Method For Constructing Gene Mutation Library
20230083751 · 2023-03-16
Inventors
- Xiaohui Dai (Nanjing, Jiangsu, CN)
- Yifan Li (Nanjing, Jiangsu, CN)
- Cheng-Hsien Wu (Nanjing, Jiangsu, CN)
Cpc classification
C12N15/1031
CHEMISTRY; METALLURGY
C12Q2535/101
CHEMISTRY; METALLURGY
C12Q2535/101
CHEMISTRY; METALLURGY
C12N15/1058
CHEMISTRY; METALLURGY
C12Q1/6806
CHEMISTRY; METALLURGY
C12N15/1058
CHEMISTRY; METALLURGY
C12Q1/6806
CHEMISTRY; METALLURGY
International classification
Abstract
A method for constructing a gene mutation library, also relating to the gene mutation library obtained by the method, a kit for the method for constructing a gene mutation library, and a method for analyzing the relationships between amino acid mutations in a protein and the properties, regulation, and/or function of the protein using the gene mutation library constructed by the method.
Claims
1. A method for constructing a gene mutation library, comprising (1) synthesizing a pool of oligonucleotide sequences comprising mutant nucleotide(s) at one or more mutation sites; (2) performing PCR amplification on the oligonucleotides in the synthesized pool of the oligonucleotide sequences comprising the mutant nucleotide(s); (3) performing PCR amplification by using the plasmid comprising a methylated site and a gene to be mutated or a part thereof as a template and using the oligonucleotides in the pool of the amplified oligonucleotide sequences obtained in step (2) as primers; (4) using an endonuclease that recognizes and cleaves the methylated site to cleave the template plasmid present in the amplified system of step (3); and (5) adding a forward primer and a reverse primer respectively corresponding to both ends of the gene to be mutated or the part thereof to the system obtained in step (4) and performing PCR amplification to obtain the gene mutation library comprising a plurality of genes containing the mutant nucleotide(s) or a part thereof.
2. The method according to claim 1, wherein purification is not performed during steps (1)-(5).
3. The method according to claim 1, further comprising (6) recovering and purifying the amplified product of step (5) to obtain a final product.
4.-5. (canceled)
6. The method according to claim 1, wherein the length of the oligonucleotide sequences in the pool of the oligonucleotide sequences synthesized in step (1) is 60-170 bp.
7. The method according to claim 1, wherein the pool of the oligonucleotide sequences synthesized in step (1) comprises mutant nucleotide(s) at 1 to 10 mutation sites.
8. (canceled)
9. The method according to claim 1, wherein the amino acid sequence encoded by a gene comprising the mutant nucleotide(s) has at least one amino acid difference compared to the amino acid sequence encoded by the gene to be mutated.
10. The method according to claim 9, wherein the at least one amino acid difference is selected from: substitution, addition or deletion.
11. (canceled)
12. The method according to claim 10, wherein the substitution is to substitute the original amino acid with an amino acid having different properties from the original amino acid.
13. The method according to claim 12, wherein the properties are selected from: acidity and alkalinity, polarity, charge characteristic and side chain group.
14. The method according to claim 1, wherein two primers respectively corresponding to both ends of the oligonucleotide sequences comprising the mutant nucleotide(s) at one or more mutation sites are used in the PCR amplification in step (2).
15. The method according to claim 1, wherein the number of cycles of the PCR amplification in step (2) is 10-25 cycles.
16. The method according to claim 1, wherein the DNA polymerase used in the PCR amplification in step (2) is a high-fidelity DNA polymerase.
17. The method according to claim 1, wherein the molar ratio of the primers to the template in step (3) is 15:1 to 50:1.
18. The method according to claim 1, wherein the number of cycles of the PCR amplification in step (3) is 10-20 cycles.
19. (canceled)
20. The method according to claim 1, wherein the plasmid is extracted from bacteria that methylate the plasmid.
21. The method according to claim 1, wherein the endonuclease in step (4) is DpnI, MspJI or FspEI.
22. A gene mutation library constructed using the method according claim 1.
23. A kit for the method for constructing the gene mutation library according to claim 1, comprising a pool of oligonucleotide sequences comprising mutant nucleotide(s) at one or more mutation sites, a plasmid comprising a methylated site and a gene to be mutated or a part thereof, and an endonuclease that recognizes and cleaves the methylated site.
