ANTI-MEFLIN ANTIBODY FOR USE IN TREATMENT OF CANCER IN SUBJECT HAVING CANCER, AND PHARMACEUTICAL COMPOSITION COMPRISING THE ANTIBODY
20230084099 · 2023-03-16
Assignee
- NATIONAL UNIVERSITY CORPORATION TOKAI NATIONAL HIGHER EDUCATION AND RESEARCH SYSTEM (Nagoya-shi, JP)
- Sowakai Medical Foundation (Kurashiki-shi, JP)
Inventors
- Atsushi ENOMOTO (Aichi, JP)
- Nobutoshi ESAKI (Aichi, JP)
- Masahide TAKAHASHI (Aichi, JP)
- Yuki MIYAI (Aichi, JP)
- Ryota ANDO (Aichi, JP)
- Yukihiro SHIRAKI (Aichi, JP)
- Yoshihiro NISHIDA (Aichi, JP)
- Makoto MATSUYAMA (Okayama, JP)
- Shino MANABE (Tokyo, JP)
Cpc classification
A61P1/04
HUMAN NECESSITIES
A61K47/6889
HUMAN NECESSITIES
A61K47/6851
HUMAN NECESSITIES
A61P43/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61P1/18
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
A61P15/00
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
An anti-MEFLIN antibody and a pharmaceutical composition comprising the antibody is described. The pharmaceutical composition may comprise an antibody-drug conjugate (ADC) of the anti-MEFLIN antibody and a cytotoxic agent, which may be connected to each other by a linker. The pharmaceutical composition may be used in the treatment of a cancer in a subject.
Claims
1. A pharmaceutical composition for use in the treatment of a cancer, comprising an antibody-drug conjugate (ADC) of an antibody that binds to MEFLIN and a cytotoxic agent.
2. The pharmaceutical composition according to claim 1, wherein the antibody has internalization activity.
3. The pharmaceutical composition according to claim 1, wherein the antibody and the cytotoxic agent of the ADC are connected to each other via a linker, and wherein the linker has a cleavage site that is intracellularly cleaved.
4. An antibody that binds to MEFLIN, the antibody being selected from the group consisting of the following antibodies: (1A) an antibody having a heavy chain variable region comprising heavy chain CDR1 having the amino acid sequence set forth in SEQ ID NO: 1, heavy chain CDR2 having the amino acid sequence set forth in SEQ ID NO: 2, and heavy chain CDR3 having the amino acid sequence set forth in SEQ ID NO: 3, and a light chain variable region comprising light chain CDR1 having the amino acid sequence set forth in SEQ ID NO: 4, light chain CDR2 having the amino acid sequence set forth in SEQ ID NO: 5, and light chain CDR3 having the amino acid sequence set forth in SEQ ID NO: 6; (1B) an antibody having a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 7 and a light chain variable region having the amino acid sequence set forth in SEQ ID NO: 8; (1C) an antibody that competes with the above-mentioned antibody (1B) for binding to the MEFLIN protein; and (1D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (1B); (2A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 9, the heavy chain CDR2 set forth in SEQ ID NO: 10, and the heavy chain CDR3 set forth in SEQ ID NO: 11, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 12, the light chain CDR2 set forth in SEQ ID NO: 13, and the light chain CDR3 set forth in SEQ ID NO: 14; (2B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 15 and the light chain variable region set forth in SEQ ID NO: 16; (2C) an antibody that competes with the above-mentioned antibody (2B) for binding to the MEFLIN protein; and (2D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (2B); (3A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 17, the heavy chain CDR2 set forth in SEQ ID NO: 18, and the heavy chain CDR3 set forth in SEQ ID NO: 19, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 20, the light chain CDR2 set forth in SEQ ID NO: 21, and the light chain CDR3 set forth in SEQ ID NO: 22; (3B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 23 and the light chain variable region set forth in SEQ ID NO: 24; (3C) an antibody that competes with the above-mentioned antibody (3B) for binding to the MEFLIN protein; and (3D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (3B); (4A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 25, the heavy chain CDR2 set forth in SEQ ID NO: 26, and the heavy chain CDR3 set forth in SEQ ID NO: 27, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 28, the light chain CDR2 set forth in SEQ ID NO: 29, and the light chain CDR3 set forth in SEQ ID NO: 30; (4B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 31 and the light chain variable region set forth in SEQ ID NO: 32; (4C) an antibody that competes with the above-mentioned antibody (4B) for binding to the MEFLIN protein; and (4D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (4B); (5A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 33, the heavy chain CDR2 set forth in SEQ ID NO: 34, and the heavy chain CDR3 set forth in SEQ ID NO: 35, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 36, the light chain CDR2 set forth in SEQ ID NO: 37, and the light chain CDR3 set forth in SEQ ID NO: 38; (5B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 39 and the light chain variable region set forth in SEQ ID NO: 40; (5C) an antibody that competes with the above-mentioned antibody (5B) for binding to the MEFLIN protein; and (5D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (5B); (6A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 41, the heavy chain CDR2 set forth in SEQ ID NO: 42, and the heavy chain CDR3 set forth in SEQ ID NO: 43, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 44, the light chain CDR2 set forth in SEQ ID NO: 45, and the light chain CDR3 set forth in SEQ ID NO: 46; (6B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 47 and the light chain variable region set forth in SEQ ID NO: 48; (6C) an antibody that competes with the above-mentioned antibody (6B) for binding to the MEFLIN protein; and (6D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (6B); (7A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 49, the heavy chain CDR2 set forth in SEQ ID NO: 50, and the heavy chain CDR3 set forth in SEQ ID NO: 51, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 52, the light chain CDR2 set forth in SEQ ID NO: 53, and the light chain CDR3 set forth in SEQ ID NO: 54; (7B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 55 and the light chain variable region set forth in SEQ ID NO: 56; (7C) an antibody that competes with the above-mentioned antibody (7B) for binding to the MEFLIN protein; and (7D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (7B); (8A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 57, the heavy chain CDR2 set forth in SEQ ID NO: 58, and the heavy chain CDR3 set forth in SEQ ID NO: 59, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 60, the light chain CDR2 set forth in SEQ ID NO: 61, and the light chain CDR3 set forth in SEQ ID NO: 62; (8B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 63 and the light chain variable region set forth in SEQ ID NO: 64; (8C) an antibody that competes with the above-mentioned antibody (8B) for binding to the MEFLIN protein; and (8D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (8B); (9A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 65, the heavy chain CDR2 set forth in SEQ ID NO: 66, and the heavy chain CDR3 set forth in SEQ ID NO: 67, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 68, the light chain CDR2 set forth in SEQ ID NO: 69, and the light chain CDR3 set forth in SEQ ID NO: 70; (9B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 71 and the light chain variable region set forth in SEQ ID NO: 72; (9C) an antibody that competes with the above-mentioned antibody (9B) for binding to the MEFLIN protein; and (9D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (9B); (10A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 73, the heavy chain CDR2 set forth in SEQ ID NO: 74, and the heavy chain CDR3 set forth in SEQ ID NO: 75, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 76, the light chain CDR2 set forth in SEQ ID NO: 77, and the light chain CDR3 set forth in SEQ ID NO: 78; (10B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 79 and the light chain variable region set forth in SEQ ID NO: 80; (10C) an antibody that competes with the above-mentioned antibody (10B) for binding to the MEFLIN protein; and (10D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (10B); (11A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 81, the heavy chain CDR2 set forth in SEQ ID NO: 82, and the heavy chain CDR3 set forth in SEQ ID NO: 83, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 84, the light chain CDR2 set forth in SEQ ID NO: 85, and the light chain CDR3 set forth in SEQ ID NO: 86; (11B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 87 and the light chain variable region set forth in SEQ ID NO: 88; (11C) an antibody that competes with the above-mentioned antibody (11B) for binding to the MEFLIN protein; and (11D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (11B); (12A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 89, the heavy chain CDR2 set forth in SEQ ID NO: 90, and the heavy chain CDR3 set forth in SEQ ID NO: 91, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 92, the light chain CDR2 set forth in SEQ ID NO: 93, and the light chain CDR3 set forth in SEQ ID NO: 94; (12B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 95 and the light chain variable region set forth in SEQ ID NO: 96; (12C) an antibody that competes with the above-mentioned antibody (12B) for binding to the MEFLIN protein; and (12D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (12B); (13A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 97, the heavy chain CDR2 set forth in SEQ ID NO: 98, and the heavy chain CDR3 set forth in SEQ ID NO: 99, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 100, the light chain CDR2 set forth in SEQ ID NO: 101, and the light chain CDR3 set forth in SEQ ID NO: 102; (13B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 103 and the light chain variable region set forth in SEQ ID NO: 104; (13C) an antibody that competes with the above-mentioned antibody (13B) for binding to the MEFLIN protein; and (13D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (13B); (14A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 105, the heavy chain CDR2 set forth in SEQ ID NO: 106, and the heavy chain CDR3 set forth in SEQ ID NO: 107, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 108, the light chain CDR2 set forth in SEQ ID NO: 109, and the light chain CDR3 set forth in SEQ ID NO: 110; (14B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 111 and the light chain variable region set forth in SEQ ID NO: 112; (14C) an antibody that competes with the above-mentioned antibody (14B) for binding to the MEFLIN protein; and (14D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (14B); (15A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 113, the heavy chain CDR2 set forth in SEQ ID NO: 114, and the heavy chain CDR3 set forth in SEQ ID NO: 115, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 116, the light chain CDR2 set forth in SEQ ID NO: 117, and the light chain CDR3 set forth in SEQ ID NO: 118; (15B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 119 and the light chain variable region set forth in SEQ ID NO: 120; (15C) an antibody that competes with the above-mentioned antibody (15B) for binding to the MEFLIN protein; and (15D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (15B); (16A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 121, the heavy chain CDR2 set forth in SEQ ID NO: 122, and the heavy chain CDR3 set forth in SEQ ID NO: 123, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 124, the light chain CDR2 set forth in SEQ ID NO: 125, and the light chain CDR3 set forth in SEQ ID NO: 126; (16B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 127 and the light chain variable region set forth in SEQ ID NO: 128; (16C) an antibody that competes with the above-mentioned antibody (16B) for binding to the MEFLIN protein; and (16D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (16B); and (17A) an antibody having a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 129, the heavy chain CDR2 set forth in SEQ ID NO: 130, and the heavy chain CDR3 set forth in SEQ ID NO: 131, and a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 132, the light chain CDR2 set forth in SEQ ID NO: 133, and the light chain CDR3 set forth in SEQ ID NO: 134; (17B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 135 and the light chain variable region set forth in SEQ ID NO: 136; (17C) an antibody that competes with the above-mentioned antibody (17B) for binding to the MEFLIN protein; and (17D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (17B).
