 1.36 2.67 Testes 0.66 0.13 0.82 0.12 0.94 0.08 0.78 0.20 0.63 0.12 0.76 0.09 Adrenals 3.35 1.15 3.00 0.72 2.14 0.52 2.00 0.34 1.87 0.37 2.24 0.95 Thyroid 2.36 0.76 2.14 10.78 1.67 0.54 1.46 0.50 1.39 0.24 2.01 0.83 Pancreas 0.96 0.27 0.87 0.20 0.99 0.21 0.76 0.12 0.86 0.34 1.04 0.15 Stomach 1.19 0.21 0.96 0.26 1.06 0.19 0.62 0.12 0.87 0.17 1.47 0.35 Small 1.43 0.28 1.17 0.24 1.25 0.12 1.24 0.16 1.20 0.22 1.79 0.39 Intestines Upper L. 1.21 0.29 1.01 0.11 1.10 0.18 1.16 0.20 1.21 0.15 1.76 0.27 Intestines Lower L. 0.67 0.10 1.22 0.09 1.25 0.17 1.38 0.27 1.51 0.31 1.98 0.34 Intestines
Residence Times
[0149] The residence times represent the cumulative presence time of radioactivity in any given organ and are expressed in units of second or hours (hr). Multiplying these values by unit of radioactivity leads to the number of radioactive decays occurring in any given organ and is therefore proportional to radiation dose. Using the above animal biodistribution data, the organ residence times (in hours) for each harvested organ were calculated by numerical integration of the time activity data expressed in percent injected dose per gram of tissue. The following initial organ activity content immediately after injection was assumed to be: 5.9% in the lungs, 2.9% in the liver, 1.5% in the spleen and kidneys, 3.7% in the bone, and 72% in the blood. It was assumed that no biological excretion occur beyond the last measured time point and that radioactivity only decreased due to physical decay. The animal organ residence times were then scaled to human organ weight by the relative organ mass scaling method. Organ residence times are presented in Table 5. The cumulative urine and feces activity (in percent injected) were plotted as a function of time and an uptake function was fitted to the data (F(t)=AO (1-exp(-A1 t)), see
TABLE-US-00009 TABLE 5 Organ residence times extrapolated to human expressed in hours. Organ Residence Time (hr) Blood 2.64 0.68 Lung 0.28 0.12 Liver 3.52 0.95 Spleen 0.36 0.20 Kidney 0.09 0.03 Muscle 0.92 0.73 Fat 0.39 0.22 Heart 0.036 0.016 Brain 0.022 0.014 Bone 0.80 0.46 Red Marrow 0.11 0.13 Testes 0.002 0.001 Adrenals 0.002 0.001 Thyroid 0.002 0.001 Pancreas 0.005 0.002 Stomach 0.009 0.004 Small Intestines 0.05 0.02 Upper L. 0.016 0.005 Intestines Lower L. 0.014 0.005 Intestines Bladder Wall 0.025 0.036
Radiation Dosimetry
[0150] The residence times of Table 5 were entered in the program OLINDA/EXM for .sup.64Cu and using the standard MIRD adult male model. The following additional assumptions were made: 10% of the blood residence time was assigned to the heart left ventricle; the bone activity was assigned in equal part to the cortical and trabecular bone source organs. The error bars on the dose estimates were assumed to be in proportion of the organ residence times uncertainties.
[0151] Although the calculated doses are for the human male model, dose to female organs (breasts, uterus and ovaries) are also provided in italics. The radiation doses above include contribution from beta (both minus and plus) and gamma rays emitted from .sup.64Cu, and include contribution from activity within one organ to itself and from neighboring organs. Due to the nature and energy of the beta particles, the self-organ dose contribution from the beta particles dominates the dose contributions. The largest radiation dose is observed in the liver and spleen with values of 0.62 and 0.6 rad per mCi injected. The effective dose is calculated at 0.088 rem/mCi.
Example 5
GRP78 Surface Expression Increases on Irradiated NSCLC
[0152] Lung cancer cell membrane preparations were studied on Western immunoblot. Antibodies to GRP78 showed an increase in this protein on the cell membrane in response to 3 Gy of irradiation in lung cancer cells (
Example 6
Anti-GRP78 Antibodies Reduce NSCLC Cell Survival and Enhance Cytotoxicity of Radiotherapy
[0153] To determine whether anti-GRP78 monoclonal antibodies enhance the efficacy of radiotherapy in NSCLC, the colony forming assay was utilized (
Example 7
Anti-GRP78 Antibodies Achieve Specific Binding to NSCLC in the Mouse Models
[0154] To determine whether antibodies against the C- and N-terminal domains of GRP78 achieve cancer specific binding, lung cancer tumors in mice (
[0155] TE11 anti TIP-1 scFv antibody and a DOTA-conjugated TE11 anti-TIP-1 scFv antibody were generated. The sequence of two TE11 clones are shown in
[0156] The TE11 antibody was tested using ELISA (
[0157] The anti-TIP-1 scFv antibody TE11 (
Example 8
Humanizing Anti-TIP1 Antibody 2C6F3
[0158] The heavy chain (HC) and light chain (LC) sequences of 2C6F3, a murine antibody to TIP-1, were synthesized. The HC nucleic acid sequence is SEQ ID NO:24 and the amino acid sequence is SEQ ID NO:25 (Table C). The LC nucleic acid sequence is SEQ ID NO:26 and the amino acid sequence is SEQ ID NO:27 (Table C). According to the sequences, two plasmids for expressing murine HC and LC separately were constructed. The HC and LC genes were cloned into the plasmid under the control of PCMV promoter. The endotoxin free plasmids were isolated and transiently transfected into 293 cells. The antibody present in the supernatant was then tested by ELISA. Results showed the recombinant murine 2C6F3 antibody (2C6F3 rmlgG) binds to antigen as well as the original 2C6F3 antibody (2C6F3 mAb) (Table 6). The CDRs of the murine antibody are then cloned to a selected matching human IgG1 backbone.
TABLE-US-00010 TABLE 6 Quality control ELISA of 2C6F3 rmIgG in the TGE supernatant Antibody OD.sub.490 2C6F3 mAb 1.398 2C6F3 rmIgG 0.913 Medium 0.053 PBS 0.054