24. The kit according to claim 23, wherein the kit further comprises a DNA polymerase.
25. A method for analyzing the relationship between an amino acid mutation in a protein and the properties, regulation and/or function of the protein, comprising the following steps: (1) constructing a gene mutation library of a gene encoding the protein using the method according to claim 1; (2) comparing the properties, regulation and/or function of the protein encoded by a mutant gene in the gene mutation library with the properties, regulation and/or function of the unmutated protein; and (3) analyzing the relationship between the amino acid at the mutation position and the properties, regulation and/or function of the protein.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
DETAILED DESCRIPTION OF EMBODIMENTS
[0091] As used in the present description and appended claims, the singular forms “a,” “an,” and “the” include plural referents, unless the context clearly dictates otherwise. Therefore, for example, reference to “a molecule” optionally includes a combination of two or more of such molecules, and the like.
[0092] As used herein, the term “about” refers to a conventional error range of the corresponding numerical value easily known by those skilled in the art. Reference herein to “about” a certain value or a parameter includes (and describes) the embodiment involving the value or parameter itself.
[0093] It is understood that the aspects and embodiments of the present invention described herein include aspects and embodiments involving “comprise”, “consist of”, and “essentially consist of”.
[0094] The term “oligonucleotide” refers to a general term for short-chain nucleotides. In this context, the oligonucleotide can be made by polymerizing 2-300 nucleotides via phosphodiester bonds.
[0095] The term “pool of oligonucleotide sequences” refers to a mixture consisting of a variety of different oligonucleotide sequences.
[0096] The term “gene mutation library” refers to a mixture consisting of a variety of different DNA variant sequences. A Gene mutation library is a product of the combination of gene synthesis, gene mutation and directed evolution study. The gene mutation library has been increasingly used in research fields, such as high-throughput drug target screening, directed evolution by protein engineering, synthesizing diversity antibody libraries to screen variant antibodies with high-affinity and specificity, etc.
[0097] The term “PCR amplification” refers to the polymerase chain reaction, which is a molecular biology technique for amplifying a specific DNA fragment. It can be regarded as a special DNA replication in vitro. The biggest feature of PCR is that it can greatly increase the trace amount of DNA. Specifically, the basic principle of PCR technology is similar to the natural replication process of DNA, and its specificity relies on oligonucleotide primers complementary to both ends of the target sequence. PCR is composed of three basic reaction steps: denaturation, annealing and extension, and comprises: (1) denaturation of a template DNA: heating the template DNA to above 90° C. for a certain period of time, and then dissociating the double-stranded template DNA or the double-stranded DNA formed by PCR amplification to become single strands, so that the single strands can be bound with primers to prepare for the next round of reaction; (2) annealing (renaturation) of the template DNA and primers: after the template DNA is denatured into a single strand by heating, lowering the temperature to a lower temperature, wherein the primers are paired and bound with the complementary sequence of the single-stranded template DNA; (3) extension of primers: synthesizing a new semi-reserved replication strand complementary to the template DNA strand from the DNA template-primer conjugate, under the action of DNA polymerase (such as TaqDNA polymerase) at about 70° C., using dNTPs as the reaction raw material, using the target sequence as a template, and according to the principles of complementary base pairing and semi-reserved replication. More “semi-retained replicated strands” can be obtained by repeating the cycle of the three processes of denaturation-annealing-extension.
[0098] In step (5) of the method for constructing a gene mutation library of the present application, a forward primer and a reverse primer respectively corresponding to both ends of the gene to be mutated or a part thereof are added to the system obtained in step (4) and PCR amplification is performed to obtain a gene mutation library comprising a plurality of genes containing mutant nucleotide(s) or a part thereof. In this step, fusion PCR is performed and comprises (1) denaturation of template DNA: heating the template DNA to above 90° C. for a certain period of time to keep the template DNA in the original single-stranded state, wherein the template DNA is a product obtained by performing PCR amplification using the plasmid containing the gene to be mutated in step (3) as a template and using the oligonucleotides in the pool of the oligonucleotides amplified in step (2) as primers, and is complementary at positions corresponding to the oligonucleotide sequences in the pool of the oligonucleotides synthesized in step (1); (2) annealing: annealing the template DNAs, wherein the complementary sequence of the single-stranded template DNA is paired and bound; (3) extension: using DNA polymerase to extend the DNA strand from the 3′ end to form a complete double-stranded DNA by using the complementary strand as a template. Then, the subsequent PCR reaction is the same as ordinary PCR, a gene mutation library comprising a plurality of genes containing mutant nucleotide(s) or a part thereof is obtained by the denaturation/annealing/extension three-step amplification, using the formed complete double-stranded DNA as a template and using the added forward primer and reverse primer corresponding to the two ends of the gene to be mutated or a part thereof as primers.