5. A pharmaceutical composition comprising an antibody-drug conjugate (ADC) of an antibody according to claim 4 and a cytotoxic agent.
6. A method for treating a cancer in a subject, comprising administering to the subject the pharmaceutical composition of claim 5.
7. The method according to claim 6, wherein the cancer is sarcoma.
8. The method according to claim 7, wherein the cancer is a MEFLIN-positive sarcoma.
9. The method according to claim 7, wherein the sarcoma is selected from the group consisting of myxofibrosarcoma, malignant fibrous histiocytoma, liposarcoma, leiomyosarcoma, rhabdomyosarcoma, neuroblastoma, malignant peripheral nerve sheath tumor, Ewing's sarcoma, epithelioid sarcoma, clear cell sarcoma, synovial sarcoma, and osteosarcoma.
10. The method according to claim 6, wherein the cancer is carcinoma.
11. The method according to claim 6, wherein the cancer is selected from the group consisting of breast cancer, pancreatic cancer, lung cancer, colorectal cancer, stomach cancer, bile duct cancer, ovary cancer, bladder cancer, and esophageal cancer.
12. The method according to claim 6, wherein the cancer is MEFLIN-negative, and a stroma surrounding the cancer contains MEFLIN-positive cells.
13. The method according to claim 10, wherein the antibody has no internalization activity.
14. The method according to claim 7, wherein the antibody has internalization activity.
15. The method according to claim 13, wherein the antibody and the cytotoxic agent of the ADC are connected to each other via a linker, and wherein the linker is a cleavable linker.
16. The method according to claim 15, wherein the linker is cleaved by cathepsin K.
17. The method according to claim 16, wherein the linker comprises a valine-citrulline dipeptide and is cleaved in the presence of cathepsin K.
18. The pharmaceutical composition according to claim 1, wherein the linker is a non-cleavable linker.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
DESCRIPTION OF EMBODIMENT
[0163] As used herein, the term “subject” means a mammal and can be, particularly, a human.
[0164] The term “treatment” is used herein in the meaning including therapy (therapeutic treatment) and prevention (prophylactic treatment). As used herein, the term “therapy” means the therapy, cure, prevention, or improved remission of a disease or a disorder, or reduction in the rate of progression of a disease or a disorder. As used herein, the term “prevention” means decrease in the possibility of onset of a disease or a pathological condition, or delay of the onset of a disease or a pathological condition.
[0165] As used herein, the term “disease” means a symptom which would benefit from the therapy. As used herein, the “cancer” means malignant tumor.
[0166] As used herein, the term “antibody” means an immunoglobulin and includes a polyclonal antibody and a monoclonal antibody. The antibody is preferably a monoclonal antibody. The origin of the antibody is not particularly limited, but examples thereof include non-human animal antibodies, non-human mammalian antibodies, and human antibodies. The antibody may be a chimeric antibody, a humanized antibody, or a human antibody. The antibody may be a bispecific antibody. For use as a medicament, the antibody can be preferably a chimeric antibody, more preferably a humanized antibody, and further preferably a human antibody. The bispecific antibody can be a monoclonal antibody, preferably a chimeric antibody, more preferably a humanized antibody, and further preferably a human antibody.
[0167] As used herein, the term “therapeutically effective amount” means an amount of an agent effective for the treatment (prevention or therapy) of a disease or a state. The therapeutically effective amount of an agent is capable of decreasing the rate of aggravation of a symptom of a disease or a state, stopping the aggravation of the symptom, ameliorating the symptom, curing the symptom, or suppressing the onset or advancement of the symptom.
[0168] As used herein, the term “competing” means striving for binding to an antigen against another binding antibody. The competition can occur when the binding sites of two antibodies share a certain antigen. Such antibodies can be obtained by immunization using an epitope as described above, and/or can be obtained by confirming whether or not one antibody decreases the binding of the other antibody to the antigen by competitive assay.
[0169] As used herein, the term “antibody-drug conjugate” (hereinafter, also referred to as “ADC”) means a substance in which an antibody and a cytotoxic agent are connected. In the ADC, the antibody and the cytotoxic agent can be connected via a suitable linker. A chemotherapeutic agent, a radioisotope, and a toxin can be used as the cytotoxic agent. The ADC also includes a conjugate of an antigen binding fragment of the antibody and a drug.
[0170] As used herein, the term “antigen binding fragment” means a portion of an antibody that maintains binding activity against the antigen. The antigen binding fragment can comprise a heavy chain variable region or a light chain variable region, or both, of the antibody of the present invention. The antigen binding fragment may be chimerized or humanized. Examples of the antigen binding fragment include Fab, Fab′, F(ab′).sub.2, Fv, scFv (single-chain Fv), diabody, and sc(Fv).sub.2 (single-chain (Fv).sub.2). Such a fragment of the antibody can be obtained, for example, by treating the antibody with an enzyme, without particular limitations. For example, Fab can be obtained by digesting the antibody with papain. Alternatively, F(ab′).sub.2 can be obtained by digesting the antibody with pepsin, and Fab′ can be obtained by further reducing this fragment. In the present invention, such an antigen binding fragment of the antibody can be used.
[0171] As used herein, the term “MEFLIN” or “Meflin” is a protein also called immunoglobulin superfamily containing leucine-rich repeat (ISLR). Human MEFLIN can have an amino acid sequence registered under GenBank accession No. BAA85970.1. MEFLIN can be MEFLIN (e.g., human MEFLIN) having an amino acid sequence corresponding to the amino acid sequence registered under GenBank accession No. BAA85970.1. If it is desired to identify the animal species of the origin, MEFLIN is described as human MEFLIN (or hMEFLIN) and mouse MEFLIN (mMEFLIN), etc.
[0172] In the present invention, the antibody and the cytotoxic agent in the antibody-drug conjugate (ADC) are connected via a linker. Examples of the cytotoxic agent include chemotherapeutic agents (e.g., anticancer agents such as commercially available anticancer agents, for example, auristatin (auristatin E, auristatin F phenylenediamine (AFP), monomethyl auristatin E, and monomethyl auristatin F, and their derivatives), maytansinoids DM1 and DM4, and their derivatives), camptothecin (SN-38, irinotecan, lurtotecan, DB67, BMP1350, ST1481, CKD602, topotecan and exatecan, and their derivatives), DNA minor groove binding agents (enediyne, lexitropsin, and duocarmycin, and their derivatives), taxane (paclitaxel and docetaxel, and their derivatives), polyketide (discodermolide and its derivatives), anthraquinones (mitoxantrone and its derivatives), benzodiazepine (pyrrolobenzodiazepine, indolinobenzodiazepine, and oxazolidinobenzodiazepine, and their derivatives), vinca alkaloid (vincristine, vinblastine, vindesine, and vinorelbine, and their derivatives), doxorubicin (doxorubicin, morpholino-doxorubicin, and cyanomorpholino-doxorubicin, and their derivatives), cardiac glycoside (digitoxin and its derivatives), calicheamicin, epothilone, cryptophycin, cemadotin, cemadotin, rhizoxin, netropsin, combretastatin, eleutherobin, etoposide, T67 (Tularik Inc.), and nocodazole), radioisotopes (e.g., .sup.32P, .sup.60C, .sup.90Y, .sup.111In, .sup.131I, .sup.125I, .sup.153Sm, .sup.186Re, .sup.188Re, and .sup.212Bi), and toxins (e.g., diphtheria toxin A, Pseudomonas endotoxin, ricin, and saporin etc.), which can be used as the cytotoxic agent in the ADC of the present invention. Preferably, for example, camptothecin, particularly, SN-38, or exatecan can be used as the cytotoxic agent in the ADC of the present invention. Any of cytotoxic agents for use in therapy of a cancer can be used. Pharmaceutically acceptable salts, solvates (e.g., hydrates), esters, or prodrugs of these cytotoxic agents may be used as the cytotoxic agent.
[0173] In the present invention, the linker of the ADC may be a non-cleavable linker or a cleavable linker. Such a linker can be appropriately selected and synthesized by those skilled in the art in the preparation of the ADC. Examples of the cleavable linker include linkers having a degradable bond such as an ester bond. Examples of the cleavable linker include linkers having a protease cleavage site such as a cleavable moiety of a peptide consisting of valine-citrulline or valine-alanine. The peptide region consisting of valine-citrulline can be cleaved by protease such as cathepsin B. In a certain aspect, in the linker, for example, a first spacer may be introduced between the antibody and the cleavable moiety. For example, polyethylene glycol (PEG), for example, PEG having approximately 5 to 40 repeat units per molecule, can be used as the first spacer. A second spacer may be introduced between the cleavable moiety and the cytotoxic agent. For example, p-aminobenzyloxycarbonyl (PABC) can be used as the second spacer. The cleavable linker is physiologically stable at sites other than the site that is cleaved in cancer tissues (particularly, physiologically stable until reaching cancer tissues).
[0174] In a certain aspect, the linker comprises the first spacer and the cleavable moiety. In a certain aspect, the linker comprises the first spacer, the cleavable moiety, and the second spacer. For a certain subject, the linker comprises PEG, the cleavable moiety, and PABC.
[0175] For the attachment between the antibody and the linker, for example, a sulfhydryl group of the antibody can be connected via a maleimido group.
