Pharmaceutical preparation
09771407 ยท 2017-09-26
Assignee
Inventors
Cpc classification
C12Y204/99
CHEMISTRY; METALLURGY
A61P5/10
HUMAN NECESSITIES
C07K14/59
CHEMISTRY; METALLURGY
C12N9/1081
CHEMISTRY; METALLURGY
A61P15/00
HUMAN NECESSITIES
A61P15/08
HUMAN NECESSITIES
International classification
Abstract
Preparations including recombinant FSH (rFSH).
Claims
1. Recombinant follicle stimulating hormone (FSH) comprising 2,3- and 2,6-sialylation, wherein from 5% to 20% of the total sialylation of the recombinant FSH is 2,6-sialylation.
2. The recombinant FSH of claim 1, wherein the recombinant FSH is produced or expressed in a human cell line.
3. The recombinant FSH of claim 2, wherein the recombinant FSH is produced or expressed in a PER.C6 cell line, a PER.C6 derived cell line or a modified PER.C6 cell line.
4. The recombinant FSH of claim 2, wherein the human cell line is a human cell line that has been modified using 2,3-sialyltransferase.
5. The recombinant FSH of claim 2, wherein the recombinant FSH comprises 2,6-linked sialylation provided by endogenous sialyltransferase activity.
6. A pharmaceutical composition comprising recombinant FSH according to claim 1.
7. The pharmaceutical composition of claim 6, wherein the composition further comprises human chorionic gonadotrophin (hCG) or luteinising hormone (LH), or both hCG and LH.
8. A method of treating infertility comprising administering to a subject in need of such treatment a recombinant FSH according to claim 1.
9. A method of manufacturing recombinant FSH according to claim 1 comprising a step of producing or expressing the recombinant FSH in a human cell line.
10. A method of manufacturing recombinant follicle stimulating hormone according to claim 1, comprising producing or expressing recombinant FSH in a human cell line, wherein the human cell line has been modified using an 2,3-sialyltransferase.
11. The method of claim 10, wherein the human cell line has endogenous 2,6-sialyltransferase activity.
12. The method of claim 10, wherein the human cell line is a PER.C6 cell line.
13. The method of claim 10, wherein the human cell line is a PER.C6 cell line that has endogenous 2,6-sialyltransferase activity.
14. Recombinant FSH (rFSH) produced by the method of claim 10.
15. Recombinant FSH (rFSH) produced by the method of claim 12.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DESCRIPTION
(14) It is desirable to have a rFSH product that more closely replicates or mimics the physiochemical and pharmacokinetic profile of the product produced from human urine. It is desirable to have a rFSH product that has improved pharmacokinetic property or properties compared to the known recombinant product.
(15) According to the present invention there is provided recombinant FSH (rFSH or recFSH) including 2,3 sialylation and 2,6 sialylation and, optionally, 2,8 sialylation. The rFSH (or rFSH preparation) according to the invention may have 10% or more of the total sialylation being 2,3-sialylation, for example 65-85% of the total sialylation may be 2,3-sialylation. The rFSH (or rFSH preparation) of the invention may have 50% or less of the total sialylation being 2,6-sialylation, for example 15-35% of the total sialylation may be 2,6-sialylation. The rFSH (or rFSH preparation) of the invention may have 5% or less of the total sialylation being 2,8-sialylation, for example 0.1-4% of the total sialylation may be 2,8-sialylation. The rFSH (or rFSH preparation) according to the invention may have a sialic acid content [expressed in terms of a ratio of moles of sialic acid to moles of protein] of 6 mol/mol or greater, for example of between 6 mol/mol and 15 mol/mol.
(16) The applicants have found that the type of sialic acid linkage, 2,3- or 2,6-, can have a dramatic influence on biological clearance of FSH. Human cell lines, as opposed to CHO cell lines, can express recombinant FSH with sialic acids attached by both 2,3 and 2,6 linkages. In Example 4 a recombinant FSH cell line was made which expressed FSH containing glycans with low levels of both 2,3- and 2,6-linked sialic acid (
(17) Recombinant FSH with a mixture of both 2,3 and 2,6-linked sialic acid was made by engineering a human cell line to express both rFSH and 2,3 sialyltransferase (Example 4 and 5). The expressed product is highly acidic and carries a mix of both 2,3- and 2,6-linked sialic acids; the latter provided by the endogenous sialyl transferase activity (
(18) The applicants have surprisingly found that rFSH of the invention may more closely replicate or mimic the physiochemical and pharmacokinetic profile of the natural human urinary product than other recombinant products. In other words, rFSH of the invention may be closer to the natural FSH. This may have significant advantages regarding dosing etc. Further, a more natural or more human product may be more desirable to the patient, who may desire therapy, although in a sense artificial, to be as natural as possible. There may be other advantages (e.g. pharmacokinetic advantages) in a recombinant product having carbohydrate (e.g. glycan) structure which is closer to natural (e.g. human urinary) FSH than other recombinant products.
(19) The invention is thus a recombinant version of FSH which carries a mix of 2,3 and 2,6 sialic acid and therefore more closely resembles natural FSH. It is expected that the use of this compound for controlled ovarian stimulation, in IVF techniques, and ovulation induction will result in a more natural stimulation of the ovary compared to existing recombinant products.
(20) According to the present invention there is provided recombinant FSH (rFSH or recFSH) (and/or a recombinant FSH preparation) including 2,3 sialylation and 2,6 sialylation. The rFSH or rFSH preparation may optionally further include 2,8 sialylation.
(21) Herein the term recombinant FSH preparation includes a preparation for e.g. pharmaceutical use which includes recombinant FSH. In embodiments of the invention, the rFSH may be present as a single isoform or as a mixture of isoforms. The rFSH (or rFSH preparation) according to the invention may have a sialic acid content [expressed in terms of a ratio of moles of sialic acid to moles of protein] of 6 mol/mol or greater (Example 8), for example between 6 mol/mol and 15 mol/mol, e.g. between 8 mol/mol and 14 mol/mol, for example between 10 mol/mol and 14 mol/mol, e.g. between 11 mol/mol and 14 mol/mol, e.g. between 12 mol/mol and 14 mol/mol, e.g. between 12 mol/mol and 13 mol/mol. The rFSH of the invention may be produced or expressed in a human cell line.