[0099] The term “PCR primer” refers to a synthesized macromolecule with a specific nucleotide sequence, that is paired and bound with the complementary sequence of the single-stranded template DNA during the annealing (renaturation) stage of the polymerase chain reaction and is linked with the nucleotides in the reaction system via covalent bonds under the action of DNA polymerase during extension stage.
[0100] Usually, one primer in the primer pair is complementary to one DNA template strand at one end of the target region, and the other primer in the primer pair is complementary to the other DNA template strand at the other end of the target region. The function of the primer is to serve as the starting point of nucleotide polymerization, and nucleic acid polymerases can respectively start to synthesize new nucleic acid strands from the 3′ ends of the two primers. The synthesized double-stranded DNA is re-melted during the DNA denaturation stage of the next cycle and can be used as a template of this cycle for amplification. Theoretically, this amplification method produces m*2.sup.n double-stranded DNAs, where m is the number of template strands initially added, and n is the number of cycles. Therefore, PCR amplification using this primer pair is also called exponential amplification.
[0101] The primer pair herein can also be two complementary oligonucleotides, wherein the two oligonucleotides are melted during the denaturation stage, complementary to respectively corresponding templates thereof during the annealing stage, and extended and amplified in the forward and backward directions respectively. The double-stranded DNA obtained after amplification is a complex of the template strand initially added to the system and the product strand obtained by extension initiated from the primer. In this case, the product strand cannot be used as the template for the next amplification reaction. Only the template strand initially added to the system can be used as a template for each PCR cycle. Therefore, theoretically, this amplification method respectively produces m*n single-stranded DNAs in each direction after n cycles, where m is the number of template strands added initially, and n is the number of cycles. Therefore, PCR amplification using such primer pairs is a linear amplification.
[0102] The term “DNA polymerase” is an enzyme that replicates DNA from the 5′ end to the 3′ end using DNA as a template for replication. The main activity of DNA polymerase is to catalyze the synthesis of DNA in the presence of templates, primers, dNTPs, etc.
[0103] The term “high-fidelity DNA polymerase” refers to a DNA polymerase with a low incorporation error rate and proofreading activity to ensure faithful replication of the DNA of interest.
[0104] The term “gene to be mutated” herein refers to a gene that needs to be specifically mutated to construct a gene mutation library, and the sequence of the gene to be mutated is an original sequence that does not contain a mutant nucleotide.
[0105] The term “plasmid” refers to a DNA molecule other than chromosomal DNA (or nucleoid) in organisms such as bacteria. Plasmid exists in the cytoplasm and has the ability to autonomously replicate, allowing same to exist in daughter cells, maintain a constant copy number, and express all carried genetic information. In general, plasmids extracted from bacteria have methylated sites.
[0106] The term “DNA methylation” is a form of chemical modification of DNA that can alter genetic behavior without altering the DNA sequence. In a broad sense, DNA methylation refers to a chemical modification process in which a specific base on the DNA sequence obtains a methyl group via covalent binding under the catalysis of DNA methyltransferase (DNMT) and using S-adenosyl methionine (SAM) as a methyl donor. This DNA methylation modification can occur at positions, such as the C-5 position of cytosine, the N-6 position of adenine and the N-7 position of guanine. DNA methylation, as a stable modification state, can be inherited to the new daughter DNA along with the DNA replication process under the action of DNA methyltransferase, which is an important epigenetic mechanism.
[0107] Common K12 E. coli strains in laboratory, such as TOP10 comprise 3 methylases that recognize different DNA sequences: Dam methylase, which adds a methyl to the A of the GATC motif of DNA; Dcm methylase, which adds a methyl to the second C of the CCWGG motif of DNA; and EcoKI methylase, which adds a methyl to the A of AACNNNNNNGTGC motif or GCACNNNNNNGTT motif of DNA.
[0108] The term “restriction endonuclease” refers to a class of enzymes that can recognize and attach to a specific deoxynucleotide sequence and cleave the phosphodiester bond between two deoxyribonucleotides at a specific location in each strand, and is referred to as “endonuclease”.
[0109] The term “restriction site” refers to a specific sequence on a DNA strand, wherein the restriction endonuclease can specifically recognize the sequence and cleave the DNA sequence here into two fragments in a specific manner.
[0110] The term “endonuclease that recognizes and cleaves a methylated site” refers to a class of enzymes that can recognize and attach to a specific deoxynucleotide sequence comprising a methylated deoxynucleotide and cleave the phosphodiester bond between two deoxyribonucleotides at a specific location in each strand. For example, the endonuclease that recognizes and cleaves a methylated site can be DpnI enzyme, FspEI enzyme and MspJI.