[0176] In a certain aspect, the antibody is connected via its sulfhydryl group to an anticancer agent through a linker having a maleimide-PEG-cleavable moiety. In a certain aspect, the antibody is connected via its sulfhydryl group to an anticancer agent through a linker having a maleimide-PEG-cleavable moiety-PABC.
[0177] In a certain aspect, the ADC can have a structure represented by the formula (II) given below.
[0178] The ADC of the present invention is considered to be useful as a therapeutic drug for a cancer.
[0179] The present invention provides an antibody having the amino acid sequences of heavy chain CDR1 to CDR3 and light chain CDR1 to CDR3 of an antibody produced from a clone selected from clones given below. The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody. In this aspect, the present invention can provide an antibody having the amino acid sequences of a heavy chain variable region and a light chain variable region of an antibody produced from a clone selected from clones given below. The antibody can be preferably a human chimeric antibody.
TABLE-US-00001 TABLE 1 Amino acid sequences of CDR1 to CDR3 of heavy chain variable reqion (VH) of antibody produced by rat hybridoma clone VH Clone name CDR1 CDR2 CDR3 27-7 KYWMD EINTDGSKTNYA WEDY (SEQ ID NO: 1) PSIKD (SEQ ID NO: 3) (SEQ ID NO: 2) 34-4 GFSLTSYD IWGNGNT TGGYPY (SEQ ID NO: 9) (SEQ ID NO: 10) (SEQ ID NO: 11) 27-8 GYTITSGY ITYSGST SRDIAAIS (SEQ ID NO: 17) (SEQ ID NO: 18) FAY (SEQ ID NO: 19) 46-3 GYTITSGY ITYSGST ARDFSGIS (SEQ ID NO: 25) (SEQ ID NO: 26) FAY (SEQ ID NO: 27) 21-3 GFTFSNYG INYDGSST ARVEYRFS (SEQ ID NO: 33) (SEQ ID NO: 34) PFDY (SEQ ID NO: 35) 25-1 GFDFKTYA ISIKTQNYPT TVGARY (SEQ ID NO: 41) (SEQ ID NO: 42) (SEQ ID NO: 43) 41-10 GFSLTSYD IWGNGNT TRSLGVG (SEQ ID NO: 49) (SEQ ID NO: 50) (SEQ ID NO: 51) 35-9 GFSLSSYG IWGNGNT ARWESGDY (SEQ ID NO: 57) (SEQ ID NO: 58) (SEQ ID NO: 59)
TABLE-US-00002 TABLE 2 Amino acid sequences of CDR1 to CDR3 of liqht chain variable reqion (VL) of antibody produced by rat hybridoma clone VL Clone name CDR1 CDR2 CDR3 27-7 KSSQSLVYSDG QVSNLDS AQTTHFPYT KTYLH (SEQ ID NO: 5) (SEQ ID NO: 6) (SEQ ID NO: 4) 34-4 QSLVGTGGKTY LVS LQGTHFPFT (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 14) 27-8 QSLVHSNGNTY KVS FQATHVPLT (SEQ ID NO: 20) (SEQ ID NO: 21) (SEQ ID NO: 22) 46-3 QSLVHSNGNTY KVS FQATHDPLT (SEQ ID NO: 28) (SEQ ID NO: 29) (SEQ ID NO: 30) 21-3 QNINKY NTN LQRNSWLT (SEQ ID NO: 36) (SEQ ID NO: 37) (SEQ ID NO: 38) 25-1 QSLLHSNGNTY LVS VQSTHAPLT (SEQ ID NO: 44) (SEQ ID NO: 45) (SEQ ID NO: 46) 41-10 QDIGDY GAT LQSKESPCSR (SEQ ID NO: 52) (SEQ ID NO: 53) (SEQ ID NO: 54) 35-9 QSLVGSGGKTY LVS LQGTHF PWT (SEQ ID NO: 60) (SEQ ID NO: 61) (SEQ ID NO: 62)
TABLE-US-00003 TABLE 3 Amino acid sequence of heavy chain variable region (VH) of antibody produced by rat hybridoma clone Clone name VH 27-7 EVQLVESGGSLVQPGGSLKLSCVASGYTPSKYWMDWV RQTPGKSLEWIGEINTDGSKTNYAPSIKDRFTISRDN AKSTLYLQMSNVKSDDTAIYYCTNWEDYWGQGVMVTV SS (SEQ ID NO: 7) 34-4 QVQLMESGPGLVQPSQTLSLTCTVSGFSLTSYDMHWV RQPPGKGLEWMGVIWGNGNTHYNSALKSRLSISRDTS KSQVFLKMNSLQTENTAIYFCTGGYFYWGQGVTVTVS S (SEQ ID NO: 15) 27-8 VQLTESGPGLVKPSQSLSLTCSVTGYTITSGYDWSWI RKFPGNKMEWMGYITYSGSTNYNPSLKSRISITRDTS KNQFFLQLNSVTTEDTATYYCSRDIAAISFAYWGQGT LVTVSS (SEQ ID NO: 23) 46-3 VQLKESGPGLVKPSQSLSLTCSVTGYTITSGYDWSWI RKFPGNKMEWMGFITYSGSTHHNPSLKSRISITRDTS RNQFFLQLNSVTTEDSATYYCARDPSGISPAYWGQGT LVSVSS (SEQ ID NO: 31) 21-3 VQLMESGGGLVQPGRSLKLSCAASGPTPSNYGMAWVR QAPTKGLEWVATINYDGSSTYYRDSVKGRFTISRDNA KSTLYLQMDSLRSEDTATYYCARVEYRFSPFDYWGQG VTATVSS (SEQ ID NO: 39) 25-1 EVQLVESGGGLVQPKGSLKLSCAASGFDFKTYAMSWV RQAPGKGLDWVASISIKTQNYPTLYADSVKERPTISR DDSQSMVYLHMNN1KTEDTALYYCTVGARYWGQGVMT TVSS (SEQ ID NO: 47) 41-10 QVQLTESGPGLVQPSQTLSLTCTVSGFSLTSYDMHWV RQPPGKGLEWMGVIWGNGNTHYNSALKSRLSISRDTS KRQVFLKMNSLQTEDTAIYFCTRSLGVGWGQGVMIIV SS (SEQ ID NO: 55) 35-9 QVQLTESGPGLVQPSQTLSLTCTVSGFSLSSYGVIWV RQPPGKGLEWMGVIWGNGNTNYNSTLKSRLSISRDTS KSQVPLKMNILQTEDTAMYFCARWESGDYWGQGVTVT VSS (SEQ ID NO: 63)
TABLE-US-00004 TABLE 4 Amino acid sequence of liqht chain variable region (VL) of antibody produced by rat hybridoma clone Clone name VL 27-7 DVVMTQTPPSLSVAIGQSVSISCKSSQSLVYSDGKTY LHWLLQSSGRSPKRLIYQVSNLDSGVPDRFSGTGSQK DFTLKISRVEAKDLGVYYCAQTTHFPYTFGAGTKLEL K (SEQ ID NO: 8) 34-4 DVVMTQTPVSLSVAIGHPASISCKSSQSLVGTGGKTY LSWLLQRPGQSPKRLIYLVSKLDSGIPDRFSGSGSET DFTLKISRVEADDLGVYYCLQGTHFPFTPGSGTQLEM K (SEQ ID NO: 16) 27-8 DVVMTQTPVAQPVTLGDQASISCRSSQSLVHSNGNTY LEWYLQKPGQSPQLLIYKVSNRFSGVPDRFIGSGSGS DFTLKISRVEPEDLGVYYCFQATHVPLTFGSGTKLEI K (SEQ ID NO: 24) 46-3 DVVLTQTPVAQPVTLGDQVSISCRSSQSLVHSNGNTY LEWYLQKPGQSPQLLIYKVSNRFSGVPDRFIGSGSGS DPTLKISRVEPEDLGIYYCFQATHDPLTFGSGTKLEI K (SEQ ID NO: 32) 21-3 DVQLTQSPSFLSASVGERVTLSCKASQNINKYLDWYQ QKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTLT ISSLQPEDVATYFCLQRNSWLTFGSGTKLEIK (SEQ ID NO: 40) 25-1 DVVMTQTPPTLSATIGQSVSISCRSSQSLLHSNGNTY LNWLLQRPGQPPQVLIYLVSRLESGVPNRFSGSGSGT DFTLKISGVEAEDLGVYYCVQSTHAPLTPGSGTKLEI K (SEQ ID NO: 48) 41-10 VQMTQAPSSLPASLGDRVTITCRASQDIGDYLRWRQQ KPGKSPRLMIYGATNLAAGVPSRFSGSRSGSDYSLTI SSLESEDMADYYCLQSKESPCSRSVLGPNWRSN (SEQ ID NO: 56) 35-9 DVVMTQTPVSLSVAVGQPASISCTSSQSLVGSGGKTY LNWFLQRPGQSPKRLISLVSKLDSGIPDRFSGSGSET DFTLKISRVEADDLGVYYCLQGTHFPWTFGGGTKQEL K (SEQ ID NO: 64)
TABLE-US-00005 TABLE 5 Amino acid sequences of CDR1 to CDR3 of heavy chain variable region (VH) of antibody produced by mouse hybridoma clone VH Clone name CDR1 CDR2 CDR3 3-2 GFTFSDYG ISSLAYTV ARFPVEAMDY (SEQ ID NO: 65) (SEQ ID NO: 66) (SEQ ID NO: 67) 11-8 GYSFTDYI INPYSGNT ARDGDDYAMDY (SEQ ID NO: 73) (SEQ ID NO: 74) (SEQ ID NO: 75) 16-5 GFTFSDYG ISSLAYTV ARFPVEAMDY (SEQ ID NO: 81) (SEQ ID NO: 82) (SEQ ID NO: 83) 19-7 GYTFTSYW IYPCNGRT ARWDWVFDY (SEQ ID NO: 89) (SEQ ID NO: 90) (SEQ ID NO: 91) 22-3 GFTFSDYG 1SSLAYTV ARFPVEAMDY (SEQ ID NO: 97) (SEQ ID NO: 98) (SEQ ID NO: 99) 23-1 GYSFTDY1 INPYYGST ARDGTDYAMDY (SEQ ID NO: 105) (SEQ ID NO: 106) (SEQ ID NO: 107) 8-2 GYTITDYY INPYNGGT ARSRTGGNGMDY (SEQ ID NO: 113) (SEQ ID NO: 114) (SEQ ID NO: 115) 13-1 GYSFTGYF INPYNGDT AKWDLYDGYFRDY (SEQ ID NO: 121) (SEQ ID NO: 122) (SEQ ID NO: 123) 32-1 GFTFSSYG ISGGSYT VIDYDVMDY (SEQ ID NO: 129) (SEQ ID NO: 130) (SEQ ID NO: 131)