(22) The rFSH (or rFSH preparation) according to the invention may have 10% or more of the total sialylation being 2,3-sialylation. For example, 20, 30, 40, 50, 60, 70, 80 or 90% or more of the total sialylation may be 2,3-sialylation. The rFSH (or rFSH preparation) may include 2,3-sialylation in an amount which is from 65 to 85% of the total sialylation, for example from 70 to 80% of the total sialylation, for example from 71 to 79% of the total sialylation. The rFSH (or rFSH preparation) of the invention may have 50% or less of the total sialylation being 2,6-sialylation. For example 40, 30, 20, 10, 5% or less of the total sialylation may be 2,6-sialylation. The rFSH (or rFSH preparation) may include 2,6-sialylation in an amount which is from 15 to 35% of the total sialylation, for example from 20 to 30% of the total sialylation, for example from 21 to 29% of the total sialylation. The rFSH (or rFSH preparation) of the invention may have 5% or less of the total sialylation being 2,8-sialylation. For example 2.5% or less of the total sialylation may be 2,8-sialylation. The rFSH (or rFSH preparation) may include 2,8-sialylation in an amount which is from 0.1 to 4% of the total sialylation, for example from 0.5 to 3% of the total sialylation, for example from 0.5 to 2.5% of the total sialylation, By sialylation it is meant the amount of sialic residues present on the FSH carbohydrate structures. 2,3-sialylation means sialylation at the 2,3 position (as is well known in the art) and 2,6 sialylation at the 2,6 position (also well known in the art). Thus % of the total sialylation may be 2,3 sialylation refers to the % of the total number of sialic acid residues present in the FSH which are sialylated in the 2,3 position. The term % of the total sialylation being 2,6-sialylation refers to the % of the total number of sialic acid residues present in the FSH which are sialylated in the 2,6 position.
(23) The rFSH (or rFSH preparation) according to the invention may have a sialic acid content (amount of sialylation per FSH molecule) of (based on the mass of protein, rather than the mass of protein plus carbohydrate) of 6% or greater (e.g. between 6% and 15%, e.g. between 7% and 13%, e.g. between 8% and 12%, e.g. between 11% and 15%, e.g. between 12% and 14%) by mass.
(24) Recombinant FSH expressed in Chinese hamster ovary (CHO) cells includes exclusively a 2, 3 sialylation (Kagawa et al, 1988, Takeuchi et al. 1988, Svensson et al. 1990).
(25) The rFSH of the invention may be produced or expressed in a human cell line. This may simplify (and render more efficient) the production method because manipulation and control of e.g. the cell growth medium to retain sialylation may be less critical than with known processes. The method may also be more efficient because there is little basic rFSH produced than in production of known rFSH products; more acidic rFSH is produced and separation/removal of basic FSH is less problematic. The rFSH may be produced or expressed in a PER.C6 cell line, a PER.C6 derived cell line or a modified PER.C6 cell line. The cell line may be modified using 2,3-sialyltransferase. The cell line may be modified using 2,6-sialyltransferase. Alternatively or additionally, the rFSH may include 2,6-linked sialic acids (2,6 sialylation) provided by endogenous sialyl transferase activity [of the cell line].
(26) The rFSH may be produced using 2,3- and/or 2,6-sialyltransferase. The rFSH may be produced using 2,3-sialyltransferase. The rFSH may include 2,6-linked sialic acids (2,6 sialylation) provided by endogenous sialyl transferase activity.
(27) According to the present invention in a further aspect there is provided a method of production of rFSH and/or an rFSH preparation as described herein (according to aspects of the invention) comprising the step of producing or expressing the rFSH in a human cell line, for example a PER.C6 cell line, a PER.C6 derived cell line or a modified PER.C6 cell line, for example a cell line which has been modified using 2,3-sialyltransferase.
(28) The rFSH structure contains glycan moieties. Branching can occur with the result that the glycan may have 1, 2, 3, 4 or more terminal sugar residues or antennae, as is well known in the art. The rFSH of the invention may have glycans with sialylation presence on mono-antennary and/or di-antennary and/or tri-antennary and/or tetra-antennary structures. The rFSH may preferably include mono-sialylated, di-sialylated, tri-sialylated and tetra-sialylated glycan structures with relative amounts as follows: 9-15% mono-sialylated; 27-30% di-sialylated; 30-36% tri-sialylated and 25-29% tetra-sialylated (e.g. as shown by WAX analysis of charged glycans, as set out in Example 8 c).
(29) According to the present invention in a further aspect there is provided rFSH produced (e.g. expressed) in a human cell line. The rFSH may include 2,3- and 2,6-sialylation. The rFSH may be produced or expressed in a PER.C6 cell line, a PER.C6 derived cell line or a modified PER.C6 cell line. The cell line may be modified using 2,3-sialyltransferase. The cell line may be modified using 2,6-sialyltransferase. Alternatively or additionally, the rFSH may include 2,6-linked sialic acids (2,6 sialylation) provided by endogenous sialyl transferase activity [of the cell line]. The rFSH (or rFSH preparation) may have 10% or more of the total sialylation being 2,3-sialylation, for example 65-85% of the total sialylation may be 2,3-sialylation. The rFSH (or rFSH preparation) of the invention may have 50% or less of the total sialylation being 2,6-sialylation, for example 15-35% of the total sialylation may be 2,6-sialylation. The rFSH (or rFSH preparation) of the invention may have 5% or less of the total sialylation being 2,8-sialylation, for example 0.5-4% of the total sialylation may be 2,8-sialylation. The rFSH may have a sialic acid content [expressed in terms of a ratio of moles of sialic acid to moles of protein] of 6 mol/mol or greater, for example between 6 mol/mol and 15 mol/mol.
(30) According to the present invention in a further aspect there is provided a pharmaceutical composition comprising rFSH including 2,3-sialylation and 2,6-sialylation (e.g. as set out above). The pharmaceutical composition may further comprise hCG and/or LH.
(31) hCG can be obtained by any means known in the art. hCG as used herein includes human-derived and recombinant hCG. Human-derived hCG can be purified from any appropriate source (e.g. urine, and placenta) by any method known in the art. Methods of expressing and purifying recombinant hCG are well known in the art.
(32) LH can be obtained by any means known in the art. LH, as used herein, includes human-derived and recombinant LH. Human-derived LH can be purified from any appropriate source (e.g. urine) by any method known in the art. Methods of expressing and purifying recombinant LH are known in the art.
(33) The pharmaceutical composition may be for the treatment of infertility, e.g. for use in e.g. assisted reproductive technologies (ART), ovulation induction or intrauterine insemination (IUD. The pharmaceutical composition may be used, for example, in medical indications where known FSH preparations are used. The present invention also provides the use of rFSH and/or an rFSH preparation described herein (according to aspects of the invention) for, or in the manufacture of a medicament for, the treatment of infertility. The pharmaceutical compositions of the present invention can be formulated into well-known compositions for any route of drug administration, e.g. oral, rectal, parenteral, transdermal (e.g. patch technology), intravenous, intramuscular, subcutaneous, intrasusternal, intravaginal, intraperitoneal, local (powders, ointments or drops) or as a buccal or nasal spray. A typical composition comprises a pharmaceutically acceptable carrier, such as aqueous solution, non toxic excipients, including salts and preservatives, buffers and the like, as described in Remington's Pharmaceutical Sciences fifteenth edition (Matt Publishing Company, 1975), at pages 1405 to 1412 and 1461-87, and the national formulary XIV fourteenth edition (American Pharmaceutical Association, 1975), among others.