[0111] DpnI enzyme recognizes and cleaves the methylated motif G.sup.mATC in plasmids extracted from bacteria containing Dam methylase. However, unmethylated PCR products are not cleaved because PCR system does not contain any methylase. Particularly, “NA” in the motif “G.sup.mATC” represents a methylated adenine nucleotide.
[0112] FspEI enzyme is a modification-dependent endonuclease that recognizes CT site and creates a double-stranded DNA break at the 3′ end N.sub.12/N.sub.16 of modified cytosine C, i.e.,
TABLE-US-00001 .Math. 5′ . . . C.sup.mC(N).sub.12 . . . 3′ 3′ . . . G G(N).sub.16 . . . 5′. .box-tangle-solidup.
Therefore, FspEI enzyme recognizes and cleaves the methylated motif C.sup.mCWGG in plasmids extracted from bacteria containing Dcm methylase. However, unmethylated PCR products are not cleaved because PCR system does not contain any methylase. Particularly, “.sup.mC” in the motifs “C.sup.mC” and “C.sup.mCWGG” represents a methylated cytosine nucleotide.
[0113] MspJI enzyme is a modification-dependent endonuclease that recognizes .sup.mCNNR site and creates a double-stranded DNA break at the 3′ end N.sub.9/N.sub.13 of modified cytosine, i.e.,
TABLE-US-00002 .Math. 5′ . . . .sup.mC N N R(N).sub.9 . . . 3′ 3′ . . . G N N Y(N).sub.13 . . . 5′, .box-tangle-solidup.
wherein R=A or G; and Y=C or T. Particularly, “.sup.mC” in the motif “.sup.mCNNR” represents a methylated cytosine nucleotide.
[0114] Sanger sequencing is a method, which comprises starting at a fixed point and randomly ending at a specific base of the nucleotide, and fluorescently labelling each base to generate a series of four groups of nucleosides with different lengths ending with A, T, C, and G, and then detecting by electrophoresis on a urea-denatured PAGE gel to obtain visible DNA base sequences.
[0115] High-throughput sequencing, also known as “Next-generation” sequencing technology (abbreviated as NGS), is relative to the traditional Sanger sequencing method. NGS is characterized by the ability to sequence hundreds of thousands to millions of DNA molecules in parallel and generally shorter reads. At present, the main platforms for high-throughput sequencing are represented by Roche 454 sequencer (Roch GS FLX sequencer), Illumina Solexa genome analyzer (Illumina Genome Analyzer) and ABI SOLiD sequencer. The common features thereof are (1) the DNA of interest is cut into small fragments; (2) the single small fragment DNA molecule binds to the surface of a solid phase; (3) the single molecule is amplified independently;
[0116] (4) only one base (A, C, T, and G) is copied at one time and the signal is detected; and (5) high-resolution imaging system.
[0117] The term “Sequencing Depth” refers to the ratio of the total number of bases (bp) obtained by sequencing to the size of the genome, which is one of the indicators for evaluating the amount of sequencing. There is a positive correlation between sequencing depth and genome coverage, and the error rate or false positive results brought by sequencing will decrease with the increase of sequencing depth. In this context, the sequencing depth is used in the sequencing results obtained by high-throughput sequencing of gene mutation library. In this context, the sequencing depth refers specifically to the sequencing depth of each gene mutant in high-throughput sequencing results.
[0118] The term “average sequencing depth” herein refers to the average sequencing depth of each gene mutant in the sequencing results of the gene mutation library.
[0119] The term “sequencing depth ranked 10%” refers to the sequencing depth corresponding to the gene mutant ranked 10%, wherein all the gene mutants obtained in the sequencing results of the gene mutation library are ranked according to the corresponding sequencing depth thereof from small to large.
[0120] The term “sequencing depth ranked 90%” refers to the sequencing depth corresponding to the gene mutant ranked 90%, wherein all the gene mutants obtained in the sequencing results of the gene mutation library are ranked according to the corresponding sequencing depth thereof from small to large.
[0121] The term “deviation degree” refers to the sequencing depth ranked 90%/sequencing depth ranked 10%, which is used to characterize whether the sequencing depths of all the gene mutants obtained by high-throughput sequencing of the gene mutation library is uniform, and indicates whether the copy numbers of different mutant sequences comprising different mutations at a certain mutation site are uniform in the gene mutation library. 1 is the optimal deviation degree, which denotes that in the gene mutation library, the copy numbers of different mutation sequences comprising different mutations at a certain mutation site are same. The closer the deviation degree is to 1, the closer the copy numbers of different mutant sequences comprising different mutations at a certain mutation site are.