TABLE-US-00006 TABLE 6 Amino acid sequences of CDR1 to CDR3 of liqht chain variable region (VL) of antibody produced by mouse hybridoma clone Clone VL name CDR1 CDR2 CDR3 3-2 ESVDNYGISF AAS QQSKEVPPT (SEQ ID NO: 68) SEQ ID NO: 69) (SEQ ID NO: 70) 11-8 QSIVHSNGNTY KVS FQGSHVPWT (SEQ ID NO: 76) (SEQ ID NO: 77) (SEQ ID NO: 78) 16-5 QSLVHSNGNTY KVS SQSTHFLT (SEQ ID NO: 84) (SEQ ID NO: 85) (SEQ ID NO: 86) 19-7 KSVSTSGYSY LVS QHIRELTR (SEQ ID NO: 92) (SEQ ID NO: 93) (SEQ ID NO: 94) 22-3 KSVSTSGYSY LVS QHIRELTR (SEQ ID NO: 100) (SEQ ID NO: 101) (SEQ ID NO: 102) 23-1 KSVSTSGYSY LVS QHIRELTR (SEQ ID NO: 108) (SEQ ID NO: 109) (SEQ ID NO: 110) 8-2 KSVSTSGYSY LVS QHIRELTR (SEQ ID NO: 116) (SEQ ID NO: 117) (SEQ ID NO: 118) 13-1 KSVSTSGYSY LVS QHIRELTR (SEQ ID NO: 124) (SEQ ID NO: 125) (SEQ ID NO: 126) 32-1 QSLLNSRTRKNY WAS KQSYNLRT (SEQ ID NO: 132) (SEQ ID NO: 133) (SEQ ID NO: 134)
TABLE-US-00007 TABLE 7 Amino acid sequence of heavy chain variable region (VH) of antibody produced by mouse hybridoma clone Clone name VH 3-2 VQLQESGGGLVQPGGSRKLSCAASGFTFSDYGMA WVRQAPGKGPEWVAFISSLAYTVYYADTVTGRFT ISRENAKNTLFLEMSSLRSEDTAMYYCARFPVEA MDYWGQGTSVTVSS (SEQ ID NO: 71) 11-8 VQLQESGPELVKPGASVKISCKASGYSFTDYIIL WVKQSHGKSLEWIGNINPYSGNTRYNLKFKGKAT LTVDKSSSTAYMQLNSLTSEDSAVYYCARDGDDY AMDYWGQGTSVTVSS (SEQ ID NO: 79) 16-5 VKLQQSGGGLVQPGGSRKLSCAASGFTPSDYGMA WVRQAPGKGPEWVAFISSLAYTVYYADTVTGRFT ISRENAKNTLFLEMSSLRSEDTAMYYCARFPVEA MDYWGQGTSVTVSS (SEQ ID NO: 87) 19-7 QVKLQESGAELVKPGASVKLSCKASGYTFTSYWM HWVKQRPGQGLDWIGEIYPCNGRTNYNEKPKSKA TLTVDKSSSTAYMQLSSLTSEDSAVYYCARWDWV FDYWGQGTTLTVSS (SEQ ID NO: 95) 22-3 VKLQESGGGLVQPGGSRKLSCAASGFTFSDYGMA WVRQAPGKGPEWVAFISSLAYTVYYADTVTGRFT ISRENAKNTLFLEMSSLRSEDTAMYYCARFPVEA MDYWGQGTSVTVSS (SEQ ID NO: 103) 23-1 VQLQESGPELVKPGASVKISCKASGYSFTDYIML WLKQSHGKSLEWIGNINPYYGSTRYNLKFKGKAT LTVDKSSSTAYMQLNSLTSEDSAVYYCARDGTDY AMDYWGQGTSVTVSS (SEQ ID NO: 111) 8-2 VQLQESGPVLVKPGASVKMSCKASGYTITDYYMN WVKQSHGKSLEWIGVINPYNGGTSYNQKFKGKAT LTVDKSSSTAYMELNSLTSEDSAVYYCARSRTGG NGMDYWGQGTSVTVSS (SEQ ID NO: 119) 13-1 VKLQESGPELVKPGASVKISCKASGYSFTGYFMN WVMQSHGKSLEWIGRINPYNGDTFYNQKFKGKAT LTVDKSSSTAHMELRSLASEDSAVYYCAKWDLYD GYFRDYWGQGTTLTVSS (SEQ ID NO: 127) 32-1 VQLQQSGGDLVKPGGSLKLSCAASGFTFSSYGMS WVRQTPDKRLEWVATISSGGSYTYYPDSVKGRFT ISRDNAKNTLYLQMSSLKSEDTAMYYCVIDYDVM DYWGQGTSVTVSS (SEQ ID NO: 135)
TABLE-US-00008 TABLE 8 Amino acid sequence of liqht chain variable region (VL) of antibody produced by mouse hybridoma clone Clone name VL 3-2 IGQRATISCRASESVDNYGISFMNWFQQKPGQP PKLLIYAASNQGSGVPARFSGSGSGTDFSLNIH PMEEDDTAMYFCQQSKEVPPTFGGGTKLEIK (SEQ ID NO: 72) 11-8 DIVITQTPLSLPVSLGDQASISCRSSQSIVHSN GNTYLEWYLQKPGQSPRLLIYKVSNRFSGVPDR FSGSGSGTDFTLKISRVETEDLGVYYCFQGSHV PWTFGGGTKLEIK (SEQ ID NO: 80) 16-5 DIVMTQTPLSLPVSLGDQASISCRSSQSLVHSN GNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDR FSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHF LTFGSGTKLEIK (SEQ ID NO: 88) 19-7 RASKSVSTSGYSYMHWNQQKPGQPPRLLIYLVS NPESGVPARFSGSGSGTDFTLNIHPVEEEDAAT YYCQHIRELTRSEGGPSWK (SEQ ID NO: 96) 22-3 RASKSVSTSGYSYMHWNQQKPGQPPRLLIYLVS NLESGVPARFSGSGSGTDFTLNIHPVEEEDAAT YYCQHIRELTRSEGGPSWK (SEQ ID NO: 104) 23-1 RASKSVSTSGYSYMHWNQQKPGQPPRLLIYLVS NLESGVPARFSGSGSGTDFTLNIHPVEEEDAAT YYCQHIRELTRSEGGPSWK (SEQ ID NO: 112) 8-2 DIVLTQSPASLAVSLGQRATISYRASKSVSTSG YSYMHWNQQKPGQPPRLLIYLVSNLESGVPARF SGSGSGTDFTLNIHPVEEEDAATYYCQHIRELT RSEGGPSWK (SEQ ID NO: 120) 13-1 DIVMTQSPASLAVSLGQRATISYRASKSVSTSG YSYMHWNQQKPGQPPRLLIYLVSNLESGVPARF SGSGSGTDFTLNIHPVEEEDAATYYCQHIRELT RSEGGPSWK (SEQ ID NO: 128) 32-1 DIVMTQTPSSLAVSAGEKVTMSCKSSQSLLNSR TRKNYLAWYQQKPGQSPKLLIYWASTRESGVPD RFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYN LRTFGGGTKLEIK (SEQ ID NO: 136)
[0180] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0181] (1A) an antibody having [0182] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 1, the heavy chain CDR2 set forth in SEQ ID NO: 2, and the heavy chain CDR3 set forth in SEQ ID NO: 3, and [0183] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 4, the light chain CDR2 set forth in SEQ ID NO: 5, and the light chain CDR3 set forth in SEQ ID NO: 4; [0184] (1B) an antibody having a heavy chain variable region set forth in SEQ ID NO: 7 and a light chain variable region set forth in SEQ ID NO: 8; [0185] (1C) an antibody that competes with the above-mentioned antibody (1B) for binding to the MEFLIN protein; and [0186] (1D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (1B). [0187] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0188] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0189] (2A) an antibody having [0190] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 9, the heavy chain CDR2 set forth in SEQ ID NO: 10, and the heavy chain CDR3 set forth in SEQ ID NO: 11, and [0191] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 12, the light chain CDR2 set forth in SEQ ID NO: 13, and the light chain CDR3 set forth in SEQ ID NO: 14; [0192] (2B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 15 and the light chain variable region set forth in SEQ ID NO: 16; [0193] (2C) an antibody that competes with the above-mentioned antibody (2B) for binding to the MEFLIN protein; and [0194] (2D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (2B).
[0195] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0196] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0197] (3A) an antibody having [0198] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 17, the heavy chain CDR2 set forth in SEQ ID NO: 18, and the heavy chain CDR3 set forth in SEQ ID NO: 19, and [0199] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 20, the light chain CDR2 set forth in SEQ ID NO: 21, and the light chain CDR3 set forth in SEQ ID NO: 22; [0200] (3B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 23 and the light chain variable region set forth in SEQ ID NO: 24; [0201] (3C) an antibody that competes with the above-mentioned antibody (3B) for binding to the MEFLIN protein; and [0202] (3D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (3B).