(34) Examples of suitable aqueous and non-aqueous pharmaceutical carriers, diluents, solvents or vehicles include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), carboxymethylcellulose and suitable mixtures thereof, vegetable oils (such as olive oil), and injectable organic esters such as ethyl oleate.
(35) The compositions of the present invention also can contain additives such as but not limited to preservatives, wetting agents, emulsifying agents, and dispersing agents. Antibacterial and antifungal agents can be included to prevent growth of microbes and includes, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. Furthermore, it may be desirable to include isotonic agents such as sugars, sodium chloride, and the like.
(36) In some cases, to effect prolonged action it is desirable to slow the absorption of FSH (and other active ingredients, if present) from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of FSH then depends upon its rate of dissolution which, in turn, can depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered FSH combination form is accomplished by dissolving or suspending the FSH combination in an oil vehicle.
(37) Injectable depot forms can be made by forming microencapsule matrices of the FSH (and other agents, if present) in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of FSH to polymer and the nature of the particular polymer employed, the rate of FSH release can be controlled. Examples of other biodegradable polymers include polyvinylpyrrolidone, poly(orthoesters), poly(anhydrides) etc. Depot injectable formulations are also prepared by entrapping the FSH in liposomes or microemulsions which are compatible with body tissues.
(38) Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium just prior to use. Injectable formulations can be supplied in any suitable container, e.g. vial, pre-filled syringe, injection cartridges, and the like.
(39) Injectable formulations can be supplied as a product having pharmaceutical compositions containing FSH (optionally with hCG, LH etc.) If there is more than one active ingredient (i.e. FSH and e.g. hCG or LH) these may be suitable for administration separately or together. If administered separately, administration can be sequential. The product can be supplied in any appropriate package. For example, a product can contain a number of pre-filled syringes containing either FSH, hCG, or a combination of both FSH and hCG, the syringes packaged in a blister package or other means to maintain sterility. A product can optionally contain instructions for using the FSH and hCG formulations.
(40) The pH and exact concentration of the various components of the pharmaceutical composition are adjusted in accordance with routine practice in this field. See GOODMAN and GILMAN's THE PHARMACOLOGICAL BASIS FOR THERAPEUTICES, 7.sup.th ed. In a preferred embodiment, the compositions of the invention are supplied as compositions for parenteral administration. General methods for the preparation of the parenteral formulations are known in the art and are described in REMINGTON; THE SCIENCE AND PRACTICE OF PHARMACY, supra, at pages 780-820. The parenteral compositions can be supplied in liquid formulation or as a solid which will be mixed with a sterile injectable medium just prior to administration. In an especially preferred embodiment, the parenteral compositions are supplied in dosage unit form for ease of administration and uniformity of dosage.
(41) The present invention will now be described in more detail with reference to the following Examples and to the attached drawings.
(42) Sequence Selection
(43) Human FSH
(44) The coding region of the gene for the FSH alpha polypeptide was used to according to Fiddes and Goodman. (1981). The sequence is banked as AH007338 and at the time of construction there were no other variants of this protein sequence. The nucleotide sequence is referred herein as SEQ ID NO:1.
(45) The coding region of the gene for FSH beta polypeptide was used according to Keene et al (1989). The sequence is banked as NM_000510 and at the time of construction there were no other variants of this protein sequence. The sequence is referred herein as SEQ ID NO:2.
(46) Sialyltransferase
(47) 2,3-Sialyltransferase
(48) The coding region of the gene for beta-galactoside alpha-2,3-sialyltransferase 4 (2,3-sialyltransferase, ST3GAL4) was used according to Kitagawa and Paulson (1994). The nucleotide sequence is banked as L23767 and referred herein as SEQ ID NO:3.
(49) 2,6-Sialyltransferase
(50) The coding region of the gene for beta-galactosamide alpha-2,6-sialyltransferase 1 (2,6-sialyltransferase, ST6GAL1) was used according to Grundmann et al. (1990). The nucleotide sequence is banked as NM_003032 and referred herein as SEQ ID NO:4.
(51) Plasmids
(52)
EXAMPLES
Example 1 Construction of the FSH Expression Vector
(53) The coding sequence of FSH alpha polypeptide (AH007338, SEQ ID NO:1) and FSH beta polypeptide (NM_003032, SEQ ID 2) were amplified by PCR using the primer combinations FSHa-fw and FSHa-rev and FSHb-fw and FSHb-rec respectively.
(54) TABLE-US-00001 FSHa-fw (SEQIDNO:9) 5-CCAGGATCCGCCACCATGGATTACTACAGAAAAATATGC-3 FSHa-rev (SEQIDNO:10) 5-GGATGGCTAGCTTAAGATTTGTGATAATAAC-3 FSHb-fw (SEQIDNO:11) 5-CCAGGCGCGCCACCATGAAGACACTCCAGTTTTTC-3 FSHb-rev (SEQIDNO:12) 5-CCGGGTTAACTTATTATTCTTTCATTTCACCAAAGG-3
(55) The resulting amplified FSH beta DNA was digested with the restriction enzymes AscI and HpaI and inserted into the AscI and HpaI sites on the CMV driven mammalian expression vector carrying a neomycin selection marker. Similarly the FSH alpha DNA was digested with BamHI and NheI and inserted into the sites BamHI and NheI on the expression vector already containing the FSH beta polypeptide DNA.
(56) The vector DNA was used to transform the DH5 strain of E. coli. Sixty colonies were picked for amplification and fifty seven contained the vector containing both FSH alpha and beta. Twenty of these were selected for sequencing and all contained the correct sequences according to SEQ ID NO:1 and SEQ ID NO:2. Plasmid pFSH A+B#17 was selected for transfection (
Example 2 Construction of the ST3 Expression Vector
(57) The coding sequence of beta-galactoside alpha-2,3-sialyltransferase 4 (ST3, L23767, SEQ ID NO:3) was amplified by PCR using the primer combination 2,3STfw and 2,3STrev.
(58) TABLE-US-00002 2,3STfw (SEQIDNO:13) 5-CCAGGATCCGCCACCATGTGTCCTGCAGGCTGGAAGC-3 2,3STrev (SEQIDNO:14) 5-TTTTTTTCTTAAGTCAGAAGGACGTGAGGTTCTTG-3
(59) The resulting amplified ST3 DNA was digested with the restriction enzymes BamHI and AflII and inserted into the BamHI and AflII sites on the CMV driven mammalian expression vector carrying a hygromycin resistance marker. The vector was amplified as previously described and sequenced. Clone pST3#1 (
Example 3 Construction of the ST6 Expression Vector
(60) The coding sequence of beta-galactosamide alpha-2,6-sialyltransferase 1 (ST6, NM_003032, SEQ ID NO:4) was amplified by PCR using the primer combination 2,6STfw and 2,6STrev.