[0122] The term “gene mutation distribution” herein refers to the overall distribution of mutations at a particular position for all sequences in the finally obtained gene mutation library.
Description Of Sequences
[0123]
TABLE-US-00003 SEQ ID NO Description Of Sequences 1 Amino acid sequence of the protein encoded by the original gene for which the gene mutation library needs to be constructed 2 Nucleotide sequence of the original gene for which the gene mutation library needs to be constructed 3 Oligonucleotide comprising mutations synthesized by Chip 4 Oligonucleotide comprising mutations synthesized by Chip 5 Oligonucleotide comprising mutations synthesized by Chip 6 Oligonucleotide comprising mutations synthesized by Chip 7 Oligonucleotide comprising mutations synthesized by Chip 8 Oligonucleotide comprising mutations synthesized by Chip 9 Oligonucleotide comprising mutations synthesized by Chip 10 Oligonucleotide comprising mutations synthesized by Chip 11 Oligonucleotide comprising mutations synthesized by Chip 12 Oligonucleotide comprising mutations synthesized by Chip 13 Oligonucleotide comprising mutations synthesized by Chip 14 Oligonucleotide comprising mutations synthesized by Chip 15 Oligonucleotide comprising mutations synthesized by Chip 16 Oligonucleotide comprising mutations synthesized by Chip 17 Oligonucleotide comprising mutations synthesized by Chip 18 Oligonucleotide comprising mutations synthesized by Chip 19 Oligonucleotide comprising mutations synthesized by Chip 20 Oligonucleotide comprising mutations synthesized by Chip 21 Oligonucleotide comprising mutations synthesized by Chip 22 Forward primer for PCR amplification of the synthesized oligonucleotide comprising mutations 23 Reverse primer for PCR amplification of the synthesized oligonucleotide comprising mutations 24 Forward primer for PCR amplification of the full-length gene comprising mutations 25 Reverse primer for PCR amplification of the full-length gene comprising mutations
SPECIFIC EXAMPLES
Example 1. Synthesis of an Oligonucleotide
[0124]
TABLE-US-00004 The amino acid sequence for which the library needs to be constructed was as follows: (SEQ ID NO: 1) MKRAFIMVLDSFGIGATEDAERFGDVGADTLGHIAEACAKGEADNGRKGPL NLPNLTRLGLAKAHEGSTGFIPAGMDGNAEVIGAYAWAHEMSSGKDSVSGH WEIAGVPVLFEWGYFSDHENSFPQELLDKLVERANLPGYLGNCRSSGTVIL DQLGEEHMKTGKWIFYTSAASVFQIACHEETFGLDKLYELCEIAREELTNG GYNIGRVIARPFIGDKAGNFQRTGNRRDLAVEPPAPTVLQKLVDEKHGQVV SVGKIADIYANCGITKKVKATGLDALFDATIKEMKEAGDNTIVFTNFVDFD SSWGHRRDVAGYAAGLELFDRRLPELMSLLRDDDILILTADHGCDPTWTGT DHTREHIPVLVYGPKVKPGSLGHRETFADIGQTLAKYFGTSDMEYGKAMF *,
a total of 407 amino acids, wherein the 35th amino acid is the amino acid which needs to be mutated, that is, the alanine (Ala) is needed to be mutated into another 19 common amino acids, i.e., glycine (Gly), valine (Val), leucine (Leu), isoleucine (Ile), phenylalanine (Phe), proline (Pro), tryptophan (Trp), serine (Ser), tyrosine (Try), cysteine (Cys), methionine (Met), asparagine (Asn), glutamine (Gln), threonine (Thr), aspartic acid (Asp), glutamic acid (Glu), lysine (Lys), arginine (Arg) and histidine (His).