[0203] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0204] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0205] (4A) an antibody having [0206] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 25, the heavy chain CDR2 set forth in SEQ ID NO: 26, and the heavy chain CDR3 set forth in SEQ ID NO: 27, and [0207] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 28, the light chain CDR2 set forth in SEQ ID NO: 29, and the light chain CDR3 set forth in SEQ ID NO: 30; [0208] (4B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 31 and the light chain variable region set forth in SEQ ID NO: 32; [0209] (4C) an antibody that competes with the above-mentioned antibody (4B) for binding to the MEFLIN protein; and [0210] (4D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (4B).
[0211] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0212] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0213] (5A) an antibody having [0214] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 33, the heavy chain CDR2 set forth in SEQ ID NO: 34, and the heavy chain CDR3 set forth in SEQ ID NO: 35, and [0215] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 36, the light chain CDR2 set forth in SEQ ID NO: 37, and the light chain CDR3 set forth in SEQ ID NO: 38; [0216] (5B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 39 and the light chain variable region set forth in SEQ ID NO: 40; [0217] (5C) an antibody that competes with the above-mentioned antibody (5B) for binding to the MEFLIN protein; and [0218] (5D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (5B).
[0219] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0220] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0221] (6A) an antibody having [0222] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 41, the heavy chain CDR2 set forth in SEQ ID NO: 42, and the heavy chain CDR3 set forth in SEQ ID NO: 43, and [0223] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 44, the light chain CDR2 set forth in SEQ ID NO: 45, and the light chain CDR3 set forth in SEQ ID NO: 46; [0224] (6B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 47 and the light chain variable region set forth in SEQ ID NO: 48; [0225] (6C) an antibody that competes with the above-mentioned antibody (6B) for binding to the MEFLIN protein; and [0226] (6D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (6B).
[0227] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0228] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0229] (7A) an antibody having [0230] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 49, the heavy chain CDR2 set forth in SEQ ID NO: 50, and the heavy chain CDR3 set forth in SEQ ID NO: 51, and [0231] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 52, the light chain CDR2 set forth in SEQ ID NO: 53, and the light chain CDR3 set forth in SEQ ID NO: 54; [0232] (7B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 55 and the light chain variable region set forth in SEQ ID NO: 56; [0233] (7C) an antibody that competes with the above-mentioned antibody (7B) for binding to the MEFLIN protein; and [0234] (7D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (7B).
[0235] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0236] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0237] (8A) an antibody having [0238] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 57, the heavy chain CDR2 set forth in SEQ ID NO: 58, and the heavy chain CDR3 set forth in SEQ ID NO: 59, and [0239] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 60, the light chain CDR2 set forth in SEQ ID NO: 61, and the light chain CDR3 set forth in SEQ ID NO: 62; [0240] (8B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 63 and the light chain variable region set forth in SEQ ID NO: 64; [0241] (8C) an antibody that competes with the above-mentioned antibody (8B) for binding to the MEFLIN protein; and [0242] (8D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (8B).
[0243] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0244] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0245] (9A) an antibody having [0246] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 65, the heavy chain CDR2 set forth in SEQ ID NO: 66, and the heavy chain CDR3 set forth in SEQ ID NO: 67, and [0247] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 68, the light chain CDR2 set forth in SEQ ID NO: 69, and the light chain CDR3 set forth in SEQ ID NO: 70; [0248] (9B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 71 and the light chain variable region set forth in SEQ ID NO: 72; [0249] (9C) an antibody that competes with the above-mentioned antibody (9B) for binding to the MEFLIN protein; and [0250] (9D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (9B).
[0251] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0252] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0253] (10A) an antibody having [0254] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 73, the heavy chain CDR2 set forth in SEQ ID NO: 74, and the heavy chain CDR3 set forth in SEQ ID NO: 75, and [0255] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 76, the light chain CDR2 set forth in SEQ ID NO: 77, and the light chain CDR3 set forth in SEQ ID NO: 78; [0256] (10B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 79 and the light chain variable region set forth in SEQ ID NO: 80; [0257] (10C) an antibody that competes with the above-mentioned antibody (10B) for binding to the MEFLIN protein; and [0258] (10D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (10B).
[0259] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0260] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0261] (11A) an antibody having [0262] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 81, the heavy chain CDR2 set forth in SEQ ID NO: 82, and the heavy chain CDR3 set forth in SEQ ID NO: 83, and [0263] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 84, the light chain CDR2 set forth in SEQ ID NO: 85, and the light chain CDR3 set forth in SEQ ID NO: 86; [0264] (11B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 87 and the light chain variable region set forth in SEQ ID NO: 88; [0265] (11C) an antibody that competes with the above-mentioned antibody (11B) for binding to the MEFLIN protein; and [0266] (11D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (11B).
[0267] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0268] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0269] (12A) an antibody having [0270] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 89, the heavy chain CDR2 set forth in SEQ ID NO: 90, and the heavy chain CDR3 set forth in SEQ ID NO: 91, and [0271] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 92, the light chain CDR2 set forth in SEQ ID NO: 93, and the light chain CDR3 set forth in SEQ ID NO: 94; [0272] (12B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 95 and the light chain variable region set forth in SEQ ID NO: 96; [0273] (12C) an antibody that competes with the above-mentioned antibody (12B) for binding to the MEFLIN protein; and [0274] (12D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (12B).
[0275] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0276] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0277] (13A) an antibody having [0278] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 97, the heavy chain CDR2 set forth in SEQ ID NO: 98, and the heavy chain CDR3 set forth in SEQ ID NO: 99, and [0279] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 100, the light chain CDR2 set forth in SEQ ID NO: 101, and the light chain CDR3 set forth in SEQ ID NO: 102; [0280] (13B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 103 and the light chain variable region set forth in SEQ ID NO: 104; [0281] (13C) an antibody that competes with the above-mentioned antibody (13B) for binding to the MEFLIN protein; and [0282] (13D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (13B).
[0283] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0284] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0285] (14A) an antibody having [0286] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 105, the heavy chain CDR2 set forth in SEQ ID NO: 106, and the heavy chain CDR3 set forth in SEQ ID NO: 107, and [0287] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 108, the light chain CDR2 set forth in SEQ ID NO: 109, and the light chain CDR3 set forth in SEQ ID NO: 110; [0288] (14B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 111 and the light chain variable region set forth in SEQ ID NO: 112; [0289] (14C) an antibody that competes with the above-mentioned antibody (14B) for binding to the MEFLIN protein; and [0290] (14D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (14B).
[0291] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0292] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0293] (15A) an antibody having [0294] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 113, the heavy chain CDR2 set forth in SEQ ID NO: 114, and the heavy chain CDR3 set forth in SEQ ID NO: 115, and [0295] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 116, the light chain CDR2 set forth in SEQ ID NO: 117, and the light chain CDR3 set forth in SEQ ID NO: 118; [0296] (15B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 119 and the light chain variable region set forth in SEQ ID NO: 120; [0297] (15C) an antibody that competes with the above-mentioned antibody (15B) for binding to the MEFLIN protein; and [0298] (15D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (15B).
[0299] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0300] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0301] (16A) an antibody having [0302] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 121, the heavy chain CDR2 set forth in SEQ ID NO: 122, and the heavy chain CDR3 set forth in SEQ ID NO: 123, and [0303] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 124, the light chain CDR2 set forth in SEQ ID NO: 125, and the light chain CDR3 set forth in SEQ ID NO: 126; [0304] (16B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 127 and the light chain variable region set forth in SEQ ID NO: 128; [0305] (16C) an antibody that competes with the above-mentioned antibody (16B) for binding to the MEFLIN protein; and [0306] (16D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (16B).
[0307] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0308] The present invention provides an antibody that binds to the MEFLIN protein, the antibody being any of: [0309] (17A) an antibody having [0310] a heavy chain variable region comprising the heavy chain CDR1 set forth in SEQ ID NO: 129, the heavy chain CDR2 set forth in SEQ ID NO: 130, and the heavy chain CDR3 set forth in SEQ ID NO: 131, and [0311] a light chain variable region comprising the light chain CDR1 set forth in SEQ ID NO: 132, the light chain CDR2 set forth in SEQ ID NO: 133, and the light chain CDR3 set forth in SEQ ID NO: 134; [0312] (17B) an antibody having the heavy chain variable region set forth in SEQ ID NO: 135 and the light chain variable region set forth in SEQ ID NO: 136; [0313] (17C) an antibody that competes with the above-mentioned antibody (17B) for binding to the MEFLIN protein; and [0314] (17D) an antibody that binds to an epitope overlapping on the MEFLIN protein with that for the above-mentioned antibody (17B).
[0315] The antibody is preferably a human chimeric antibody and can be preferably a humanized antibody.
[0316] In a certain aspect of the present invention, the antibody that binds to the MEFLIN protein binds to human MEFLIN protein. In a certain aspect of the present invention, the antibody that binds to the MEFLIN protein specifically binds to human MEFLIN protein. The term “specifically bind” means binding to the MEFLIN protein with stronger affinity than to at least another protein. The term “specifically bind” includes binding to the human MEFLIN protein with stronger affinity than to mouse MEFLIN protein.
[0317] Whether or not antibodies compete with each other can be confirmed by in-vitro competitive assay. In the competitive assay, the antibodies can be regarded as antibodies competing with each other for binding to the same antigen when the binding of the desired antibody can be blocked by, for example, at least 20%, preferably at least 20 to 50%, more preferably at least 50%. The competitive antibody can be confirmed by cross-blocking assay, preferably competitive ELISA assay. In the cross-blocking assay, for example, a microtiter plate is coated with the antigen, and a candidate competitive antibody is added thereto. The plate is incubated to form the binding between the antigen and the candidate antibody. Then, the desired antibody is labeled and then added to wells, and the plate is incubated and washed. The amount of the desired antibody bound can be quantified to determine the presence or absence of the competition between the antibodies. In the presence of competition, the amount of the label remaining in the wells should be decreased.
[0318] Whether or not antibodies bind to overlapping epitopes on the binding partner protein can be confirmed depending on whether or not their interaction faces overlap with each other. For example, hydrogen/deuterium exchange mass spectrometry (HDX-MS) is known as a method for determining epitopes. In the HDX-MS, the exchange of hydrogen of an amide proton of a protein complex for deuterium can be detected in the presence of deuterated water. In the presence of deuterated water, the amide proton on the interaction face of the protein complex is difficult to exchange for deuterium (or the rate of exchange is slow), while the amide proton of a region exposed to the surface is easily exchanged for deuterium (or the rate of exchange is fast). Thus, through the use of this phenomenon, a region found to have decrease in the rate of exchange of hydrogen for deuterium can be considered as a region bound to an antibody. The interaction face (epitope region) on the binding partner can thereby be determined for the antibody. The respective epitope regions for two antibodies can be determined by the method for determining whether or not the epitope regions overlap with each other. The exchange of hydrogen for deuterium can be detected by those skilled in the art using mass spectrometry.
[0319] In a certain aspect of the present invention, the antibody that binds to the MEFLIN protein is an antibody having internalization activity into cells. In a certain aspect of the present invention, the antibody that binds to the MEFLIN protein is an antibody having no internalization activity into cells. In a certain aspect of the present invention, cancer cells are MEFLIN protein-positive, and the antibody that binds to the MEFLIN protein is an antibody having internalization activity into cells. In a certain aspect of the present invention, cancer cells are MEFLIN protein-positive, and the antibody that binds to the MEFLIN protein is an antibody having no internalization activity into cells. In a certain aspect of the present invention, stromal cells of a cancer are MEFLIN protein-positive, and the antibody that binds to the MEFLIN protein is an antibody having internalization activity into cells. In a certain aspect of the present invention, stromal cells of a cancer are MEFLIN protein-positive, and the antibody that binds to the MEFLIN protein is an antibody having no internalization activity into cells. In these aspects, the ADC may have a cleavable linker. In these aspects, the ADC may have a non-cleavable linker. In the case of preparing a prodrug such that the payload of the ADC exerts cytotoxicity only after linker cleavage, the linker is preferably a cleavable linker. In a certain aspect, the ADC of the present invention has internalization activity and has a cleavable linker that is intracellularly cleaved. In a certain aspect, the ADC of the present invention has no internalization activity and has a cleavable linker that is extracellularly cleaved.
[0320] Whether or not an antibody has internalization activity can be confirmed by an in-vitro test. For example, the antibody that binds to the MEFLIN protein is contacted with cells having the MEFLIN protein on the cell surface and incubated for a time sufficient (e.g., approximately 15 minutes) for the internalization of the antibody. Then, an antibody in a culture solution and an antibody bound to the cell surface are washed off (e.g., using an aqueous solution containing 0.5 M NaCl and 3% by volume of acetic acid). Then, the antibody internalized into the cell can be confirmed by staining. The staining of the antibody internalized into the cell can be carried out in the same manner as in the staining of intracellular proteins. The staining of the antibody internalized into the cell can be detected, for example, on the basis of a label using a labeled secondary antibody.
[0321] Cancer tissues contain cancer cells (i.e., malignant tumor cells) and stromal cells of the cancer. MEFLIN is expressed in both malignant tumor (sarcoma) and benign tumor derived from mesenchymal stem cells or cells similar thereto. Specifically, this protein was confirmed to be expressed on cancer cells in almost all non-epithelial tumor cases such as osteosarcoma, chondrosarcoma, liposarcoma, rhabdomyosarcoma, undifferentiated pleomorphic sarcoma, desmoid tumor, and meningioma. Thus, the ADC of the present invention can be used in the treatment of malignant tumor (sarcoma) derived from mesenchymal stem cells or cells similar thereto. The ADC of the present invention can also be used in the treatment of benign tumor. In cancers (carcinoma) developed from epithelial cells, the MEFLIN protein was expressed in stromal cells (e.g., CAF) of almost all the cancers even when cancer cells themselves are MEFLIN protein-negative. Thus, the ADC of the present invention can be used in the treatment of carcinoma by targeting stromal cells of the carcinoma. The expression of MEFLIN can be examined by, for example, in situ hybridization or by immunohistochemical staining using an antibody and may be examined by other methods, for example, RT-PCR, Western blot, DNA microarray method, and RNA sequencing analysis method.
[0322] Examples of the cancer to be subjected to therapy with the ADC or the pharmaceutical composition of the present invention include, but are not particularly limited to, cancers, for example, cancers (carcinoma) developed from epithelial cells, such as lung cancer, pancreatic cancer, head and neck cancer, prostate cancer, bladder cancer, breast cancer, esophageal cancer, stomach cancer, colorectal cancer, uterine cancer, ovary cancer, skin cancer, thyroid gland cancer, thymic cancer, kidney cancer, testis cancer, penis cancer, liver cancer, bile duct cancer, and biliary tract cancer, and their metastatic cancers (or cancer cells). Examples of the cancer to be subjected to therapy with the ADC or the pharmaceutical composition of the present invention also include retroperitoneal tumor, angiosarcoma, and lymphangiosarcoma, and their metastatic cancers (or cancer cells). Further examples of the cancer to be subjected to therapy with the ADC or the pharmaceutical composition of the present invention include brain tumor and bone and soft tissue tumor. Cancer cells of these cancers are MEFLIN protein-positive, or the stroma of the cancers contains MEFLIN protein-positive cells even if the cancer cells are MEFLIN protein-negative. According to the present invention, MEFLIN protein-positive cells are recruited into the stroma of the above-mentioned cancers. Thus, according to the present invention, the cancer (or cancer cells) to be subjected to therapy with the ADC or the pharmaceutical composition of the present invention may be MEFLIN-negative. MEFLIN protein-positive cells are recruited into the stroma of a MEFLIN protein-negative cancer, and the ADC of the present invention targets the MEFLIN protein-positive cells recruited into the stroma and is capable of exerting antitumor activity against the cancer, irrespective of the cancer (or cancer cells) itself being MEFLIN protein-positive or -negative. This can be explained by a bystander effect. The presence or absence of MEFLIN protein-positive cells in the stroma of a cancer may be confirmed by testing the expression of the MEFLIN protein in a tissue specimen. In a certain aspect of the present invention, the cancer to be subjected to the therapy is MEFLIN protein-negative and is a cancer in which MEFLIN protein-positive cells reside in the stroma of the cancer. According to the present invention, the cancer to be subjected to therapy with the ADC or the pharmaceutical composition of the present invention may be a MEFLIN protein-positive cancer (e.g., sarcoma, for example, myxofibrosarcoma, malignant fibrous histiocytoma, liposarcoma, leiomyosarcoma, rhabdomyosarcoma, malignant peripheral nerve sheath tumor, Ewing's sarcoma, epithelioid sarcoma, clear cell sarcoma, synovial sarcoma, and osteosarcoma). In a certain aspect of the present invention, the cancer to be subjected to the therapy is MEFLIN protein-positive and is a cancer in which MEFLIN protein-positive cells reside in the stroma of the cancer. In a certain aspect of the present invention, the cancer to be subjected to the therapy is MEFLIN protein-positive and is a cancer in which no MEFLIN protein-positive cell is detected in the stroma of the cancer. In a certain aspect, the cancer to be subjected to the therapy can be a cancer evaluated or predicted to be MEFLIN-positive, or a cancer evaluated or predicted to contain MEFLIN-positive cells in the stroma though the cancer cells themselves are MEFLIN-negative.
[0323] The bispecific antibody can be, for example, an antibody having binding affinity for each of a cancer cell and an immunocyte. The bispecific antibody can be, for example, an antibody that binds to the MEFLIN protein and a T cell surface antigen such as CD3 protein. The bispecific antibody can be of IgG type and of diabody type. This aspect can be effective for, for example, MEFLIN protein-positive cancer cells.
[0324] In a certain aspect of the present invention, the pharmaceutical composition comprises the ADC of the present invention and an excipient. The pharmaceutical composition of the present invention can be administered by an administration method such as intravenous administration, subcutaneous administration, intratumoral administration, intraperitoneal administration, intracerebroventricular administration, or intramuscular administration. The dose can be appropriately determined by a physician in consideration of the age, sex, body weight, disease severity, etc. of a patient.
[0325] The present invention provides use of the ADC of the present invention in the production of a medicament for use in therapy of a cancer.
[0326] The present invention provides a method for therapy of a cancer in a subject in need thereof, the method comprising administering a therapeutically effective amount of the ADC of the present invention to the subject. In this aspect, the cancer to be subjected to the therapy is MEFLIN protein-negative and can be a cancer (e.g., carcinoma) in which MEFLIN protein-positive cells reside in the stroma of the cancer. In a certain aspect, the cancer can be a MEFLIN protein-positive cancer (e.g., sarcoma). Such a subject can be identified or selected by the detection of MEFLIN mRNA by immunohistochemical staining using an anti-MEFLIN antibody or by in situ hybridization in a tissue specimen obtained from the subject or a tissue section thereof.
[0327] The present invention provides use of the ADC of the present invention in a method for therapy of a cancer. The present invention can provide the ADC of the present invention for use in a method for therapy of a cancer.
EXAMPLES
Example 1: Preparation of Antibody and Characterization of Obtained Monoclonal Antibody
[0328] In this Example, a monoclonal antibody that recognizes the human MEFLIN protein was prepared, and the binding characteristics of the antibody were confirmed by various assays.
[Preparation of Cell]
[0329] A human embryonic kidney (HEK293) cell line stably expressing mouse Meflin (hereinafter, referred to as a mMeflin HEK293 cell line) and a Chinese hamster ovary (CHO) cell line stably expressing mouse Meflin (hereinafter, referred to as a “mMeflin CHO cell line”) were established using Flp-In™ system (Thermo Fisher Scientific, Inc.). Likewise, a human embryonic kidney (HEK293) cell line stably expressing human MEFLIN (hereinafter, referred to as a hMeflin HEK293 cell line) and a Chinese hamster ovary (CHO) cell line stably expressing human MEFLIN (hereinafter, referred to as a “hMEFLIN CHO cell line”) were established.
[Preparation of Rat Anti-Human MEFLIN Monoclonal Antibody]
[0330] In animal immunization for preparing an antibody against human MEFLIN, a human MEFLIN recombinant protein was used as an antigen. The human MEFLIN recombinant protein was obtained using a mammalian cell expression system. For example, the human MEFLIN gene was introduced into a human embryonic kidney-derived cell line (Expi293F cells, Thermo Fisher Scientific, Inc.) acclimatized in suspension culture by lipofection (lipofectamine 2000, Invitrogen Corp.). In order to enable later purification, the carboxyl-terminal GPI anchor sequence of the MEFLIN gene was removed, and a histidine tag was introduced thereto. The cell culture solution 5 to 8 days after gene introduction was recovered, treated through a filter (0.22 micrometers), and then applied to a column filled with a support (Ni Excel, GE Healthcare Japan Corp.) that specifically bind to a histidine-tagged protein so that the MEFLIN protein in the culture solution was attached thereto. After washing of the column, the attached MEFLIN protein was competitively eluted using a buffer solution containing imidazole (500 mM). Imidazole was removed from the eluate containing the MEFLIN protein by ultrafiltration (dialysis using a phosphate buffer solution) to obtain a final human MEFLIN recombinant protein. The purity of the purified human MEFLIN recombinant protein was measured by subjecting the protein to SDS-PAGE electrophoresis and subsequent Coomassie Brilliant Blue staining method.
[0331] The sole of a WKY rat hindlimb was immunized once with 100 μg of the recombinant human MEFLIN protein (degree of purification: 95%). Two weeks later, plasma cells residing in iliac lymph nodes were electrically fused with a myeloma (SP2/0) cell line to prepare hybridomas. The culture medium used was HAT medium (MPB) and BM condimed H1 (Roche) supplemented with High glucose DMEM (Nacalai Tesque, Inc.), and the hybridomas were screened.
[Preparation of Mouse Anti-Human MEFLIN Monoclonal Antibody]
[0332] A monoclonal antibody was prepared in the same manner as in the preparation of the rat anti-human MEFLIN monoclonal antibody except that the muscle of a C57BL/6 mouse tail root was immunized once with 50 μg of the recombinant human MEFLIN protein (degree of purification: 95%).
[Screening of Hybridoma]
[0333] A hybridoma producing the monoclonal antibody that recognizes the antigen was screened for by each method of ELISA using the recombinant human MEFLIN protein, immunofluorescence staining (IF) using the hMEFLIN CHO cell line, flow cytometry using the hMEFLIN CHO cell line, and immunoprecipitation and Western blotting using a cell lysate prepared from the hMeflin HEK293 cell line.
[Western Blotting]
[0334] The human embryonic kidney (HEK293) cell line was allowed to transiently express pRP-CMV vector having an insert of DNA encoding the human MEFLIN protein or a fragment thereof by lipofection, and a cell lysate was prepared. The fragment used was the fragments shown in
[Analysis of Internalization Activity of Monoclonal Antibody]
[0335] The hMeflin CHO cell line or the mMeflin CHO cell line was cultured at 37° C. for 3 hours under 5% CO.sub.2 in an assay solution of F-12 Glutamax culture medium (Gibco) supplemented with 20 mM HEPS and 0.1% BSA. Each hybridoma supernatant was diluted 10-fold with the assay solution and added to the CHO cell line, followed by culture for 15 minutes. The CHO cell line was washed with PBS (4° C.), and an antibody bound on the cell membrane was washed off with a washing solution (MilliQ-H.sub.2O containing 0.5 M NaCl and 3% acetic acid). The CHO cell line was fixed in 4% paraformaldehyde (PFA) through reaction for 10 minutes and then reacted with 0.1% Triton X-100 for 5 minutes for cell membrane permeation treatment. The secondary antibody used was an anti-rat or anti-mouse antibody-Alexa 488 conjugate. The secondary antibody was diluted 400-fold with PBS and reacted with the cells treated by cell membrane permeation at ordinary temperature for 30 minutes. After washing with PBS, the cells were reacted with DAPI at ordinary temperature for 5 minutes and washed with PBS, and an image was obtained using a confocal microscope (LSM700, Carl Zeiss AG).
[In Situ Hybridization]
[0336] A region richest in tumor components was microscopically selected from a pathological tissue preparation obtained from a sarcoma patient or a carcinoma patient, and examined for the expression of MEFLIN (also referred to as “ISLR”) by in situ hybridization (hereinafter, referred to as the “ISH staining method”) (see WO2017/22472). Among the examined tissues, which were observed in a field of view with a medium magnification (20× objective lens), sarcoma tissues were grouped into ISLR-positive tumor tissues when 20% or more of cells having the morphology of tumor cells were ISLR-positive and into ISLR-negative tumor tissues when the percentage of the cells was less than this. Likewise, carcinoma tissues were grouped into ISLR-positive tumor tissues when 20% or more of cells infiltrating into the cancer stroma and having fibroblast-like morphology were ISLR-positive and into ISLR-negative tumor tissues when the percentage of the cells was less than this. Tissues were regarded as being ISLR-positive when signals were observed in at least a portion of the cytoplasm.
[Histological Immunofluorescence Double Staining Method]
[0337] Tumor tissues were sampled from cancer-bearing mouse models in which an osteosarcoma cell line (HsOs1) or a pancreatic cancer cell line (BxPC-3) was subcutaneously transplanted. The tissue samples were fixed in 10% formalin and then embedded in paraffin. The samples were sliced into a thickness of 2 μm, and the paraffin-embedded tissues were left standing on glass slides and deparaffinized with xylene and ethanol, followed by the activation of the antigen with an antigen activation solution of pH 6.0 (Leica Camera AG). After subsequent blocking, the immunofluorescence double staining method was performed using an anti-MEFLIN monoclonal antibody and an anti-cathepsin K antibody (ab37259, Abcam plc) as primary antibodies and an anti-rat antibody-Alexa 488 conjugate and an anti-mouse antibody-Alexa 594 conjugate as secondary antibodies (Invitrogen Corp.). The intracellular nuclei were stained with DAPI. The colors were green for MEFLIN, red for cathepsin K, and blue for the nuclei. An image was obtained using a confocal microscope (LSM700, Carl Zeiss AG).
[Immunohistochemical Staining Method]
[0338] A region richest in tumor components was microscopically selected from a pathological tissue preparation obtained from a carcinoma patient, and examined for the expression of MEFLIN (also referred to as “ISLR”) by the immunohistochemical staining method (hereinafter, referred to as the “IHC staining method”). The examined tissues, which were observed in a field of view with a medium magnification (20× objective lens), were grouped into ISLR-positive tumor tissues when 20% or more of cells infiltrating into the cancer stroma and having fibroblast-like morphology were ISLR-positive and into ISLR-negative tumor tissues when the percentage of the cells was less than this. Tissues were regarded as being ISLR-positive when signals were observed in at least a portion of the cytoplasm. An anti-rat or anti-mouse antibody-horseradish peroxidase (HRP) conjugate was used as a secondary antibody (ImmPRESS, Vector Laboratories).
[Results]
[0339] Results of examining the binding of each monoclonal antibody to each human MEFLIN protein fragment by Western blotting was as shown in
[0340] The internalization activity of each antibody clone was confirmed. The results were as shown in
[0341] The results were as shown in Table 9.
TABLE-US-00009 TABLE 9 List of characteristics of each monoclonal antibody Clone name Host Internalization Epitope 21-3 Rat S ? 25-1 Rat M ? 8-2 Mouse S ? 27-7 Rat S 344-399 27-8 Rat S 344-399 34-4 Rat M 232-343 35-9 Rat S 1-146 41-10 Rat N 344-399 46-3 Rat S 344-399 3-2 Mouse M 344-399 11-8 Mouse M 344-399 12-2 Mouse M 344-399 13-1 Mouse N 147-231 16-5 Mouse N 1-146 19-7 Mouse S 344-399 22-3 Mouse M 1-146 23-1 Mouse M 344-399 32-1 Mouse N 1-146
[0342] In Table 9, the symbol “S” represents that strong internalization activity was found, the symbol “M” represents that moderate internalization activity was found, and the symbol “N” represents that no internalization activity was detected. In the table, “?” means undetermined. In Table 9, “Host” represents that the species from which the antibody was derived was a rat or a mouse. In Table 9, the 21-3 antibody, the 25-1 antibody and the 8-2 antibody bound to the mouse MEFLIN protein, and the other antibodies were antibodies that bind to the human MEFLIN protein.
[0343] The expression of the MEFLIN protein in various cancer tissues was as shown in Table 10. Table 10 shows the number of tissues samples assayed, the number of positive samples among them, and a positive ratio (%).
TABLE-US-00010 TABLE 10 Expression of human MEFLIN (ISLR) in tumor cells Tumor type ≥ISLR (+) 20% tumor cells Positive % Osteosarcoma 8/34 23.5% Soft sarcoma Rhabdomyosarcoma 6/10 60.0% Desmoid sarcoma 9/54 16.7% Liposarcoma 10/44 22.7% Chondrosarcoma 7/35 20.0%
[0344] The expression of human MEFLIN (ISLR) in the tumor stroma was as shown in Table 11. Table 11 shows the number of tissues samples assayed, the number of positive samples among them, and a positive ratio (%). Two out of seven stomach cancer cases were positive.
TABLE-US-00011 TABLE 11 Expression of human MEFLIN (ISLR) in tumor stroma Tumor type ≥ISLR (+) 20% stromal cells Positive % Pancreatic cancer 47/71 66.2% Lung cancer 103/180 57.2% Breast cancer 34/71 47.9% Colorectal cancer 29/53 54.7% Bile duct cancer 20/47 42.6% Ovary cancer 43/48 89.6% Bladder cancer 18/35 51.4% Esophageal cancer 44/69 63.8%
[0345] The tumor cells of pancreatic cancer, lung cancer, breast cancer, colorectal cancer, stomach cancer, bile duct cancer, ovary cancer, bladder cancer and esophageal cancer were negative for the expression of human MEFLIN.