(61) TABLE-US-00003 2,6STfw (SEQIDNO:15) 5-CCAGGATCCGCCACCATGATTCACACCAACCTGAAG-3 2,6STrev (SEQIDNO:16) 5-TTTTTTTCTTAAGTTAGCAGTGAATGGTCCGG-3
(62) The resulting amplified ST6 DNA was digested with the restriction enzymes BamHI and AflII and inserted into the BamHI and AflII sites on the CMV driven mammalian expression vector carrying a hygromycin resistance marker. The vector was amplified as previously described and sequenced. Clone pST6#11 (
Example 4 Stable Expression of pFSH A+B in PER.C6 Cells. Transfection Isolation and Screening of Clones
(63) PER.C6 clones producing FSH were generated by expressing both polypeptide chains of FSH from a single plasmid (see Example 1).
(64) To obtain stable clones a liposome based transfection agent with the pFSH A+B construct. Stable clones were selected in VPRO supplemented with 10% FCS and containing G418. Three weeks after transfection G418 resistant clones grew out. A total of 250 clones were selected for isolation. The isolated clones were cultured in selection medium until 70-80% confluent. Supernatants were assayed for FSH protein content using an FSH selective ELISA and pharmacological activity at the FSH receptor in cloned cell line, using a cAMP accumulation assay. Clones (98) expressing functional protein were progressed for culture expansion to 24 well, 6 well and T80 flasks.
(65) Studies to determine productivity and quality of the material from seven clones were initiated in T80 flasks to generate sufficient material. Cells were cultured in supplemented media as previously described for 7 days and the supernatant harvested. Productivity was determined using the FSH selective ELISA. The isoelectric profile of the material was determined (Example 6). Representative samples are shown in
Example 5 Level of Sialylation is Increased in Cells that Over Express 2,3- or 2,6-Sialyltransferase. Stable Expression of pST3 or pST6 in FSH Expressing PER.C6 Cells; Transfection Isolation and Screening of Clones
(66) PER.C6 clones producing highly sialylated FSH were generated by expressing 2,3 sialyltransferase or 2,6 sialyltransferase from separate plasmids (see Examples 2 and 3) in PER.C6 cells already expressing both polypeptide chains of FSH (see Example 4). Four clones produced from PER.C6 cells as set out in Example 4 were selected for their characteristics including productivity, good growth profile, production of functional protein, and produced FSH which included some sialylation.
(67) Stable clones were generated as previously described in Example 4. A total of 202 clones from the 2,3-sialyltransferase program and 210 clones from the 2,6-sialyltransferase program were isolated, expanded and assayed. The final clone number for the 2,3-study was 12 and 30 for the 2,6-study.
(68) The 2,3-sialyltransferase clones were adapted to serum free media and suspension conditions.
(69) As before clones were assayed using a FSH selective ELISA, functional response in an FSH receptor cell line, IEF (Example 6), metabolic clearance rate (Example 9) and Steelman Pohley analysis (Example 10). Results were compared to a commercially available recombinant FSH (GONAL-F, Serono) and the parental FSH PER.C6 cell lines. Representative samples are shown in
(70) In conclusion, expression of FSH together with sialyltransferase in PER.C6 cells results in increased levels of sialylated FSH compared to cells expressing FSH only.
Example 6 Analysis of the pI of PER.C6 Cell Produced FSH Isoforms by Isoelectric Focussing
(71) Electrophoresis is defined as the transport of charged molecules through a solvent by an electrical field. The mobility of a biological molecule through an electric field will depend on the field strength, net charge on the molecule, size and shape of the molecule, ionic strength and properties of the medium through which the molecules migrate.
(72) Isoelectric focusing (IEF) is an electrophoretic technique for the separation of proteins based on their pI. The pI is the pH at which a protein has no net charge and will not migrate in an electric field. The sialic acid content of the FSH isoforms subtly alters the pI point for each isoform, which can be exploited using this technique to visualise the FSH isoforms produced in PER.C6 cells from each clone.
(73) The isoelectric points of the FSH isoforms produced in PER.C6 cell culture supernatants were analysed using isoelectric focussing. Cell culture media from PER.C6 cell FSH clones was produced as described in Example 4 and 5.
(74) FSH samples produced in PER.C6 cells were separated on Novex IEF Gels containing 5% polyacrylamide under native conditions on a pH 3.0-7.0 gradient in an ampholyte solution pH 3.0-7.0.
(75) Proteins were transferred onto supported nitrocellulose and visualised using a primary anti-FSHa monoclonal antibody, secondary anti-mouse IgG alkaline phosphatase conjugated antibody and 5-bromo-4-chloro-3-indolyl-phosphate (BCIP) and nitro blue tetrazolium (NBT) reagent to visualise the bands.
(76) As indicated in
(77)
(78)
(79) Using this method clones producing FSH isoforms with a higher number of sialic acid molecules were identified. Engineering with 2,3- or 2,6-sialyltransferase resulted in clones with more sialic acid and a lower pI.
Example 7 Analysis of the Sialic Acid Linkages of PER.C6 Cell Produced FSH
(80) Glycoconjugates were analysed using a lectin based glycan differentiation method. With this method glycoproteins and glycoconjugates bound to nitrocellulose can be characterized. Lectins selectively recognize a particular moiety, for example 2,3 linked sialic acid. The lectins applied are conjugated with the steroid hapten digoxigenin which enables immunological detection of the bound lectins.
(81) Purified FSH produced from a PER.C6 cell parental clone (no additional sialyltransferase), a 2,3-sialyltransferase engineered clone and a 2,6-sialyltransferase engineered clone were separated using standard SDS-PAGE techniques. A commercially available recombinant FSH (GONAL-F, Serono) was used as a standard.
(82) Sialic acid was analysed using the DIG Glycan Differentiation Kit (Cat. No. 11 210 238 001, Roche) according to the manufacturers instructions. Positive reactions with Sambucus nigra agglutinin (SNA) indicated terminally linked (2-6) sialic acid. Positive reactions with Maackia amurensis agglutinin II (MAA): indicated terminally linked (2-3) sialic acid
(83) In summary the parental clone 005 contained low levels of both 2,3- and 2,6-sialic acid. The clones engineered with 2,3-sialyltransferase contained high levels of 2,3-sialic acid linkages and low levels of 2,6-sialic acid linkages. Clones engineered with 2,6-sialyltransferase contained high levels of 2,6-sialic acid linkages and low levels of 2,3-sialic acid linkages. The standard control GONAL-F FSH only contains 2,3-sialic acid linkages. This is consistent with what is known about recombinant proteins produced in Chinese Hamster ovary (CHO) cells (Kagawa et al, 1988, Takeuchi et al, 1988, Svensson et al., 1990).
(84)
(85) In conclusion, engineering of FSH producing PER.C6 cells with 2,3- or 2,6-sialyltransferase successfully increased the number of sialic acid molecules conjugated to the FSH in the sample.