[0125] The nucleotide sequence of the full-length gene which needs to be mutated is as follows (1224 bp in total):
TABLE-US-00005 (SEQ ID NO: 2) atgaaacgtgcatttattatggtgctggactcattcggcatcggcgctaca gaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcatatc gaagcttgtgccaaaggcgaagctgataacggtcgtaaaggcccg ctcaatctgccaaatctgacccgtctggggctggcgaaagctcacgaaggt tctaccggtttcattccggcgggaatggacggcaacgctgaagttatcggc gcgtacgcatgggcgcacgaaatgtcatccggtaaagatagcgtgtctggt cactgggaaattgccggtgtcccggttctgtttgagtggggatatttctcc gatcacgaaaacagcttcccgcaagagctgctggataaactggtcgaacgc gctaatctgccgggttacctcggtaactgccgttcttccggtacggtcatt ctggatcaactgggcgaagagcacatgaaaaccggcaagtggattttctat acctccgctgcatccgtgttccagattgcctgccatgaagaaactttcggt ctggataaactctacgaactgtgcgaaatcgcccgtgaagagctgaccaac ggcggctacaatatcggtcgtgttatcgctcgtccgtttatcggcgacaaa gccggtaacttccagcgtaccggtaaccgtcgtgacctggctgttgagccg ccagcaccgaccgtgctgcagaaactggttgatgaaaaacacggccaggtg gtttctgtcggtaaaattgcggacatctacgccaactgcggtatcaccaaa aaagtgaaagcgactggcctggacgcgctgtttgacgccaccatcaaagag atgaaagaagcgggtgataacaccatcgtcttcaccaacttcgttgacttc gactcttcctggggccaccgtcgcgacgtcgccggttatgccgcgggtctg gaactgttcgaccgccgtctgccggagctgatgtctctgctgcgcgatgac gacatcctgatcctcaccgctgaccacggttgcgatccgacctggaccggt actgaccacacgcgtgaacacattccggtactggtatatggcccgaaagta aaaccgggctcactgggtcatcgtgaaaccttcgcggatatcggccagact ctggcaaaatattttggtacttctgatatggaatatggcaaagccatgttc taa
[0126] Genscript was commissioned to use a chip to synthesize a pool of oligonucleotide sequences comprising mutant nucleotides. Each oligonucleotide was a nucleotide sequence encoding a protein comprising a mutant amino acid of one of the other 19 common amino acids at position 35. Each oligonucleotide is 80 bp in length. Particularly, the ratio of each amino acid mutation is 1/19. The sequences are as follows:
TABLE-US-00006 (SEQ ID NO: 3) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcGGCgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 4) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcGTTgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 5) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcCTGgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 6) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcATTgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 7) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcATGgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 8) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcTTTgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 9) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcTGGgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 10) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcCCGgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 11) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcTCAgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 12) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcACAgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 13) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcTGCgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 14) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcTATgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 15) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcAATgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 16) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcCAAgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 17) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcGATgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 18) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcGAAgaagcttgtgccaaaggcgaagctg (SEQ ID NO: 19) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcAAAgaagcttgtgccaaaggcgaagctg; (SEQ ID NO: 20) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcAGAgaagcttgtgccaaaggcgaagctg; and (SEQ ID NO: 21) agaagatgcagaacgctttggtgacgtcggggctgacaccctgggtcat atcCATgaagcttgtgccaaaggcgaagctg.
Example 2. Amplification of Oligonucleotides Synthesized by Chip
[0127] The amplification primers were designed, wherein the forward primer was named Chip-F, and the reverse primer was named Chip-R. The primer sequences are as follows: Chip-F: agaagatgcagaacgctttggtgac (SEQ ID NO: 22), and the reverse primer sequence is as follows: Chip-R: cagcttcgcctttggcacaagcttc (SEQ ID NO: 23). A PCR reaction system was prepared (see Table 1), wherein the template was the pool of the oligonucleotide sequences synthesized by the chip, the primers were the above-mentioned Chip-F/Chip-R, and the reaction system also comprised Phusion DNA polymerase, dNTPs and 5×HF buffer from kit Phusion® High-Fidelity DNA Polymerase (purchased from New England Biolabs), and water were added to a total volume of 50 μl. PCR amplification was performed on the oligonucleotides synthesized by chip according to the PCR reaction procedure shown in Table 2. The amplification results are shown in
TABLE-US-00007 TABLE 1 HF buffer (5x) 10 μl 10 nM dNTP 1 μl Template (oligonucleotide synthesized by chip) 100 ng Forward primer: Chip-F 2 μl Reverse primer: Chip-R 2 μl BSA (20 mg/ml) 10 μl Phusion (2 U/μl) 0.5 μl H.sub.2O Added to 50 μl
The PCR reaction procedure is shown in Table 2:
TABLE-US-00008 TABLE 2 1 98° C. 30 seconds 2 98° C. 10 seconds 3 64° C. 10 seconds 4 72° C. 20 seconds 5 return to step 2, 16 cycles 6 72° C. 5 minutes
Example 3 Linear Amplification Using Amplified Oligonucleotides Synthesized by the Chip as Primers
[0128] PCR amplification was performed by using the plasmid PMB1 extracted from E. coli TOP10 comprising the full-length gene to be mutated and the methylated site as a template and using the amplified oligonucleotides synthesized by the chip in Example 2 as primers. The amplified oligonucleotides synthesized by the chip in Example 2 were double-stranded DNAs, both strands can be used as primers to amplify towards the front and rear ends respectively, and both amplifications were linear amplifications. The number of primers required for linear amplification was much smaller than that for exponential amplification. Therefore, during linear amplification, it is necessary to strictly control the ratio of primers (that is, the amplified oligonucleotides synthesized by the chip in Example 2) to templates (that is, plasmids) in the system. The molar ratio of the plasmid templates to the amplified oligonucleotides synthesized by the chip (double-stranded) in Example 2 was 1:20, and the cycle number of the PCR reaction was 15. The PCR reaction system is shown in Table 3:
TABLE-US-00009 TABLE 3 HF buffer (5x) 10 μl 10 nM dNTP 1 μl Template (PMB1) 1.5 ng Oligonucleotide synthesized by chip (dsDNA) 0.473 ng Phusion DNA polymerase (2 U/μl) 0.5 μl H.sub.2O Added to 50 μl
The PCR reaction procedure is shown in Table 4:
TABLE-US-00010 TABLE 4 1 98° C. 30 seconds 2 98° C. 10 seconds 3 60° C. 30 seconds 4 72° C. 15 seconds 5 return to step 2, 15 cycles 6 72° C. 5 minutes
Example 4. Digestion of Plasmid Template in Amplification System by DpnI
[0129] If the subsequent amplification system contains the PMB1 plasmid template, then the original full-length gene without any mutation would be generated in the next amplification reaction, therefore the plasmid in the reaction system needed to be removed. E. coli TOP10 strain contains Dam methylase, which can catalyze the adenine methylation of GATC in the plasmid to form G.sup.mATC. Therefore, the plasmid PMB1 extracted from E. coli DH5α contains methylation modification. DpnI can recognize and cleave the methylated site G.sup.mATC. The plasmid templates in the amplification system were digested into small fragments by adding DpnI and cannot be used as the template for the next PCR amplification. The preparation of enzyme digestion system comprised adding 10 μl of PCR reaction product, DpnI (New England Biolabs, R0176L) and 10× Cutsamrt, and adding water to a total volume of 50 μl. The reaction was performed at the optimum temperature for DpnI enzyme, 37° C., for 2 hours.
[0130] The enzyme digestion system is shown in Table 5:
TABLE-US-00011 TABLE 5 PCR product obtained in Example 3 10 μl Cutsamrt 5 μl DpnI 1 μl H.sub.2O Added to 50 μl
Example 5. PCR Amplification to Obtain Final Product
[0131] The head and tail primers of the gene were designed. The forward primer was set at the head of the gene and named Gene-F, and the reverse primer was set at the tail of the gene and named Gene-R. The primer sequences are as follows: Gene-F: atgaaacgtgcatttattatgg (SEQ ID NO: 24), and Gene-R: ttagaacatggctttgccatat (SEQ ID NO: 25). The preparation of the PCR reaction system comprised using the product system digested with the endonuclease DpnI obtained in Example 4 as a template, and adding primers Gene-F/Gene-R, Phusion DNA polymerase, dNTP, and 5×HF buffer to the reaction system, and adding water to a total volume of 50 μl to amplify the full-length sequence of the gene. The sense and antisense PCR amplification products (that were two single-stranded DNAs, which had complementary nucleosides at the mutation sites) obtained by respectively using the two strands of the oligonucleotides synthesized by chip as primers in Example 3 can be linked together by complementary regions and used as a template for the PCR amplification reaction. After PCR was completed, the product was subjected to agarose gel electrophoresis. The band corresponding to the size of the final product was subjected to gel cutting, and recovered and purified by using axygen DNA gel recovery kit (purchased from AXYGEN, article number: AP-GX-250) to obtain the final product, as shown in
[0132] The reaction system of the PCR amplification is shown in Table 6:
TABLE-US-00012 TABLE 6 HF buffer (5x) 10 μl 10 nM dNTP 1 μl Template 2.5 μl Forward primer Gene-F 1 μl Reverse primer Gene-R 1 μl Phusion (2 U/μl) 0.5 μl H.sub.2O Added to 50 μl
The reaction procedure of the PCR amplification reaction is shown in Table 7:
TABLE-US-00013 TABLE 7 1 98° C. 30 seconds 2 98° C. 10 seconds 3 60° C. 30 seconds 4 72° C. 20 seconds 5 return to step 2, 15 cycles 6 72° C. 5 minutes
Example 6. Identification of Final Product
[0133] The DNA recovered and purified in Example 5 was subjected to Sanger sequencing, and the sequencing results are shown in
[0134] The DNA recovered and purified in Example 5 was subjected to high-throughput sequencing, and the mutant nucleotide sequences at the mutation sites and the frequency of each mutant nucleotide sequence in the obtained DNA sequence were analyzed. The high-throughput sequencing results are shown in Table 8.
TABLE-US-00014 TABLE 8 Expected oligonucleotide species 19 Detected oligonucleotide species 19 Max sequencing depth 284 Average sequencing depth 230.85 Sequencing depth ranked 10% 211 Sequencing depth ranked 90% 258 Deviation degree (depth ranked 90%/10%) 1.22
Example 7. Comparison of Different Ratios of Templates to Primers in the Linear Amplification Step Using the Oligonucleotides Synthesized by Chip as Primers
[0135] Different ratios of templates to primers in the linear amplification step using the oligonucleotides synthesized by chip as primers were tested. PCR amplification was performed by using the plasmid PMB1 extracted from E. coli TOP10 comprising the full-length gene to be mutated and the methylated site as a template and using the amplified oligonucleotides synthesized by the chip in Example 2 as primers. The molar ratio of the template plasmids to the amplified oligonucleotides synthesized by the chip (double-stranded) in Example 2 was 1:254, and the cycle number of the PCR reaction was 25. The PCR reaction system is shown in Table 8, and the reaction procedure is shown in Table 9. Then the same steps as Examples 4-6 were repeated, and the electrophoresis result of the finally obtained full-length gene is shown in
TABLE-US-00015 TABLE 8 HF buffer (5x) 10 μl 10 nM dNTP 1 μl Template (PMB1) 20 ng Oligonucleotide synthesized by chip (dsDNA) 80 ng Phusion DNA polymerase (2 U/μl) 0.5 μl H.sub.2O Added to 50 μl
The PCR reaction procedure is shown in Table 9:
TABLE-US-00016 TABLE 9 1 98° C. 30 seconds 2 98° C. 10 seconds 3 60° C. 30 seconds 4 72° C. 15 seconds 5 return to step 2, 25 cycles 6 72° C. 5 minutes
[0136] The cycle number of the reaction was optimized. PCR amplification was performed by using the plasmid PMB1 extracted from E. coli TOP10 comprising the full-length gene to be mutated and the methylated site as a template and using the amplified oligonucleotides synthesized by the chip in Example 2 as primers. The molar ratio of the template plasmids to the amplified oligonucleotides synthesized by the chip (double-stranded) in Example 2 was 1:254, and the cycle number of the PCR reaction was reduced to 15. The PCR reaction system is shown in Table 8, and the reaction procedure is shown in Table 10. The electrophoresis result of the finally obtained full-length gene is shown in
TABLE-US-00017 TABLE 10 1 98° C. 30 seconds 2 98° C. 10 seconds 3 60° C. 30 seconds 4 72° C. 15 seconds 5 return to step 2, 15 cycles 6 72° C. 5 minutes
Example 8: Comparison Between the Method for Constructing a Gene Mutation Library of the Present Invention and the Method for Constructing a Gene Mutation Library in the Prior Art
[0137] Conventional method for constructing a gene mutation library in the prior art are: 1. amplifying a mutant region synthesized by a chip by PCR, and then performing column purification, 2. amplifying the non-mutant regions before and after the mutant region using a gene to be mutated as a template, wherein the region in front of the mutant region and the region behind the mutant region need to be amplified separately and are respectively subjected to a PCR reaction, then performing agarose gel electrophoresis, and recovering and purifying DNA fragments by cutting the gel; 3. assembling the 3 fragments into one fragment by assembly PCR, and 4. amplifying a full-length fragment by using the assembled product as a template (without purification) and adding head and tail primers for gene, then performing agarose gel electrophoresis, and recovering and purifying DNA fragments by cutting the gel.
[0138] The above conventional method for constructing a gene mutation library in the prior art takes about 6.5 hours in total, while the method for constructing a gene mutation library of the present invention takes about 5.5 hours. It can be seen that the method for constructing a gene mutation library of the present invention has fewer steps and saves time.
[0139] It should also be noted that, on the premise that it can be implemented and does not obviously violate the gist of the present invention, any technical feature or combination of technical features described as a constituent part of a technical solution in the present description can also be applied to other technical solutions; in addition, on the premise that it can be implemented and does not obviously violate the gist of the present invention, the technical features described as constituent parts of different technical solutions can also be combined in any way to form other technical solutions. The present invention also comprises technical solutions obtained by combining in the above-mentioned cases, and these technical solutions are equivalent to being described in the present invention.
[0140] The present invention was described above by specific embodiments and examples, but those skilled in the art should understand that these are not intended to limit the scope of the present invention. The scope of the present invention should be determined by the claims.