Example 2: Preparation of Antibody-Drug Conjugate (ADC) and In-Vivo Drug Efficacy Test Thereof
[0346] In this Example, a conjugate of each antibody prepared in Example 1 and a cytotoxic agent was prepared. The prepared conjugate was administered to cancer-bearing mouse models, and its antitumor effect was confirmed.
[Preparation of ADC]
[0347] An antibody was purified using Mono Spin™ L ProG (GL Sciences Inc.) from an antibody-containing hybridoma supernatant enriched by the high-density culture of the hybridoma. The disulfide bonds of the antibody were cleaved by reduction treatment with 1.0 mM DTT at 25° C. for 30 minutes, and VcMMAE (mc-vc-PAB-MMAE, MedChemExpress) or mc-PEG.sub.12-vc-PABC-MMAE was added to the exposed thiol groups at ordinary temperature, followed by purification by ultrafiltration. The VcMMAE is a compound registered under CAS No. 646502-53-6. The VcMMAE is composed of monomethyl auristatin E (MMAE) attached to a valine-citrulline linker via p-aminobenzoyloxycarbonyl (PBAC) and is configured to release MMAE upon cleavage of valine-citrulline by protease such as cathepsin B. The valine-citrulline linker is modified with a maleimidocaproyl group and can be reacted with a thiol group of cysteine of an antibody via the maleimido group. The mc-PEG.sub.12-vc-PABC-MMAE is the same as VcMMAE except that PEG is interposed. Its mechanism of MMAE release is also the same as that of VcMMAE. The drug-antibody ratio (the number of molecules of the cytotoxic agent conjugated with one molecule of the antibody; DAR) was determined by calculating the difference between the number of thiol groups of the antibody after reduction treatment and the number of thiol groups after addition of VcMMAE to the antibody. Specifically, the exposed thiol groups are reacted with 5,5′-dithiobis (2-nitrobenzoic acid, Dojindo Laboratories) to form stable 5-mercapto-2-nitrobenzoic acid. The thiol groups are quantified from the absorbance (λ.sub.max=412 nm, ε=1.55×10.sup.4) of this formed thiol.
[0348] The mc-vc-PAB-MMAE has a structure of the following formula (I):
##STR00001##
[0349] The obtained ADC can have a structure of the following formula (II):
##STR00002##
wherein n is any natural number of 1 to 8.
[0350] The mc-PEG.sub.12-vc-PABC-MMAE has a structure of the following formula (III):
##STR00003##
[0351] The prepared ADC was used to test cytotoxicity to various cells.
Cytotoxicity of ADC to HEK293 Cell Expressing Human MEFLIN
[0352] First, the cytotoxicity of ADC to HEK293 cells expressing human MEFLIN was tested. Specifically, the hMeflin HEK293 cell line was inoculated at 1.0×10.sup.4 cells/well to a plate and cultured at 37° C. for 1 day under 5% CO.sub.2. Next, each concentration of ADC was added thereto, and the cells were cultured for 2 days and evaluated for the ability of the cells to proliferate by the MTT test. The ability of the cells to proliferate was evaluated by measuring the absorbance of a sample at a wavelength of 590 nm using an absorption spectrometer (POWERSCAN 4, DS Pharma Biomedical Co., Ltd.) in the MMT test. Also, the Meflin expression level of the hMeflin HEK293 cell line was evaluated by FACS analysis. Hereinafter, a clone number simply described in a drawing means that the monoclonal antibody itself was used; a clone number described immediately before or immediately after ADC means that ADC in which the antibody was the clone was used; and CTL ADC or isotype control IgG ADC means that ADC in which the antibody was an isotype control IgG antibody was used. The isotype control antibody used was rat IgG2a (BioLegend, Inc.).
[0353] The results were as shown in
Cytotoxicity of ADC to Human Rhabdomyosarcoma Cell Line
[0354] The cytotoxicity of ADC to a rhabdomyosarcoma (KYM-1) cell line was tested in the same manner as above. The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Rhabdomyosarcoma Cell Line
[0355] Next, the cytotoxicity of ADC was tested in vivo using cancer-bearing mouse models. 1.0×10.sup.7 cells of a KYM-1 cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 100 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the KYM cell line was subjected to ISH staining.
[0356] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Osteosarcoma Cell Line
[0357] 1.0×10.sup.7 cells of an endogenous Meflin-positive osteosarcoma (HsOs1) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 75 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the HsOs1 cell line was subjected to ISH staining.
[0358] The results were as shown in
[0359] Cytotoxicity of ADC in model with subcutaneously transplanted pancreatic cancer cell line 1.0×10.sup.7 cells of an endogenous Meflin-negative human pancreatic cancer (BxPC-3) cell line were subcutaneously transplanted to the back of each female nude mouse (BALB/cS1c nu/nu) (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 150 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the BxPC-3 cell line was subjected to ISH staining.
[0360] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Lung Cancer Cell Line
[0361] 1.0×10.sup.7 cells of an endogenous Meflin-negative human lung cancer (A549) cell line were subcutaneously transplanted to the back of each female nude mouse (BALB/cS1c nu/nu) (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 100 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the A549 cell line was subjected to ISH staining.
[0362] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Neuroblastoma Cell Line
[0363] 1.0×10.sup.7 cells of an endogenous Meflin-positive neuroblastoma (NB-1) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 250 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the NB-1 cell line was subjected to ISH staining.
[0364] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Colorectal Cancer Cell Line
[0365] 1.0×10.sup.7 cells of an endogenous Meflin-negative human colorectal cancer (DLD-1) cell line were subcutaneously transplanted to the back of each female nude mouse (BALB/cS1c nu/nu) (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 200 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the DLD-1 cell line was subjected to ISH staining.
[0366] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Stomach Cancer Cell Line
[0367] 1.0×10.sup.7 cells of an endogenous Meflin-negative human stomach cancer (MKN45) cell line were subcutaneously transplanted to the back of each female nude mouse (BALB/cS1c nu/nu) (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 200 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the MKN45 cell line was subjected to ISH staining.
[0368] The results were as shown in
Single-Cell Analysis in Mouse Pancreas
[0369] In
Single-Cell Analysis in Mouse Lung
[0370] In
[0371] CHO cells were allowed to express the full-length mouse MEFLIN protein, and Western blotting was attempted on a cell lysate thereof. The results were as shown in
Immunofluorescence Double Staining Method of Osteosarcoma Tissue
[0372]
[0373] The results were as shown in
Immunofluorescence Double Staining Method of Pancreatic Cancer Tissue
[0374]
[0375] The results were as shown in
[0376] These results demonstrated that: when human MEFLIN-negative cancer cells are transplanted to mice, MEFLIN-positive cells are recruited into tissues containing the cancer cells; and ADC targeting the recruited MEFLIN-positive cells is beneficial for the treatment of the cancer. These results also demonstrated that ADC targeting the human MEFLIN protein is not necessarily required to have internalization activity. An enzyme, such as cathepsin, which cleaves a valine-citrulline linker resides in the stroma containing MEFLIN protein-positive cells, and this enzyme presumably allows ADC that is not internalized into cells to exhibit cytotoxicity.
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Bile Duct Cancer Cell Line
[0377] 1.0×10.sup.7 cells of an endogenous Meflin-negative human bile duct cancer (HuCCT1) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=5 per group). ADC was administered to the tail vein of the mouse having a tumor volume of approximately 250 mm.sup.3 (5 mg/kg body weight; a total of 3 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the HuCCT1 cell line was subjected to ISH staining.
[0378] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Bladder Cancer Cell Line
[0379] 1.0×10.sup.7 cells of an endogenous Meflin-negative human bladder cancer (T24) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=4 per group). ADC was administered to the tail vein of the mouse having a tumor volume of approximately 300 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the T24 cell line was subjected to ISH staining.
[0380] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Ovary Cancer Cell Line
[0381] 1.0×10.sup.7 cells of an endogenous Meflin-negative human ovary cancer (OV-90) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 100 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the OV-90 cell line was subjected to ISH staining.
[0382] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Esophageal Cancer Cell Line
[0383] 1.0×10.sup.7 cells of an endogenous Meflin-negative human esophageal cancer (KYSE) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=5 per group). ADC was intraperitoneally administered to the mouse having a tumor volume of approximately 200 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the KYSE cell line was subjected to ISH staining.
[0384] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Osteosarcoma Cell Line
[0385] 1.0×10.sup.7 cells of an endogenous Meflin-positive osteosarcoma (HsOs1) cell line were subcutaneously transplanted to the back of each female NOD SCID mouse (n=4 per group). ADC was administered to the tail vein of the mouse having a tumor volume of approximately 250 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the HsOs1 cell line was subjected to ISH staining.
[0386] The results were as shown in
Cytotoxicity of ADC in Model with Subcutaneously Transplanted Breast Cancer Cell Line
[0387] 1.0×10.sup.7 cells of an endogenous Meflin-negative human breast cancer (MCF-7) cell line were subcutaneously transplanted to the back of each female nude mouse (BALB/cS1c nu/nu) (n=5 per group). ADC was administered to the tail vein of the mouse having a tumor volume of approximately 300 mm.sup.3 (5 mg/kg body weight; a total of 5 doses were administered at 4-day intervals). The length (L) and width (W) of tumor were measured using electric calipers, and the volume was calculated according to V=L×W.sup.2×0.52. The tumor formed by the transplantation of the MCF-7 cell line was subjected to ISH staining.
[0388] The results were as shown in
Evaluation of Validity of Immunohistochemical Staining of Human Pancreatic Cancer Tissue
[0389] The subject samples used were serial sections of a surgical specimen of human pancreatic cancer. Immunohistochemical staining using an anti-MEFLIN antibody was carried out on the serial sections of a surgical specimen of human pancreatic cancer, and the expression of MEFLIN in the human tissues was confirmed using an anti-MEFLIN antibody. Also, the expression of human MEFLIN mRNA in these serial sections was confirmed by in situ hybridization.
[0390] The results were as shown in
[0391] Sequence Listing