Example 8a Quantification of Total Sialic Acid
(86) Sialic acid is a protein-bound carbohydrate considered to be a mono-saccharide and occurs in combination with other mono-saccharides like galactose, mannose, glucosamine, galactosamine and fucose.
(87) The total sialic acid on purified rFSH (Example 11) was measured using an enzymatic sialic acid quantification kit according to the manufacturers protocol (Sigma, Sialic-Q). In short N-acetylneuraminic acid aldolase catalyses sialic acid to N-acetylmannoasine and pyruvic acid. The pyruvic acid can be reduced to lactic acid by -NADH and lactic dehydrogenase. B-NADH oxidation can be accurately measured spectrophotometrically.
(88) Protein concentration was measured in microtiter plates using a commercial bicinchoninic acid (BCA) assay kit (Sigma, B 9643) based on the Lowry method (Lowry et al, 1951).
(89) The total sialic acid content of FSH produced in PER.C6 cells was measured and found to be greater than 6 mol/mol.
Example 8b Quantification of Relative Amounts of 2,3, 2,6 and 2,8 Sialic Acid
(90) The relative percentage amounts of 2,3, 2,6 and 2,8 sialic acid on purified rFSH (Example 11) were measured using known techniques.
(91) Each sample of rFSH was immobilized (gel block), washed, reduced, alkylated and digested with PNGase F overnight. The N-glycans were then extracted and processed. N-glycans for NP-HPLC and WAX-HPLC analysis were labelled with the fluorophore 2AB as detailed in Royle et al. The N-glycans were run on normal phase (NP) HPLC on a TSK amide column (as detailed in Royle et al) with retention times expressed in glucose units (GU).
(92) Samples of the extracted, pooled, glycans (extracted as above) were digested with different sialidases to determine the linkages. NAN 1 (recombinant sialidase) releases 2,3 linked non-reducing terminal sialic acids (NeuNAc and NeuNGc), ABS (Arthrobacter ureafaciens sialidase) releases 2,3, 2,6 and 2,8 linked non-reducing terminal sialic acids (NeuNAc and NeuNGc). Samples were analysed by NP-HPLC, to allow comparison of the undigested sample with that digested with NAN1 and that digested with ABS. Comparison of the three NP-HPLC traces (undigested, NAN1 digested, ABS digested) shows that digestion with ABS and NAN1 give different results. This indicates that the samples have sialic acids with 2,3, 2,6 and 2,8 linkages. The relative percentages were calculated from structures present in the undigested glycan pools and were found to be in the ranges 65%-85% (e.g. 77.75%) for 2,3 sialylation; 15 to 35% (e.g. 21.46%) for 2,6 sialylation; and 0.1 to 3% for 2,8 sialylation.
Example 8c Quantification of Relative Amounts Mono, Di, Tri and Tetra Antennary Sialylated Structures
(93) The relative percentage amounts of mono, di, tri and tetra sialylated structures on glycans extracted from purified rFSH (Example 11) were measured using known techniques.
(94) Each sample of rFSH was immobilized (gel block), washed, reduced, alkylated and digested with PNGase F overnight. The N-glycans were then extracted and processed. N-glycans for NP-HPLC and WAX-HPLC analysis were labelled with the fluorophore 2AB as detailed in Royle et al.
(95) Weak anion exchange (WAX) HPLC to separate the N-glycans by charge (Example 8b) was carried out as set out in Royle et al, with a Fetuin N-glycan standard as reference. Glycans were eluted according to the number of sialic acids they contained. All samples included mono (1S), di(2S), tri(3S) and tetra(4S) sialylated structures. The relative amounts of sialylated structures were found to be in the following ratios (1S:2S:4S:4S): 9-15%: 27-30%: 30-36%: 25-29% (for example 10.24:28.65:35.49:25.62).
Example 9 Determination of the Metabolic Clearance Rates of rFSH
(96) To determine the metabolic clearance rate (MCR) of FSH samples produced in PER.C6 cells, conscious female rats (3 animals per clone) were injected into the tail vein at time zero with a bolus of rFSH (1-10 g/rat, based on ELISA quantification of samples, DRG EIA 1288). Blood samples (400 l) were taken from the tip of the tail at 1, 2, 4, 8, 12, 24 and 32 hours after test sample injection. Serum was collected by centrifugation and assayed for FSH content by ELISA (DRG EIA 1288).
(97) The asialoglycoprotein receptor (ASGP-R) recognizes desialyated (galactose-terminated) glycoproteins such as asialofetuin (ASF). (Pricer and Ashwell, 1971. Van Lenten and Ashwell, 1972). The ASGP receptor and the bound desialyated glycoprotein are internalized into the cell where the receptor is recycled and the ligand is degraded (Regoeczi et al, 1978, Steer and Ashwell, 1980).
(98) To investigate if FSH material produced in PER.C6 cells was cleared via this mechanism, the ASGP-R was saturated with asialofetuin. The metabolic clearance rate of parental, 2,6 or 2,3-sialyltransferase engineered material was determined as described with co administration of a minimum 7500-fold molar excess of asialofetuin to saturate the ASGP-R for 1-2 h.
(99) The material produced by the parental PER.C6 cell FSH clones contained some longer MCR material but a high percentage was cleared quickly (
(100)
(101)
(102)
(103)
Example 10 Steelman-Pohley In Vivo Assay
(104) To demonstrate increasing sialic acid content on FSH results in an increased biological effect, the increase in ovarian weights in rats by highly sialylated FSH such as produced in Example 5 was examined.
(105) The increase in ovarian weights due to the rFSH produced in PER.C6 cell clones were analysed according to the method of Steelman and Pohley (1953). rFSH produced in PER.C6 cells from filtered cell media samples was quantified by ELISA (DRG,EIA-1288). The samples (PER.C6 cell produced rFSH) and standards (GONAL-F rFSH) were tested at five different doses (3 animals/dose). GONAL-F was dosed at 50, 100, 200, 400, and 800 ng/rat. The sample doses were calculated using their AUC values relative to GONAL-F, typically 0.05-10 g/rat.
(106)
(107)
(108)
(109) In conclusion, the undersialylated material produced by the parental PER.C6 cell FSH clones (
Example 11 Production and Purification Overview
(110) A procedure was developed to produce FSH in PER.C6 cells that were cultured in suspension in serum free medium. The procedure is described below and was applied to several FSH-producing PER.C6 cell lines.
(111) FSH from the parental clone 005, 2,3-clone 007 and 2,6 clone 059 was prepared using a using a modification of the method described by Lowry et al. (1976).
(112) For the production of FSH in PER.C6 cells, the cell lines were adapted to a serum-free medium, i.e., Excell 525 (JRH Biosciences). The cells were first cultured to form a 70%-90% confluent monolayer in a T80 culture flask. On passage the cells were re-suspended in the serum free medium, Excell 525+4 mM L-Glutamine, to a cell density of 0.310.sup.6 cells/ml. A 25 ml cell suspension was put in a 250 ml shaker flask and shaken at 100 rpm at 37 C. at 5% CO.sub.2. After reaching a cell density of >110.sup.6 cells/ml, the cells were sub-cultured to a cell density of 0.2 or 0.310.sup.6 cells/ml and further cultured in shaker flasks at 37 C., 5% CO.sub.2 and 100 rpm.
(113) For the production of FSH, the cells were transferred to a serum-free production medium, i.e., VPRO (JRH Biosciences), which supports the growth of PER.C6 cells to very high cell densities (usually >10.sup.7 cells/ml in a batch culture). The cells were first cultured to >110.sup.6 cells/ml in Excell 525, then spun down for 5 min at 1000 rpm and subsequently suspended in VPRO medium+6 mM L-glutamine to a density of 110.sup.6 cells/ml. The cells were then cultured in a shaker flask for 7-10 days at 37 C., 5% CO2 and 100 rpm. During this period, the cells grew to a density of >10.sup.7 cells/ml. The culture medium was harvested after the cell viability started to decline. The cells were spun down for 5 min at 1000 rpm and the supernatant was used for the quantification and purification of FSH. The concentration of FSH was determined using ELISA (DRG EIA 1288).
(114) Thereafter, purification of FSH was carried out using a modification of the method described by Lowry et al. (1976). This was achieved by chromatography on DEAE cellulose, gel filtration on SEPHADEX G100, adsorption chromatography on hydroxyapatite, and preparative polyacrylamide electrophoresis.
(115) During all chromatographic procedures, the presence of immunoreactive FSH was confirmed by RIA (DRG EIA 1288) and IEF (Example 6).
REFERENCES
(116) Andersen C Y, Westergaard L G, and van Wely M. (2004). FSH isoform composition of commercial gonadotrophin preparations: a neglected aspect? Reprod. Biomed. Online. 9(2), 231-236. Arey B J, Stevis P E, Deecher D C, Shen E S, Frail D E, Negro-Vilar A, and Lopez F J. (1997) Induction of promiscuous G protein coupling of the follicle-stimulating hormone (FSH) receptor: a novel mechanism for transducing pleiotropic actions of FSH isoforms. Mol Endocrinol. 11(5), 517-526. Baenziger J U and Green E D. (1988). Pituitary glycoprotein hormone oligosaccharides: structure, synthesis and function of the asparagine-linked oligosaccharides on lutropin, follitropin and thyrotropin. Biochim Biophys Acta. 947(2), 287-306. Bassett R M, and Driebergen R. (2005). Continued improvements in the quality and consistency of follitropin alfa, recombinant human FSH. Reprod Biomed Online. 10(2), 169-177. Damin-Matsumura P, Zaga V, Maldonado A, Snchez-Hernndez C, Timossi C, and Ulloa-Aguirre A. (1999). Oestrogens regulate pituitary alpha2,3-sialyltransferase messenger ribonucleic acid levels in the female rat. J Mol Endocrinol. 23(2), 153-165. D'Antonio M., Borrelli F., Datola A., Bucci R., Mascia M., Polletta P., Piscitelli D., and Papoian R. (1999) Biological characterization of recombinant human follicle stimulating hormone isoforms. Human Reproduction 14, 1160-1167 Dalpathado D S, Irungu J, Go E P, Butnev V Y, Norton K, Bousfield G R, and Desaire H. (2006). Comparative glycomics of the glycoprotein follicle stimulating hormone: glycopeptide analysis of isolates from two mammalian species. Biochemistry. 45(28), 8665-8673. Dias J A, Van Roey P. (2001). Structural biology of human follitropin and its receptor. Arch Med Res. 32(6), 510-519 Fiddes, J. C. and Goodman, H. M. (1979) Isolation, cloning and sequence analysis of the cDNA for the alpha-subunit of human chorionic gonadotropin. Nature, 281, 351-356. Flack, M. R., Bennet, A. P., Froehlich, J. Anasti, J N and Nisula, B. (1994). Increased biological activity due to basic isoforms in recombinant human follicle-stimulating hormone produced in a human cell line. J. Clin. Endocrinol. Metab., 79, 756-760 Fox K M, Dias J A, and Van Roey P. (2001). Three-dimensional structure of human follicle-stimulating hormone. Mol Endocrinol. 15(3), 378-89 Grabenhorst E, Hoffmann A, Nimtz M, Zettlmeissl G, and Conradt H S. (1995). Construction of stable BHK-21 cells coexpressing human secretory glycoproteins and human Gal(beta 1-4)GlcNAc-R alpha 2,6-sialyltransferase alpha 2,6-linked NeuAc is preferentially attached to the Gal(beta 1-4)GlcNAc(beta 1-2)Man(alpha 1-3)-branch of diantennary oligosaccharides from secreted recombinant beta-trace protein. Eur J Biochem. 232(3), 718-25. Green E D and Baenziger J U. (1988). Asparagine-linked oligosaccharides on lutropin, follitropin, and thyrotropin. II. Distributions of sulfated and sialylated oligosaccharides on bovine, ovine, and human pituitary glycoprotein hormones. J Biol Chem. 263(1), 36-44. Grundmann, U., Nerlich, C., Rein, T. and Zettlmeissl, G. (1990). Complete cDNA sequence encoding human beta-galactoside alpha-2,6-sialyltransferase. G Nucleic Acids Res. 18 (3), 667 Howles, C. M. (1996). Genetic engineering of human FSH (Gonal-F). Hum Reprod. Update, 2, 172-191. Kagawa Y, Takasaki S, Utsumi J, Hosoi K, Shimizu H, Kochibe N, and Kobata A. (1988). Comparative study of the asparagine-linked sugar chains of natural human interferon-beta 1 and recombinant human interferon-beta 1 produced by three different mammalian cells. J Biol Chem. 263(33), 17508-17515. Keene, J. L., Matzuk, M. M., Otani, T., Fauser, B, C, J, M., Galway, A. B., Hsueh, A. J. W. and Boime, I. (1989). Expression of Biologically active Human Follitropin in Chinese Hamster Ovary Cells. The Journal of Biological Chemistry, 264(9), 4769-4775. Kitagawa, H. and Paulson, J. C (1994) Cloning of a novel alpha 2,3-sialyltransferase that sialylates glycoprotein and glycolipid carbohydrate groups. J. Biol. Chem. 269(2), 1394-1401. Lee E U, Roth J, and Paulson J C (1989) Alteration of terminal glycosylation sequences on N-linked oligosaccharides of Chinese hamster ovary cells by expression of beta-galactoside alpha 2,6-sialyltransferase. J Biol Chem. 264(23), 13848-13855. de Leeuw, R., Mulders, J., Voortman, G. Rombout, F. Damm, J. and Kloosterboer, L. (1996) Structure-function relationship of recombinant follicle stimulating hormone (Puregon). Mol. Hum. Reprod., 2, 361-369. Lowry O H, Rosebrough N J, Farr A L, Randall R J. (1951) Protein measurement with the Folin phenol reagent. J Biol Chem. 193(1), 265-75. Lowry, P J, McLean, C, Jones R L and Satgunasingam N. (1976) Purification of anterior pituitary and hypothalamic hormones Clin Pathol Suppl (Assoc Clin Pathol). 7, 16-21. Pierce J G, and Parsons T F (1981) Glycoprotein hormones: structure and function Annu Rev Biochem. 50, 465-495. Pricer W E Jr, and Ashwell G. (1971). The binding of desialylated glycoproteins by plasma membranes of rat liver. J Biol Chem. 246(15), 4825-33. Rathnam P, and Saxena B B. (1975). Primary amino acid sequence of follicle-stimulating hormone from human pituitary glands. I. alpha subunit. J Biol Chem.; 250(17):6735-6746. Regoeczi E, Debanne M T, Hatton M C, and Koj A. (1978) Elimination of asialofetuin and asialoorosomucoid by the intact rat. Quantitative aspects of the hepatic clearance mechanism. Biochim Biophys Acta. 541(3), 372-84. Royle L, Radcliffe C M, Dwek R A and Rudd P M (2006) Methods in Molecular Biology, ed I Brockhausen-Schutzbach (Humana Press), 347: Glycobiology protocols, 125-144. Ryan R J, Keutmann H T, Charlesworth M C, McCormick D J, Milius R P, Calvo F O and Vutyavanich T. (1987). Structure-function relationships of gonadotropins. Recent Prog Horm Res.; 43:383-429. Saxena B B and Rathnam P. (1976) Amino acid sequence of the beta subunit of follicle-stimulating hormone from human pituitary glands. J Biol Chem. 251(4), 993-1005 Steelman S L, and Pohley F M. (1953) Assay of the follicle stimulating hormone based on the augmentation with human chorionic gonadotropin. Endocrinology. 53(6), 604-616. Steer C J, and Ashwell G. (1980) Studies on a mammalian hepatic binding protein specific for asialoglycoproteins. Evidence for receptor recycling in isolated rat hepatocytes. J Biol Chem. 255(7), 3008-13. Svensson E C, Soreghan B, and Paulson J C. (1990) Organization of the beta-galactoside alpha 2,6-sialyltransferase gene. Evidence for the transcriptional regulation of terminal glycosylation. J Biol Chem. 265(34):20863-20868. Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, and Kobata A (1988). Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. J Biol Chem. 263(8), 3657-3663. Timossi C M, Barrios de Tomasi J, Zambrano E, Gonzalez R, Ulloa-Aguirre A. (1998). A naturally occurring basically charged human follicle-stimulating hormone (FSH) variant inhibits FSH-induced androgen aromatization and tissue-type plasminogen activator enzyme activity in vitro. Neuroendocrinology. 67(3), 153-163. Timossi C M, Barrios-de-Tomasi J, Gonzlez-Surez R, Arranz M C, Padmanabhan V, Conn P M, and Ulloa-Aguirre A. (2000). Differential effects of the charge variants of human follicle-stimulating hormone. J Endocrinol. 165(2), 193-205. Ulloa-Aguirre, A., Espinoza, R., Damian-Matsumura, P. and Chappel, S. C. (1988) Immunological and biological potencies of the different molecular species of gonadotrophins. Hum. Reprod. 3, 491-501. Ulloa-Aguirre, A., Cravioto, A., Damin-Matsumura, P. Jimenez, M, Zambrano, E and Diaz-Sanchez, V. (1992) Biological characterization of the naturally occurring analogues of intrapituitary human follicle stimulating hormone. Hum. Reprod. 7, 23-30. Ulloa-Aguirre A, Midgley A R Jr, Beitins I Z, and Padmanabhan V. (1995). Follicle-stimulating isohormones: characterization and physiological relevance. Endocr Rev. 16(6), 765-787. Ulloa-Aguirre A, Maldonado A, Damin-Matsumura P, and Timossi C (2001). Endocrine regulation of gonadotropin glycosylation. Arch Med Res. 32(6), 520-532. Ulloa-Aguirre A, Timossi C, Barrios-de-Tomasi J, Maldonado A, and Nayudu P. (2003). Impact of carbohydrate heterogeneity in function of follicle-stimulating hormone: studies derived from in vitro and in vivo models. Biol Reprod. 69(2), 379-389. Van Lenten L, and Ashwell G. (1972) The binding of desialylated glycoproteins by plasma membranes of rat liver. Development of a quantitative inhibition assay. J Biol Chem. 247(14), 4633-40. Wide, L. and Albertsson-Wikland, K. (1990) Change in electrophoretic mobility of human follicle-stimulating hormone in serum after administration of gonadotropin-releasing hormone. J. Clin. Endocrinol. Metab. 70, 271-276. Wide, L. and Bakos, O. (1993). More basic forms of both human follicle-stimulating hormone and luteinizing hormone in serum at midcycle compared with the follicular or luteal phase. J. Clin. Endocrinol. Metab., 76, 885-889. Wide L, Naessn T, Sundstrm-Poromaa I, Eriksson K. (2007) Sulfonation and sialylation of gonadotropins in women during the menstrual cycle, after menopause, and with polycystic ovarian syndrome and in men. J Clin Endocrinol Metab.; 92(11), 4410-4417. Zambrano E, Zarin T, Olivares A, Barrios-de-Tomasi J, and Ulloa-Aguirre A. (1999). Receptor binding activity and in vitro biological activity of the human FSH charge isoforms as disclosed by heterologous and homologous assay systems: implications for the structure-function relationship of the FSH variants. Endocrine. 10(2), 113-121. Zhang X, Lok S H, and Kon O L (1998) Stable expression of human alpha-2,6-sialyltransferase in Chinese hamster ovary cells: functional consequences for human erythropoietin expression and bioactivity. Biochim Biophys Acta. 1425(3), 441-452.
(117) TABLE-US-00004 Sequences Folliclestimulatinghormonealphapolypeptide AccessionnumberAH007338 NucleotidesequenceofFSHalpha (SEQIDNO:1) 1ATGGATTACTACAGAAAATATGCAGCTATCTTTCTGGTCACATTGTCGGTGTTTCTGCAT 61GTTCTCCATTCCGCTCCTGATGTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCA 121TTCTTCTCCCAGCCGGGTGCCCCAATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCA 181TATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAG 241TCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTG 301GAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCTTAA ProteinsequenceofFSHalpha (SEQIDNO:5) 1MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP 61ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS 121YCSFGEMKE Folliclestimulatinghormonebetapolypeptide AccessionnumberNM_000510 NucleotidesequenceofFSHbeta (SEQIDNO:2) 1ATGAAGACACTCCAGTTTTTCTTCCTTTTCTGTTGCTGGAAAGCAATCTGCTGCAATAGC 61TGTGAGCTGACCAACATCACCATTGCAATAGAGAAAGAAGAATGTCGTTTCTGCATAAGC 121ATCAACACCACTTGGTGTGCTGGCTACTGCTACACCAGGGATCTGGTGTATAAGGACCCA 181GCCAGGCCCAAAATCCAGAAAACATGTACCTTCAAGGAACTGGTATATGAAACAGTGAGA 241GTGCCCGGCTGTGCTCACCATGCAGATTCCTTGTATACATACCCAGTGGCCACCCAGTGT 301CACTGTGGCAAGTGTGACAGCGACAGCACTGATTGTACTGTGCGAGGCCTGGGGCCCAGC 361TACTGCTCCTTTGGTGAAATGAAAGAATAA ProteinsequenceofFSHbeta (SEQIDNO:6) 1MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP 61ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS 121YCSFGEMKE Beta-galactosidealpha-2,3-sialyltransferase4 AccessionNumberL23767 NucleotidesequenceofST3GAL4 (SEQIDNO:3) 1ATGTGTCCTGCAGGCTGGAAGCTCCTGGCCATGTTGGCTCTGGTCCTGGTCGTCATGGTG 61TGGTATTCCATCTCCCGGGAAGACAGGTACATCGAGCTTTTTTATTTTCCCATCCCAGAG 121AAGAAGGAGCCGTGCCTCCAGGGTGAGGCAGAGAGCAAGGCCTCTAAGCTCTTTGGCAAC 181TACTCCCGGGATCAGCCCATCTTCCTGCGGCTTGAGGATTATTTCTGGGTCAAGACGCCA 241TCTGCTTACGAGCTGCCCTATGGGACCAAGGGGAGTGAGGATCTGCTCCTCCGGGTGCTA 301GCCATCACCAGCTCCTCCATCCCCAAGAACATCCAGAGCCTCAGGTGCCGCCGCTGTGTG 361GTCGTGGGGAACGGGCACCGGCTGCGGAACAGCTCACTGGGAGATGCCATCAACAAGTAC 421GATGTGGTCATCAGATTGAACAATGCCCCAGTGGCTGGCTATGAGGGTGACGTGGGCTCC 481AAGACCACCATGCGTCTCTTCTACCCTGAATCTGCCCACTTCGACCCCAAAGTAGAAAAC 541AACCCAGACACACTCCTCGTCCTGGTAGCTTTCAAGGCAATGGACTTCCACTGGATTGAG 601ACCATCCTGAGTGATAAGAAGCGGGTGCGAAAGGGTTTCTGGAAACAGCCTCCCCTCATC 661TGGGATGTCAATCCTAAACAGATTCGGATTCTCAACCCCTTCTTCATGGAGATTGCAGCT 721GACAAACTGCTGAGCCTGCCAATGCAACAGCCACGGAAGATTAAGCAGAAGCCCACCACG 781GGCCTGTTGGCCATCACGCTGGCCCTCCACCTCTGTGACTTGGTGCACATTGCCGGCTTT 841GGCTACCCAGACGCCTACAACAAGAAGCAGACCATTCACTACTATGAGCAGATCACGCTC 901AAGTCCATGGCGGGGTCAGGCCATAATGTCTCCCAAGAGGCCCTGGCCATTAAGCGGATG 961CTGGAGATGGGAGCTATCAAGAACCTCACGTCCTTCTGA ProteinSequenceofST3GAL4 (SEQIDNO:7) 1MCPAGWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGN 61YSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCV 121VVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVEN 181NPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAA 241DKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITL 301KSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF Beta-galactosamidealpha-2,6-sialyltransferase1 AccessionnumberNM_003032 NucleotidesequenceofST6GAL1 (SEQIDNO:4) 1ATGATTCACACCAACCTGAAGAAAAAGTTCAGCTGCTGCGTCCTGGTCTTTCTTCTGTTT 61GCAGTCATCTGTGTGTGGAAGGAAAAGAAGAAAGGGAGTTACTATGATTCCTTTAAATTG 121CAAACCAAGGAATTCCAGGTGTTAAAGAGTCTGGGGAAATTGGCCATGGGGTCTGATTCC 181CAGTCTGTATCCTCAAGCAGCACCCAGGACCCCCACAGGGGCCGCCAGACCCTCGGCAGT 241CTCAGAGGCCTAGCCAAGGCCAAACCAGAGGCCTCCTTCCAGGTGTGGAACAAGGACAGC 301TCTTCCAAAAACCTTATCCCTAGGCTGCAAAAGATCTGGAAGAATTACCTAAGCATGAAC 361AAGTACAAAGTGTCCTACAAGGGGCCAGGACCAGGCATCAAGTTCAGTGCAGAGGCCCTG 421CGCTGCCACCTCCGGGACCATGTGAATGTATCCATGGTAGAGGTCACAGATTTTCCCTTC 481AATACCTCTGAATGGGAGGGTTATCTGCCCAAGGAGAGCATTAGGACCAAGGCTGGGCCT 541TGGGGCAGGTGTGCTGTTGTGTCGTCAGCGGGATCTCTGAAGTCCTCCCAACTAGGCAGA 601GAAATCGATGATCATGACGCAGTCCTGAGGTTTAATGGGGCACCCACAGCCAACTTCCAA 661CAAGATGTGGGCACAAAAACTACCATTCGCCTGATGAACTCTCAGTTGGTTACCACAGAG 721AAGCGCTTCCTCAAAGACAGTTTGTACAATGAAGGAATCCTAATTGTATGGGACCCATCT 781GTATACCACTCAGATATCCCAAAGTGGTACCAGAATCCGGATTATAATTTCTTTAACAAC 841TACAAGACTTATCGTAAGCTGCACCCCAATCAGCCCTTTTACATCCTCAAGCCCCAGATG 901CCTTGGGAGCTATGGGACATTCTTCAAGAAATCTCCCCAGAAGAGATTCAGCCAAACCCC 961CCATCCTCTGGGATGCTTGGTATCATCATCATGATGACGCTGTGTGACCAGGTGGATATT 1021TATGAGTTCCTCCCATCCAAGCGCAAGACTGACGTGTGCTACTACTACCAGAAGTTCTTC 1081GATAGTGCCTGCACGATGGGTGCCTACCACCCGCTGCTCTATGAGAAGAATTTGGTGAAG 1141CATCTCAACCAGGGCACAGATGAGGACATCTACCTGCTTGGAAAAGCCACACTGCCTGGC 1201TTCCGGACCATTCACTGCTAA ProteinSequenceofST6GAL1 (SEQIDNO:8) 1MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS 61QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN 121KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP 181WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE 241KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM 301PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF 361DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC