Alpha-enolase specific antibodies and method of use in immune diseases

Abstract

A method for treating an inflammatory disease or an immune disorder includes administering to a subject in need of such treatment an antagonist against ENO1. The antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity. The antagonist may be an anti-human ENO1 antibody, or an scFv, Fab, or F(ab).sub.2 fragment thereof, that specifically binds to human ENO1 (GenBank: AAH50642.1) for the treatment of an inflammatory disease or an immune disorder, which may be multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic Lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, type 1 diabetes mellitus, artherosclerosis or osteoporosis.

Claims

1. An antibody, or an scFv, Fab or F(ab)2 fragment thereof, wherein the antibody, or the scFv or Fab or F(ab)2 fragment thereof, can bind to an epitope on human ENO1 and inhibit ENO1 plasminogen receptor activity, wherein the epitope is located in a region consisting of the sequence of 296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPK RIAKAVNEKS336 (SEQ ID NO:39) of human ENO1.

2. The antibody, or an scFv, Fab or F(ab)2 fragment thereof, according to claim 1, wherein the epitope is located in a region consisting of the sequence of 296FDQDDWGAWQKFTA 309 (SEQ ID NO:40) or 326KRIAKAVNEKS336 (SEQ ID NO:41) of human ENO1.

3. The antibody, or the scFv, Fab or F(ab)2 fragment thereof, according to claim 1, wherein the antibody is a monoclonal antibody.

4. A pharmaceutical composition for treating an inflammatory disease or an immune disorder, comprising the antibody, or the scFv, Fab or F(ab)2 fragment thereof, according to claim 1 and a pharmaceutically acceptable carrier.

5. A method for treating an inflammatory disease or an immune disorder, comprising administering to a subject in need thereof the antibody, or an scFv, Fab or F(ab)2 fragment thereof, according to claim 1 an antagonist against ENO1, wherein the antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity.

6. The method of claim 5, wherein the subject is human and the anti-ENO1 antibody binds human ENO1 protein.

7. The method of claim 6, wherein the anti-ENO1 antibody inhibits a plasminogen receptor activity of the human ENO1 protein by preventing plasminogen from binding to the human ENO1 protein.

8. The method of claim 5, wherein the anti-ENO1 antibody is a monoclonal antibody.

9. The method of claim 5, wherein the inflammatory disease or immune disorder is multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic Lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, type 1 diabetes mellitus, atherosclerosis or osteoporosis.

10. The method of claim 9, wherein the anti-ENO1 antibody is a monoclonal antibody.

11. The method of claim 10, wherein the anti-ENO1 antibody binds human ENO1 with a Kd of 110-7M or less.

12. The method of claim 5, wherein the anti-ENO1 antibody is selected from the group consisting of a chimeric antibody, a humanized antibody, an affinity matured antibody, a human antibody, a bispecific antibody and antibody drug conjugated (ADC).

13. The method of claim 5, wherein the anti-ENO1 antibody can specifically bind to an ENO1 plasminogen receptor of monocytes or leukocytes.

14. The method of claim 5, further comprising administering to the subject in need thereof an immune-suppressor immune-suppression modulator.

15. The method according to claim 5, wherein the epitope is located in a region consisting of the sequence of 296FDQDDWGAWQKFTA309 (SEQ ID NO:40) or 326KRIAKAVNEKS336 (SEQ ID NO:41) of human ENO1.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows ELISA results from ENO1 binding by a mouse anti ENO1mAb isolated from the ascites of hybridoma. Ammonium sulfate purification, protein A column purification, and SDS-PAGE purification were performed as described in Example 1. These data show the K.sub.d of anti-human ENO1 antibody EN10 mAb.

(2) FIGS. 2A, 2B and 2C show results of ENO1 expression on the surface of CD11b+ cell when normal human PBMC is treated with LPS. The induction of ENO1 expression by LPS in normal human PBMC was performed as described in Example 2. FIG. 1A shows that LPS induced the expression of ENO1 on cell surface, as evidenced by the increase and right-shift of fluorescent cell population in FACS scan. Data in FIG. 2B and FIG. 2C show that ENO1 is up-regulated in the CD11b.sup.high (FIG. 2B) and Mac3.sup.high (FIG. 2C) cells of inflammatory PBMC.

(3) FIG. 3 shows the results of effects on LPS-induced U937 fibrinolytic activity by EN10 mAb (anti-ENO1 antibody) isolated from acites of hybridomas. The induction of ENO1 expression by LPS on human U937 monocytic cell line and plasmin activity assay were performed as described in Example 3. These data show that EN10 mAb can inhibit ENO1 plasminogen receptor function on monocytes.

(4) FIG. 4 shows results of invasion activities of human U937 monocytic cell line treated with different concentrations of EN10 mAb when the surface ENO1 expression of cells is induced by LPS. The detailed procedures were performed as described in Example 4. These data show that the EN10 mAb inhibits the invasion activity of U937 cells in a dose-dependent manner.

(5) FIG. 5 shows that the EN10 mAb recognizes the cell surface ENO1 on the human U937 monocytes treated with LPS. The detailed procedures were performed as described in Example 5.

(6) FIG. 6A shows the EN10 mAb binding activities of deletion mutants of ENO1. The binding epitope of EN10 mAb is located between the amino residue number 297 and 434 of human ENO1 protein because deletion of this fragment essentially abolishes antibody binding. The large portion deletion of ENO1 to determine the binding region of EN10 mAb was performed as described in Example 6.

(7) FIG. 6B shows the 12% SDS PAGE of 6 C-terminal deletion mutant protein of ENO1 purified from E. coli. The detailed procedures for the purification of ENO1 deletion mutants are described in Example 6.

(8) FIG. 6C shows the EN10 mAb binding activities of 6 C-terminal deletion mutants of ENO1. The binding epitope of EN10 mAb is located between amino residue number 296 and 336 of human ENO1 protein. The large portion deletion of ENO1 to determine the binding region of EN10 mAb was performed as described in Example 6.

(9) FIG. 7A depicts the crystal structure and surface-expose amino acid residues between amino number 296 and 336 of human ENO1. The structure prediction was described in Example 7.

(10) FIG. 7B shows the 12% SDS PAGE of 11 alanine scanning mutant proteins of ENO1 purified in E. coli. The detailed procedures for the purification of ENO1 mutation proteins are described in Example 7.

(11) FIG. 7C shows the ENO1 binding ELISA and Kd values of 11 alanine scanning mutants against EN10 mAb. The result suggests that sequences of ENO1 peptide 1, FD Q D D W G A W Q K F TA (SEQ ID NO: 40), and peptide 2, K R I A K A V N EK S (SEQ ID NO:41), located between amino residue number 296 and 336 of human ENO1 are involved in EN10 mAb binding. The alanine scanning was performed as described in Example 7.

(12) FIG. 7D shows the sequences of ENO1 peptide 1 (FD Q D D W G A W Q K F TA (SEQ ID NO: 40)) and peptide 2 (K R I A K A V N EK S (SEQ ID NO:41)) between amino residue number 296 and 336 of human ENO1 (SEQ ID NO:39), which participate in human ENO1 and EN10 mAb binding.

(13) FIGS. 8A and 8B show results of inhibition of leukocyte infiltration in a mouse non-infectious inflammation model by administration of En10 mAb into mice. The detailed procedures were performed as described in Example 8. FIG. 8A shows the effect of EN10 mAb on the total peritoneum cell counts, and FIG. 8B shows no effect on neutrophil counts after administration of EN10 mAb.

(14) FIG. 9 shows that the administration of EN10 mAb improves the course of experimental autoimmune encephalomyelitis (EAE) in an animal prophylactic model of multiple sclerosis. The detailed procedures were performed as described in the example 9.

(15) FIG. 10A shows that the administration of EN10 mAb ameliorates multiple sclerosis symptoms of EAE in an animal therapeutic model. The detailed procedures were performed as described in Example 10.

(16) FIG. 10B shows that the administration of EN10 mAb decreases CNS histopathology scores of EAE in an animal therapeutic model. The detailed procedures were performed as described in Example 10.

(17) FIG. 10C shows that the administration of EN10 mAb improves CNS demyelination scores of EAE in an animal therapeutic model. The detailed procedures were performed as described in Example 10.

(18) FIG. 10D shows that the administration of EN10 mAb alleviates CNS inflammation of EAE in an animal therapeutic model. The detailed procedures were performed as described in the example 10.

(19) FIG. 11A shows that the administration of the EN10 mAb alleviates the symptoms of arthritis in the collagen antibody-induced arthritis rodent model. The detailed procedures were performed as described in Example 11.

(20) FIG. 11B shows that the treatment of the EN10 mAb down-regulates synovial IL1-b in the collagen antibody-induced arthritis rodent model. The detailed procedures were performed as described in Example 11.

(21) FIG. 11C show that the treatment of the EN10 mAb down-regulates synovial MMP9 in the collagen antibody-induced arthritis rodent model. The detailed procedures were performed as described in Example 11.

(22) FIGS. 12A and 12B. shows the generation of rat anti-mouse ENO1 antibody hybridomas and verification of each monoclonal antibody clones by the binding ELISA and the competition ELISA. The OD reading from the ELISA assays is shown next to each clone. The procedures for the generation of hybridoma, and the production of each antibody and verification of antibody by the binding ELISA and the competition ELISA were described in Example 12. The data show that 5 of 75 hybridomas antibodies may recognize the orthologous epitope of EN10 mAB in mouse ENO1 protein.

(23) FIG. 13. shows ELISA results from ENO1 binding by 5 rat anti mouse ENO1 antibodies isolated from the supernatants of individual hybridoma. Ammonium sulfate purification, and protein A column purification were performed as described in Example 1. These data show the Kd of rat anti mouse ENO1 7E5

(24) FIG. 14A. shows that administration of rat anti mouse ENO1 antibody 7E5 ameliorates multiple sclerosis symptoms of EAE in an animal therapeutic model. The detailed procedures were performed as described in Example 14.

(25) FIG. 14B shows that the administration of rat anti mouse ENO1 antibody 7E5 decreases CNS histopathology scores of EAE in an animal therapeutic model. The detailed procedures were performed as described in Example 14.

(26) FIG. 14C shows that the administration of rat anti mouse ENO1 antibody 7E5 improves CNS demyelination scores of EAE in an animal therapeutic model. The detailed procedures were performed as described in Example 14.

(27) FIG. 14D shows that the administration of rat anti mouse ENO1 antibody 7E5 alleviates CNS inflammation of EAE in an animal therapeutic model. The detailed procedures were performed as described in the example 14.

DETAILED DESCRIPTION OF THE INVENTION

(28) Embodiments of the invention relate to methods for the treatments of various ENO1-related diseases or disorders. ENO1-related diseases or disorders may include inflammatory diseases or immune disorders. Examples of inflammatory diseases include multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, and systemic Lupus erythematosus. Examples of immune disorders include chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, type 1 diabetes mellitus, artherosclerosis and osteoporosis. The methods use an antagonist that can bind to ENO1 to inhibit its function as a receptor for plasminogen. By such inhibition, plasminogen activation is inhibited, thereby downstream reactions that involve plasmin activity is prevented or reduced. The antagonists against ENO1 may be antibodies, which may be polyclonal antibodies, monoclonal antibodies, or other modified antibodies that can bind ENO1 and inhibit ENO1's function in the activation of plasminogen.

(29) Embodies of the invention will be further illustrated with specific examples set forth below. One skilled in the art would appreciate that these examples are for illustration only an dare not intended to be limiting because variations and modifications are possible without departing from the scope of the invention.

EXAMPLES

Example 1

(30) To evaluate the ENO1 binding affinity of anti-human ENO1 antibody EN10 mAb, the hybridomas were grown in RPMI containing 10% fetal calf serum (FCS). After one week culture, 110.sup.6 cells were collected, washed with PBS, resuspended in 200 ul RPMI medium, and injected into severe combined immunodeficiency (SCID) mice by IP injection. Three weeks later, acites of mice was collected and diluted to 15 ml. Antibody was further purified by 40% ammonium sulfate and Protein A column (Montage antibody purification kit Millipore) according to procedures known in the art. The purified antibody was concentrated with an Amicon Ultra-15 centrifugal filter device, following the protocols provided by the manufacturer (Millpore). The purity of antibody was analyzed by 12% SDS PAGE.

(31) Four hundred (400) ng of human ENO1 protein was coated on a 96-well ELISA plate, and the plate was further washed with PBS. Serial dilutions from 110.sup.12 to 110.sup.8 M of EN10 mAb antibody were added to the plate, and the plate was incubated at 37 C. for 1 hour. A goat anti-mouse IgG conjugated with hypoxanthine phosphoribosyltransferase (HPRT) was added. After 1 hour, 3,3,5,5-Tetramethylbenzidine (TMB) was added and OD405 was read. Every study was repeated three times. Data were presented as meanSD. OD readings and concentrations of antibodies were used to make a multiple scatter plot using Sigmaplot. The K.sub.d values were predicted by four parameter logistic fit.

(32) The results of this experiment are shown in FIG. 1. Antibody EN10 mAb had productivities from 20.4 mg to 4.6 mg per mice. The K.sub.d value of EN10 mAb antibody was 2.030.1210.sup.10 M (N=3). This result suggests that EN10 mAb antibody can recognize the human ENO1 protein and has a favor affinity with a K.sub.d value of about 2.030.1210.sup.10 M (N=3).

Example 2

(33) It is known that ENO1 protein is up-regulated in mouse inflammatory monocytes in vivo and in vitro (Wygrecka, M. et al. (2009) Blood. 113:5588-5598). To assess the ENO1 expression level in human PBMC in the inflammatory status, fresh blood samples were collected from normal volunteers following the IRB committee codes of the Development Center for Biotechnology, Taiwan. The blood was processed to purify PBMC using Ficoll-Hypaque gradient centrifugation. The density of Ficoll-Hypaque (Pharmacia, France) was adjusted to about 1.077 g/ml. The harvested cells were grown in RPMI containing 10% fetal calf serum to a cell density of about 110.sup.6 cells/ml. The viability of cells was checked with trypan blue stains to confirm that the overall % of lymphocytes was over 90%. PBMC was further treated with 10 mcirogram/ml of lipopolysaccharide (LPS) for 6 hours. Cells were washed with PBS two times and subjected to flow cytometric analysis. The intact cells were stained with or without EN10 mAb (1:300 dilution) and with rat anti-human CD11b or Mac3 antibody. The stained cells were visualized with FITC-conjugated goat anti-mouse IgG for the EN10 mAb and PE-conjugated anti-rat IgG for the CD11b or Mac3 antibody (Becton Dickinson). The samples were then analyzed with FACScan flow cytometer (Becton Dickinson). ENO1 and CD11b+ expression was measured by the resulting fluorescence intensity.

(34) Results from these experiments are shown in FIG. 2A. Treating normal PBMC with LPS and EN10 mAb shifts the histogram to the right, as compared to incubating the cells without LPS and with EN10 mAb. This observation indicates that normal PBMC express ENO1 on their cell surface when cells are in inflammation condition (e.g., stimulated with LPS). Furthermore, cell populations with high ENO1 expression can be identified. As shown in FIG. 2B and FIG. 2C, Mac3+ and CD11b+ cell populations also increase in the LPS-treated human PBMC, as compared to cells without treatment. The high ENO1 expression cell population co-relates with the CD11b.sup.high and Mac3.sup.high cells (FIG. 2B and FIG. 2C). These results indicate that ENO1 protein is up-regulated on the surfaces of activated monocytes and macrophages.

Examples 3

(35) Wygrecka's study indicates that ENO1 plasminogen receptor activity is very important for monocytes to transmigrate into inflammatory sites (Wygrecka, M. et al., (2009), Blood., 113:5588-5598). To assess the capability of EN10 mAb to inhibit the ENO1 plasminogen receptor activity of human monocytes, a human U937 monocyte cell line was grown in RPMI containing 10% FCS. Cells were treated with 10 microgramlml of LPS for 6 hours to induce ENO1 protein expression on the cell surface. 1.510.sup.6 cells/ml in PBS were then pre-incubated with1 microgram/nil human Lys-plasminogen and 10 microgram/ml of EN10 mAb for one hour, respectively. Samples were washed with PBS twice and 3 nM of tissue specific plasminogen activator and 0.5 mM of chromogenic substrate S-2251 were added. After one hour incubation at 37 C., OD 405 was read. Every study was repeated three times, and the antagonist activity was analyzed. Data were presented as mean SD. T-test was used to compare each group. P values <0.05 were considered statistically significant.

(36) Results of this experiment are shown in FIG. 3. EN10 mAb had a high ENO1 plasminogen receptor antagonist activity and can achieve 100% inhibition of LPS-induced specific ENO1 activity. Therefore, EN10 mAb would have a good potential in inhibiting the transmigration of monocytes to the target organs.

Examples 4

(37) The result of Example 3 suggests that EN10 mAb can inhibit the ENO1 plasminogen receptor activity and results in the inhibition of plasminogen activation and transmigration activity in the LPS-stimulated human monocytes. This result is further supported by other literature reports indicating that monocytes of plasminogen-null mice lose the migration capability and infiltration activity in a mouse non-infectious inflammation model (Ploplis, V. A. et al., (1998) Blood, 91:2005-2009).

(38) To assess whether compromising the ENO1 plasminogen receptor activity results in the alleviation of invasion activity of activated monocytes, a human monocyte U937 cell line was grown in RPMI containing 10% FCS. Cells were treated with 10 microgram/ml of LPS for 6 hours to induce ENO1 protein expression on cell surface. After being mixed with 5 to 50 microgram/ml of EN10 mAb, 210.sup.4 cells were seeded in the top chamber of a two-chamber assay system containing 15 micro molar of Lys-plasminogen and incubated for 24 hours with media containing 10% FBS and 10 nM MCP-1 in the lower chamber. An anti-mouse IgG was used as a negative control group. Two chambers were separated by a micropore filter (8 micrometer pore size) coated with matrigel. After the incubation period, cells in the lower chamber were counted by a hemocytometer under a microscope. Every study was repeated three times. Data are presented as meanSD. The T-test was used to compare each groups. P values <0.05 were considered statistically significant.

(39) The results are shown in FIG. 4. When LPS-treated U937 cells were treated with 5 to 50 microgram/ml of EN10 mAb, the invasion activity of U937 was from 90.22% to 49.11% (N=3) of the control IgG. These results indicate that EN10 mAb can alleviate the invasion capability of activated U937 monocytes by compromising the ENO1 plasminogen receptor activity in a dose-dependent manner. By targeting ENO1 protein on the surface of inflammatory monocytes, it is feasible to inhibit cells entering affected sites using EN10 mAb.

Examples 5

(40) To know the expression level of cell surface ENO1 after inflammatory stimulation, human U937 monocytes were grown in RPMI containing 10% FCS. Cells were treated with 10 microgram/ml of LPS for 6 hours to induce ENO1 protein expression on the cell surface. For flow cytometric analysis, the intact whole cells were stained with or without EN10 mAb (1:300 dilution), visualized with FITC-conjugated goat antiserum (Jackson Lab), and analyzed with FACScan flow cytometer (Becton Dickinson). ENO1 expression was measured by the resulting fluorescence intensity.

(41) Results from these experiments are shown in FIG. 5. Incubating U937 with LPS and EN10 mAb shifts the histogram to the right, as compared to incubating the cells without LPS but with EN10 mAb. This result indicates that U937 cells express ENO1 on their cell surfaces when they are stimulated by LPS. These data support the notion that EN10 mAb recognizes LSP-induced surface ENO1 on the monocytes.

Example 6

Epitope Mapping

Antibody Epitope Mapping

(42) To determine the epitope of EN10 mAb on the human ENO1 protein, two forward primers, with the nucleotide sequences of 5-GGATCCGCAGCAAACTTCAGGGAAGCCATG-3 (SEQ ID NO:l), and 5-GGATCCTCGAAGATCCCTTTGACCAGGATG-3 (SEQ ID NO:2), and a reverse primer 5-TCAGGCTGAAAATCTCTCATCCGC-3 (SEQ ID NO:3) were designed. An E. coli expression plasmid pTRC-HIS ENO1 containing the human ENO1 cDNA gene was used as a template to amplify ENO1 deletion mutants. Primers with SEQ NO:1 and SEQ NO:2 were used as forward primers, with the SEQ ID NO:3 as a reverse primer, to amplify deletion mutants 1-189 (FIG. 6A) and 1-297 (FIG. 6A), respectively. The other set of primers, having the sequences of 5-GGATCCTATCTATTCTCAAGATCCATGCC-3 (SEQ ID NO:4) and 5-CTCGAGGTCATGGTGTCTCATCGTTCGCTCGAG-3 (SEQ ID NO:5), was used to amplify a deletion 297-434 (in FIG. 6A) mutant. For amplification of each mutant, a reaction solution having a composition of 1 microL of 1:1000 dilution of template DNA about 0.1 ng, 5 microL of 10 reaction buffer, 1 microL of 10 mM dNTP mix, 1 microL of 2.5 unit Taq polymerase, 1 microL of the forward primer, and 1 microL of the reverse primer was prepared in a final volume of 50 microL with double distilled water and subjected to PCR. A cycle of 94 degree C. for 10 minutes was used, then a cycle of 94 degree C. for one minute, 52 degree C. for one minute, and 72 degree C. for 1 minute was repeated 35 times, and the reaction was incubated at 72 degree C. for 10 more minutes. This reaction solution was subjected to 2% agarose gel electrophoresis to analyze the reaction products. Reaction products with the correct molecular weights were ligated into a pCR 2.1-TOPO vector (manufactured by Invitrogen) for subcloning in accordance with the attached instruction manual. M13 forward 5-GTAAACAACGACGGCGAG-3 (SEQ ID NO: 6) and M13 reverse 5-CAG GAAACA GCT ATG AC-3 (SEQ ID NO: 7) primers were then used to determine the nucleotide sequence. Every mutation clone with the correct sequences was digested with restriction enzymes BamHI and XhoI, and the digestion products were subjected to 2% agarose gel electrophoresis. The insertion fragment of each mutant was cut from the agarose gel and purified with a Gene Clean Kit in accordance with the attached instruction manual provided by the manufacturer (BIO101). The BamHI and XhoI DNA fragment of each mutant was ligated to the BamHI and XhoI sites of an E. coli expression vector pTRC His A (Invitrogen). The resulting plasmid was transformed into E. coli BL21 Rosseta. The ENO1 mutation protein was expressed in E. coli by IPTG induction and purified by Ni-agarose in accordance with the attached instruction manual provided by the manufacturer (Qiagen) after the bacteria pellet was sonicated. The purity of each mutant was analyzed by 12% SDS PAGE. To determine the binding activity of each mutant protein, 400 ng of each human ENO1 mutant protein was coated on a 96-well ELISA plate and the plate was washed by PBS. 10 microgram of EN10 mAb was added to the plate and the plate was incubated at 37 C. for 1 hours. After the binding complex was washed with PBS twice, a goat anti-mouse IgG conjugated with HPRT was added, After 1 hours incubation, TMB was added. The binding affinity was determined by the readings of OD 405. Each study was repeated three times. Data are presented as meanSD. The T-test was used to compare activity between each group. P values <0.05 were considered statistically significant.

(43) The results are shown in FIG. 6A. ENO1 mutants 1-189 and 1-297 have OD405 readings about 1.430.18 and 1.560.08 (N=3) (in FIG. 6A), which are about 42% and 39% of that of the wild type ENO1 (2.870.08) (N=3), respectively. However, when amino acid residues from 297 to 434 were deleted, the binding activity of this mutated ENO1 to EN10 mAb was lost, as compared with the BSA background. These results suggest that amino acid residues from 297 to 434 are required for ENO1 protein binding to EN10 mAb and the decrease in the binding activity of mutants 1-182 and 1-297 may be due to the instability or conformation change of the mutant proteins.

(44) To further explore the epitope of EN10 mAb in the ENO1 protein, 5 reverse primers, having sequences of 5-CTCGAGAGGGATCTTCGATAGACACCACTGGG -3 (SEQ ID NO:8), 5-CTCGAGCTACCTGGATTCCTGCACTGGCTG-3 (SEQ ID NO:9), 5-CTCGAGACTTCTCGTTCACGGCCTTGGCGATC-3 (SEQ ID NO:10), 5-CTCGAGACTTCTCGTTCACGGCCTTGGCGATCC-3 (SEQ ID NO:11), 5-CTCGAGCAGTCTCCCCCGAACGATGAGACACC-3 (SEQ ID NO:12), and 5-CTCGAG CACCAGTCTTGATCTGCCCAGTGCAC-3 (SEQ ID NO:13) were designed. An E. coli expression plasmid pTRC-HIS ENO1 containing the human ENO1 cDNA gene was used as a template to amplify the ENO1 deletion mutants. SEQ ID NO:4 were used as the forward primer to amplify deletion mutants 296-434, 316-434, 336-434, 376-434 and 396-434 with the SEQ ID NO:8, SEQ ID:9, SEQ ID:10, SEQ ID:11, SEQ 1D:12, and SEQ ID:13 primers, respectively. For amplification of each mutant, a reaction solution having a composition of 1 microL of 1:1000 dilution of template DNA about 0.1 ng, 5 microL of 10 reaction buffer, 1 microL of 10 mM dNTP mix, 1 microL of 2.5 unit Taq polymerase, 1 microL of forward primer, and 1 microL of reverse primer was prepared in a final volume of 50 microL with double distilled water and subjected to PCR. A cycle of 94 degree C. for 10 minutes was used. Then, a cycle of 94 degree C. for one minute, 52 degree C. for one minute, and 72 degree C. for 1 minute was repeated 35 times, and the reaction was incubated at 72 degree C. for 10 more minutes. This reaction solution was subjected to 2% agarose gel electrophoresis to analyze the reaction products. Reaction products with the correct molecular weights were ligated into a pCR 2.1-TOPO vector (manufactured by Invitrogen) for subcloning in accordance with the attached instruction manual. M13 forward (5-GTAAACAACGACGGCGAG-3 (SEQ ID NO:6) and MI3 reverse (5-CAGGAA ACAGCTATGAC-3 (SEQ ID NO:7) primers were then used to determine the nucleotide sequence. Every mutation clone with the correct sequence was digested with restriction enzymes BamHI and XhoI and the digestion product was subjected to 2% agarose gel electrophoresis. The DNA fragment of each mutant was isolated from the agarose gel and purified with a Gene Clean Kit in accordance with the attached instruction manual provided by the manufacturer (BIO101). The BamHI and XhoI DNA fragment of each mutant was ligated into the BamHI and XhoI sites of an E. coli expression vector pTRC His A (Invitrogen). The resulting plasmid was transformed into E. coli BL21 Rosseta. The ENO1 mutation protein was expressed in E. coli by IPTG induction and purified by Ni-agarose in accordance with the attached instruction manual provided by the manufacturer (Qiagen) after the bacteria pellet was sonicated. The purity of each mutant was analyzed by 12% SDS PAGE. To determine the binding activity of each mutant protein, 400 ng of human ENO1 protein or mutant protein was coated on a 96-well ELISA plate and the plate was washed by PBS. 10 microgram of EN10 mAb was added and incubated at 37 C. for 1 hour. After the binding complex was washed with PBS twice, a goat anti-mouse IgG conjugated with HPRT was added. After 1 hour incubation, TMB was added. The binding affinity was determined by the readings of OD 405. Each study was repeated three times. Data are presented as meanSD. The T-test was used to compare activity between each group. P values <0.05 are considered statistically significant.

(45) The 12% of SDS PAGE of each mutant and the wild type protein are shown in the FIG. 6B. The molecular weight of each mutant increases from the mutant 296-343 to the wild type. This result suggests that we can yield the whole protein from each mutant even though some degradation of mutants 336-434 and 376-434 can be seen. As showed in the FIG. 6C, there is no significant difference between the EN 10 mAb binding affinity of the wild type ENO1 and those of deletion mutants 336-434, 376-434, and 369-343. However, when amino acid residues from 296 to 316 and 317 to 336 are deleted, the EN10 mAb binding activities of these two ENO1 mutants are lost, as compared with that the E. coli cell lysate background. These results suggest that amino acid residues in the region from around 296 to around 336 (.sup.296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS.sup.336, SEQ ID NO:39) are important for the ENO1 protein binding with EN10 mAb.

Example 7

Alanine Scanning

(46) To further explore which residues from 296 to 336 of human ENO1 are important for EN10 mAb binding, the crystal structure of ENO1 was downloaded from protein data bank (pdb-entry: 2PSN). After the structure analysis, amino acid residues D300, W301, G302, Q305, K306, A309, K326, K330, N333, E334, and K335 are predicted to be exposed on the protein surface and are candidates for mutations to analyze whether they are indeed important for EN10 mAb binding. 10 of these 11 residues were chosen to be mutated to alanine, except for A309 which was mutated to glycine using the QuickChange II site-directed mutagenesis Kit in accordance with the attached instruction manual provided by the manufacturer (Agilent Technology). The following mutagenic oligonucleotides for alanine scanning (Table 1) were generated by Genomics BioScience and Technology Co., Ltd.

(47) TABLE-US-00001 TABLE1 OligoSequences 5-GATCCCTTTGACCAGGATGCCTGGGGAGCTTGGCAG-3 (SEQIDNO:14) 5-CTGCCAAGCTCCCCAGGCATCCTGGTCAAAGGGATC-3 (SEQIDNO:15) 5-CCCTTTGACCAGGATGACGCGGGAGCTTGGCAGAAG-3 (SEQIDNO:16) 5-CTTCTGCCAAGCTCCCGCGTCATCCTGGTCAAAGGG-3 (SEQIDNO:17) 5-CTTTGACCAGGATGACTGGGCAGCTTGGCAGAAGTTC-3 (SEQIDNO:18) 5-GAACTTCTGCCAAGCTGCCCAGTCATCCTGGTCAAAG-3 (SEQIDNO:19) 5-GACTGGGGAGCTTGGGCGAAGTTCACAGCCAGTGCA-3 (SEQIDNO:20) 5-TGCACTGGCTGTGAACTTCGCCCAAGCTCCCCAGTC-3 (SEQIDNO:21) 5-GGGGAGCTTGGCAGGCGTTCACAGCCAGTGCAGG-3 (SEQIDNO:22) 5-CCTGCACTGGCTGTGAACGCCTGCCAAGCTCCCC-3 (SEQIDNO:23) 5-GGCAGAAGTTCACAGGCAGTGCAGGAATCCAGGTAG-3 (SEQIDNO:24) 5-CTACCTGGATTCCTGCACTGCCTGTGAACTTCTGCC-3 (SEQIDNO:25) 5-TCACAGTGACCAACCCAGCGAGGATCGCCAAGGCC-3 (SEQIDNO:26) 5-GCCTTGGCGATCCTCGCTGGGTTGGTCACTGTGAG-3 (SEQIDNO:27) 5-CAACCCAAAGAGGATCGCCGCGGCCGTGAACGAGAAG-3 (SEQIDO:28) 5-CTTCTCGTTCACGGCCGCGGCGATCCTCTTTGGGTTG-3 (SEQIDNO:29) 5-GAGGATCGCCAAGGCCGTGGCCGAGAAGTCCTGCAAC-3 (SEQIDO:30) 5-GTTGCAGGACTTCTCGGCCACGGCCTTGGCGATCCTC-3 (SEQIDNO:31) 5-GATCGCCAAGGCCGTGAACGCGAAGTCCTGCAACTG-3 C(SEQIDNO:32) 5-GCAGTTGCAGGACTTCGCGTTCACGGCCTTGGCGATC-3 (SEQIDNO:33) 5-GCCAAGGCCGTGAACGAGGCGTCCTGCAACTGCCTC-3 (SEQIDNO:34) 5-GAGGCAGTTGCAGGACGCCTCGTTCACGGCCTTGGC-3 (SEQIDNO:35) 5-CAAGGCCGTGAACGCGGCGTCCTGCAACTGCCTCCTG-3 (SEQIDNO:36) 5-CAGGAGGCAGTTGCAGGACGCCGCGTTCACGGCCTTG-3 (SEQIDNO:37)

(48) For amplification of each mutant, a reaction solution having a composition of 3 microL of template DNA about 30 ng, 5 microL of 10 reaction buffer, 1 microL of 10 mM dNTP mix, 1 microL of 2.5 unit pfu polymerase, 12.5 microL of 125 ng forward primer, and 12.5 microL of 125 ng reverse primer was prepared in a final volume of 50 microL with double distilled water and subjected to PCR. A cycle of 95 degree C. for 10 minutes was used. Then, a cycle of 95 degree C. for 30 seconds, 55 degree C. for 30 seconds, and 68 degree C. for 6 minute was repeated 16 times. After the PCR reaction, 1 microL of DpnI was added to each PCR tubes, incubated at 37C for 1 hour and then DpnI was heated to be inactivated at 80 C. for 20 minutes. The reaction products were transformed to 50 microL XL1-Blue competent cells in accordance with the attached instruction manual (manufactured by Invitrogen). An ENO1 R400-420 primer (5-GCAAGGGGCACCAGTCTTGATCTG-3 (SEQ ID NO:38)) was used to determine the nucleotide sequence. Every mutation clone plasmids with correct sequences were transformed to E. coli BL21 Rosseta. The ENO1 mutation protein was expressed in E. coli by IPTG induction and purified by Ni-agarose in accordance with the attached instruction manual provided by the manufacturer (Qiagen) after the bacteria pellet was sonicated. The purity of each mutant protein was analyzed by 12% SDS PAGE.

(49) To determine the binding activity of each mutant protein, 400 ng/100 microL of human ENO1 protein or mutated ENO1 protein was coated on a 96-well ELISA plate overnight at 4 C. and the plate was washed with PBS. The plate was blocked with 1% BSA (w/v) in PBS at room temperature for 1 hour, then washed again with 1 PBS. A primary antibody (EN10 mAb) was 2-fold serial diluted to 15 different concentrations and added to the plate at 37 C. for 1 hour. After the reaction was complete, the plate was washed 3 times with 1 PBS. A 1/8000 dilution of goat anti-mouse-HRP antibody was added and incubated at 37 C. for 1 hour, then the plate washed 3 times with 1 PBS. Then, TMB substrate was added and the reaction was allowed to proceed at room temperature for 30 minutes. The reaction was stopped by adding 1N HCl and OD 450 was read to determine the activity. Each study was repeated three times. Data are presented as meanSD. OD readings and concentrations of antibody were used to make a multiple scatter plot using Sigmaplot. The K.sub.d values were predicted by four parameter logistic fit.

(50) According to the ENO1 large portion deletion study results shown in Example 6, a peptide sequence .sup.296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS.sup.336 (SEQ ID NO:39) from the residue number 296 to 336 is required for tight binding of ENO1 protein with EN10 mAb. Tight binding as used herein refers to binding between a specific binding agent (e.g., an antibody, an scFv or Fab fragment) and a ligand/target (e.g., a peptide, protein, or cell) with a dissociation constant (K.sub.d) of 10 nM or lower, preferably 1.0 nM or lower.

(51) The above deletion experiments identify residues 296 to 336 on ENO1 as the region for the antibody binding. To further characterize the actual binding sites (e.g., eptitopes), the crystal structure of ENO1 was downloaded from protein data bank (pdb-entry: 2PSN) to analyze residue positions from this region. There are eleven amino acid residues including D300, W301, G302, Q305, K306, A309, K326, K330, N333, E334, and K335 exposed on the protein surface (FIG. 6A, putative epitope). By site-direct mutagenesis, these 11 amino acids were mutated and resulting mutant proteins were expressed in E. coli and purified, respectively (FIG. 7B). Every purified ENO1 mutant protein was analyzed for any K.sub.d changes (as compared with END 1 binding) using ELISA.

(52) The results indicate that there are three functional classes of amino acid residues in these mutants. Amino acid residues W301 and K330 are important for the binding between ENO1 protein and EN10 mAb. If these two amino acid residue are mutated to alanine, respectively, the binding activities of these two ENO1 mutants to EN10 mAb are significantly abolished. The second class of amino acid residues includes A309, E334, K335 and D300. If E334, K335 and D300 are mutated to alanine or the A309 is mutated to glycine, respectively, the binding activities of these ENO1 mutants to EN10 mAb are compromised. The rest of amino acid residues including G302, Q305, K306, N333, and K326 belong to the group of amino acids residues that have no significant binding effects on ENO1 protein binding to EN10 mAb (FIG. 7C and Table II). These results suggest that W301, K330 A309, E334, K335 and D300 are important for the protein-protein binding between ENO1 and EN10 mAb. These amino acid residues belong to sequences of ENO1 peptide 1, .sup.296FD Q D D W G A W Q K F TA.sup.309 (FIG. 7D, SEQ ID NO:40) and peptide 2, .sup.326 K R I A K A V N EK S.sup.336 (FIG. 7D, SEQ ID NO:41), which may be the binding epitopes of EN10 mAb in the amino residue number from 296 to 335 (FIG. 7D; SEQ ID NO:39) of human ENO1.

(53) TABLE-US-00002 TABLE II Mutant K.sub.d Values Mutant KD Mutant KD Mutant KD Wild type 4.43 0.65 10.sup.10 A300 6.33 2.57 10.sup.8 A301 Non-detected A302 3.45 0.28 10.sup.10 A305 3.31 0.50 10.sup.10 A306 4.65 2.42 10.sup.10 A309 5.63 2.67 10.sup.9 A326 7.87 1.35 10.sup.10 A330 Non-detected A333 4.13 1.09 10.sup.10 A334 1.07 4.39 10.sup.7 A335 9.57 3.72 10.sup.9

Example 8

(54) The results from Examples 3 and 4 suggest that EN10 mAb can compromise the ENO1 plasminogen receptor activity. This reduction of ENO1 plasminogen receptor activity in turn inhibits the activation of plasminogen, resulting in the alleviation of the invasion capability of activated U937 monocytes. This result is further supported by literature reports indicating that monocytes of plasminogen-null mice lose the migration capability and infiltration activity in a mouse non-infectious inflammation model (Ploplis, V. A. et al., (1998), Blood, 91:2005-2009).

(55) To prove the efficacy of EN10 mAb on the inhibition of leukocyte infiltration in vivo, a mouse non-infectious inflammation (NII) model was used for the study. Twelve mice were divided into 4 groups with three mice in each group. On day one, each group was given PBS, 6 mg/kg body weight (mpk) of Enbrel, 10 mpk of mouse IgG, and 10 mpk of EN 10 mAb (ip), respectively. Two hours later, each mouse was injected with 200 microgram of casein (ip). Mice were kept at 25 C. for 12 hours. Mice were then treated with the same dose of the same drug, followed with 200 microgram of casein after two hours, respectively. Three hours latter, mouse peritoneum was opened and fluid was collected. Total peritoneum cells of each group were counted. To identify the cell population distribution of monocytes and neutrophils, peritoneum fluid cells of each group were stained with rat 1A8 antibody for neutrophils and rat anti BR1 for monocytes, visualized with FITC-conjugated goat anti-rat IgG (Jackson Lab), and analyzed with FACScan flow cytometer (Becton Dickinson). Data are presented as meanSEM. The T-test was used to compare each group. P values <0.05 were considered statistically significant.

(56) Results from this study are shown in FIG. 8A and FIG. 8B. Average total cell counts of mice treated with 6 mpk of Enbrel, vehicle, and 10 mpk of control IgG are 1.50.110.sup.7 (N=3), 1.810.sup.7, and 40.510.sup.7 (N=3) in the peritoneum, respectively. However, when the same casein treated mice are given 10 mpk of EN10 mAb, the average cell counts in the peritoneum is 51.210.sup.6 (N=3), which is significantly lower than those of Enbrel, vehicle, and the control IgG groups. No significant difference was found between the 10 mpk of EN10 mAb treated group and the nave group (3.91.210.sup.6 (N=3)) (FIG. 8A)

(57) When the cell populations in the peritoneum were analyzed, neutrophils accounts for about 73% to 85% of the total cells in the peritoneum and no significant difference was found between each group (except the nave treatment group) in this study (FIG. 8B). This result implies that EN10 mAb can compromise the ENO1 plasminogen receptor activity, which in turn as the plasminogen-null mice decreases plasminogen activation in the tissue and prevents inflammatory cells (for example, neutrophils) from infiltrating to affected sites. Therefore, targeting ENO1 plasminogen receptor with ENO1 antibody has potential applications in the therapy of immune diseases.

Example 9

(58) Recent literature reports indicate that monocyte infiltration is very important in the disease progression of multiple sclerosis in an EAE animal model. Based on the data in Example 8, it was hypothesized that comprising ENO1 plasminogen receptor activity by anti-ENO1 antibody will ameliorate multiple sclerosis symptoms of EAE in an animal model. Twelve seven to 10-week-old female CB57/BL/6 mice were provided subcutaneously with 100 microgram of MOG p35-55 in Freud's complete adjuvant, and then 100 ng of pertussis toxin was injected intra-peritoneally. Mice were randomly divided into two groups with 6 mice in each group. On the second day, each group of mice was subcutaneously injected with 200 microliter of 10 mpk of EN10 mAb and mouse IgG, respectively. On the third day, the other dose of 100 ng of pertussis toxin was administered intra-peritoneally. Animals were observed daily and clinical symptoms were assessed as follows: 0, no sign; 1, decreased tail tone; 2, mild monoparesis or paraesis; 3, severe paraparesis; 4, paraplegia and or quadraparesis; 5 moribund or death. All studies were performed in accordance with the guidelines prescribed by the Animal Care and Use committee at the Development center for Biotechnology, Taiwan.

(59) The results are shown in the FIG. 9. Each group of mice started to show the EAE syndromes on day 7, and there were no significant difference in clinical scores between the two groups from days 7 to day 12. In the EN10 mAb treatment group, mice reach the disease plateau on the day 13 with an average maxima clinical score of about 2.7032 (N=6). Then, mice entered the remission phase of EAE until day 28, at which time the study was terminated. In contrast, mice treated with the mouse IgG reach the disease plateau on the day 16 with an average maxima clinical score of about 3.30.21 (N=6). Then, these mice started to enter the remission stage. At the end of study both groups have the same average clinical scores.

(60) This study indicates that mouse treated with ENO1 antibody has a lower maxima clinical score of about 0.6 point on average, when compared with the IgG treatment mice. These data suggest that inhibition of ENO1 plasminogen receptor activity by antibody confers clinical benefits in the EAE mouse prophylactic model.

Example 10

(61) In Example 9, the result indicates that administration of ENO1 antibody confers clinical benefits in the EAE mouse prophylactic model. To explore the therapeutic effects of EN10 mAb on MS, a mouse EAE therapeutic model was used in the next study. 28 seven-to 10-week-old female CB57/BL/6 mice were provided subcutaneously with 100 microgram of MOG p35-55 in Freud's complete adjuvant, and then 100 ng of pertussis toxin was injected intra-peritoneally. On the third day, another dose of 100 ng of pertussis toxin was administered. Animals were observed daily and the clinical symptoms were assessed as follows: 0, no sign; 1, decreased tail tone; 2, mild monoparesis or paraesis; 3, severe paraparesis; 4, paraplegia and or quadraparesis; 5 moribund or death. Until about day 10, at which time the average clinical score of mice was about 0.5, mice were randomly divided into 4 groups with 7 mice in each group. On days 11, 13, and 15, mice of group 1 were injected with 5 mpk of EN10 mAb intra-peritoneally. Mice of group 2 were fed daily with 15 mpk dimethyl fumarate (DMF) twice per day after day 11. Mice of group 3 were treated as those of the group 2, except that these mice were injected with 5 mpk of EN10 mAb intra-peritoneally on days 11, 13, and 15. The group 4 was the control group injected with vehicle; these mice were injected with PBS intra-peritoneally daily.

(62) At the end of the study, the three mice with close to the average maxima clinical scores from each group were collected, and their whole bodies were perfused with the Bouin's solution. The brains and spinal cords of these mice were fixed with 10% formalin, sectioned and stained with Luxol fast blue, as well as hematoxylin and eosin (H&E). Histopathology scores of meningeal and parenchymal inflammatory lesions of demyelination were evaluated by a pathologist based on the Shackelford score method (Toxicologic Pathology, Vol 30, No 1, pp 93-96, 2002) as follows: 1, minimal; 2, slight; 3, moderate; 4, moderate/severe; 5, severe/high. Data are presented as meanSEM. The T-test was used to compare each groups. P values <0.05 were considered statistically significant. All studies were performed in accordance with guidelines prescribed by the Animal Care and Use committee at the Development Center for Biotechnology, Taiwan.

(63) The results are shown in the Hers. 10A, 10B, 10C, and 10D. Each group of mice started to show the EAE syndromes on day 10, and at that time the average clinical score was about 0.5. After mice started to receive testing drugs on day 11, mice administered with 5 mpk EN10 mAb, 15 mpk DMF twice per day, and EN10 mAb and DMF combination, respectively, began to show slowdown in the onset of EAE syndromes. Mice in every group reach the disease plateau around day 27. At that time, the average maxima clinical scores of vehicle, 5 mpk EN10 mAb, 15 mpk DMF twice per day, and EN10 mAb and DMF combination groups are 4.10.34 (N=7), 2.90.16 (N=7), 2.70.47 (N=7), and 2.40.39 (N=7), respectively (FIG. 10A). The study was terminated on day 32, and 3 mice in the vehicle group died due to progression of the disease in the study period. There was no statistical difference in the average maxima clinical scores in each group, even though mice treated with 5 mpk EN10 mAb, 15 mpk DMF twice per day, and EN 10 mAb and DMF combination showed benefits of the treatments, as evidenced in the decrease in average maxima clinical scores, about 1.2, 1.4, and 1.7, respectively, as compared to that of the vehicle group.

(64) These results indicate that inhibition of ENO1 plasminogen receptor activity by antibody showed clinical benefits in the mouse EAE therapeutic model, and three doses of 5 mpk EN10 mAb has similar efficacy as 15 mpk of DMF twice daily. Some synergistic effects were seen in the EN10 mAb and DMF combination treatment group (FIGS. 10A-10D).

(65) To study the EAE disease benefits of mice treated with EN10 mAb and DMF, the histopathology incidences of these mouse CNS sections were further analyzed. The items analyzed include total clinical histpathology, demyelination and inflammatory scores of CNS and the tissues examined include cerebrum, cerebellum, medulla, cervical vertebrae, thoracic vertebrae, lumbar vertebrae, and sacrum. The results are shown in the FIGS. 10B, 10C, and 10D.

(66) The average total histopathology incidence scores of mice of the vehicle, 5 mpk EN10 mAb, 15 mpk DMF twice per day, and EN10 mAb and DMF combination groups are 40.77.1 (N=3), 154.4 (N=3), 285.2 (N=3), and 1311.7 (N=3), respectively. Mice in the EN10 mAb treatment group and EN10 mAb and DMF combination treatment group showed statistical difference in the average total histopathology incidence scores per mice, as compared to that of the vehicle group, with P values of 0.025 and 0.004, respectively (FIG. 10B). This result indicates that mice treated with EN10 mAb, or EN10 mAb and DMF combination have total pathology and lesions benefits on the CNS of EAE disease. When the demyelination scores of CNS were compared, results are shown in the FIG. 10C. The average total demyelination scores per mice in CNS of the vehicle, 5 mpk EN10 mAb, 15 mpk DMF twice per day, and EN10 mAb and DMF combination groups are 131.8 (N=3), 4.30.7 (N=3), 71.0 (N=3), and 32.3 (N=3), respectively. All of drug treatment groups show statistic difference in the average total demyelination incidence scores per mice in CNS, as compared to that of the vehicle group, with P values of 0.01 for the EN10 mAb group, 0.04 for the DMF group and 0.04 for the combination treatment group, respectively. This result indicates that mice treated with EN10 mAb, or DMF, or EN10 mAb and DMF combination are protected, by the drugs tested in this study, from the CNS demyelination damages in the EAE disease course. This study is further supported by literature reports that DMF has neuron protection effects on MS patients (Moharregh-Khiabani, D. et al., (2009), Current Neuropharmacology, 7:60-64; Oh, C. J. (2012) et al., PLoS ONE, 7:1-10). Three doses of 5 mpk EN10 mAb in the disease course have better efficacy than that of 30 mpk DMF daily.

(67) Leukocyte infiltration incidence score in CNS is the other parameter examined. The results are shown in FIG. 10D. The average total inflammation score per mice in CNS of the vehicle, 5 mpk EN10 mAb, 15 mpk DMF twice per day, and EN10 mAb and DMF combination groups are 10.31.18 (N=3), 6.30.9 (N=3), 91.0 (N=3), and 2.71.3 (N=3), respectively. Mice in the EN10 mAb treatment group and the EN10 mAb and DMF combination group show statistical difference in the average total inflammation score per mice in CNS, as compared to that of the vehicle group, with P values of 0.05 and 0.01, respectively (FIG. 10D). However, DMF seems to have no statistical effects in preventing inflammatory cells from entering the affected CNS sites. This result suggests that EN10 mAb or EN10 Mb combined with DMF is able to prevent leukocytes from infiltrating the CNS, thereby decreasing the pathology incidences in the CNS, more importantly to ameliorate the demyelination of CNS neuron on MS symptoms.

Example 11

(68) Bae's (Bae, S. et al. (2013) J. Immunology. 189:365-372) result shows that the activation of ENO1 plasminogen receptor activity on the surface of monocytes increases pro-inflammatory cytokines, for example TNF and IL, in the Rheumatoid arthritis (RA) patient's PBMC and results in the exacerbation of diseases. When the epitope of antibody used by Bae's study is compared with EN10 mAb, we found that EN10 mAb binds to a different epitope from that of Bae's study. The epitope of anti human ENO1 used in Bae's study locates at N-terminal and center part of ENO1 protein. However, the epitope of EN10 mAb is at amino acid residues from 296 to 336. Two antibodies show the different plasminogen receptor agonist discrepancy. The antibody used in Bae's study displays the agonist activity, which activates the plasminogen receptor activity of ENO1. However, EN10 mAb shows antagonist activity when the antibody was administrated in the stimulated human monocytes. This study supports our MS results in Examples 8, 9, and 10 and Presslor' study in the lung inflammatory model that down-regulating of ENO1 plasminogen receptor activity on monocytes prevents activated monocytes from infiltrating to the inflammation sites. Both results suggest that the therapeutic effect of ENO1 antibodies in immune diseases is epitope-dependent and some of ENO1 antibodies, such as the one used in Bae's study, may result in the exacerbation of diseases. To confirm our EN10 mAb efficacy in RA, a study was performed using a collagen antibody-induced arthritis rodent model. Six week-old Balb/c male mice were injected with 1.5 mg/mice of mouse monoclonal anti-type II collagen intravenously. Four days later, mice were treated with 50 microgram/mice of LPS (E. coli 0111B4) intra-peritoneally. Mice were divided into 3 groups with three mice in each group. Each group was treated with 5 mpk of mouse IgG, 5 mpk of EN10 mAb, and 6 mpK of Enbrel, respectively, on days 1, 3, 5, and 7. Animals were observed daily and clinical symptoms were assessed as follows: body weight (everyday), footpad thickness (day 1, 3, 7, and 10), arthritis score (day 3, 7, and 10), pathology (day 10), and cytokines (ELISA). Data are presented as meanSEM. ANOVA followed by Newman-Keuls multiple comparison test was used to compare three or more groups. P values <0.05 were considered statistically significant. All studies were performed in accordance with the guidelines prescribed by the Animal Care and Use committee at the Development center for Biotechnology, Taiwan. For the cytokine analysis, knees were opened, and synovial fluid was washed with PBS and collected. The cytokine concentrations were analyzed with a Cytokine ELISA kit

(69) The result shows in the FIG. 11A. On the day 7 the average arthritis scores of 10 mpK of EN10 mAb, 6 mpk of Enbrel, and vehicle groups are 100.54 (N=3), 120.8 (N=3) and 120.3 (N=3), respectively. The average arthritis score of mice treated with EN10 mAb is statistically different from that of the vehicle group with a P value of 0.0001. On the day 10, the average arthritis scores of 10 mpK of EN10 mAb, 6 mpk of Enbrel and vehicle groups are 8.90.53 (N=3), 7.20.8 (N=3) and 11.70.3 (N=3), respectively. The average arthritis score of mice treated with EN10 mAb and 6 mpk of Enbrel are statistically different from that of the vehicle group with a P value of less than 0.0001 (FIG. 11A). The results from this study indicate that compromising ENO1 plasminogen receptor activity with EN 10 mAb reduced the symptoms of RA in the CAIA rodent model. When the IL1b and MMP9 cytokines were analyzed in the synovial fluid of CAIA mice, the average MMP9 concentrations of the EN10 mAb treated, Enbrel treated, and vehicle groups are 62.55, 349.4, and 92.511.25 ng/ml (N=3). For the IL1b cytokine, the average concentrations of the EN10 mAb treated, Enbrel treated, and vehicle groups are 9115.8, 68.931, and 115.620 pg/ml (N=3), respectively. Both cytokines are down-regulated in the EN10 mAb and Enbrel treated groups. Based on the results shown in FIGS. 11A, 11B and 11C, it can be concluded that in both cases, three doses of 10 mpk EN 10 mAb and Enbel have therapeutic effects in the reduction of the symptoms of RA.

Example 12

(70) Result from examples 9, 10, and 11 suggest that compromising ENO1 activity by an ENO1 antagonist antibody alleviates the syndromes of MS and Rheumatoid arthritis in mouse EAE and CAIA models.

(71) We hypothesize that the similar epitope of mouse ENO1 is effective on similar mouse auto immune diseases. 10 mg of mouse ENO1 protein was contracted to generate rat anti mouse ENO1 antibody by Genescript Inc. (Piscataway, N.J., USA). To screen for hybridomas that secreted rat anti mouse ENO1 antibody, four hundred nanogram of mouse ENO1 protein was coated on a 96-well ELISA plate, and the plate was further washed with PBS. Serial dilutions from each hybridoma supernatant were added to the plate, and the plate was incubated at 37 C. for 1 hour. A goat anti-rat IgG conjugated with hypoxanthine phosphoribosyltransferase assay (HPRT) was added. After 1 hour, 3,3,5,5-Tetramethylbenzidine (TMB) was added and OD405 was read. 75 positive clones out of 30,000 hybridomas with significant mouse ENO1 binding affinities were further subjected to do the EN10 mAb competition assay (FIG. 12A). An ELISA plate coated with mouse ENO1 protein was used to bind the individual supernatants (about 100 micro liter) of positive hybridomas clones. After the plate was washed trice with PBS, 100 nanogram of EN10 mAb was added to the plate, and the plate was incubated at 37.sup.0c for one hour. A goat anti-rat IgG conjugated with hypoxanthine phosphoribosyltransferase assay (HPRT) was added. After 1 hour, 3,3,5,5-Tetramethylbenzidine (TMB) was added and OD405 was read. The result shows in the FIG. 12B. Only 5 of 75 hybridoma supernatants have mouse ENO1 binding activities competed by EN10 mAb. This result suggests that these 5 rat anti mouse ENO1 antibodies may have the similar epitope in the mouse ENO1 to that of EN10 mAb in the human ENO1.

Example 13

(72) To evaluate the mouse ENO1 binding affinity of 5 anti-mouse ENO1 antibodies, the hybridomas were grown in 25 ml of SFM medium (Gibco Inc). After one week culture, individual supernatant was collected. The antibody was further purified by 40% ammonium sulfate and Protein A column (Montage antibody purification kit Millipore). The purified antibody was concentrated with an Amicon Ultra-15 centrifugal filter device, following the protocols provided by the manufacturer (Millpore Inc).

(73) Four hundred nanogram of mouse ENO1 protein was coated on a 96-well ELISA plate, and the plate was further washed with PBS. Serial dilutions from 110.sup.12 to 110.sup.8 M of individual antibody were added to the plate, and the plate was incubated at 370 C for 1 hour. A goat anti-rat IgG conjugated with hypoxanthine phosphoribosyltransferase (HPRT) was added. After 1 hour, 3,3,5,5-Tetramethylbenzidine (TMB) was added and OD405 was read. Every study was repeated three times. Data were presented as meanSD. OD readings and concentrations of antibodies were used to make a multiple scatter plot using Sigmaplot. The Kd values were predicted by four parameter logistic fit.

(74) The results of this experiment are shown in FIG. 13. The Kd value of individual antibodies range from 3.900.6610.sup.10M (N=3) to 3.391.8910.sup.8 M (N=3). Due to the low productivity of clone 12D9, 7E5 was chosen to do the further study.

Example 14

(75) In Examples 9 and 10, the result indicates that administration of ENO1 antibody confers clinical benefits in the EAE mouse prophylactic and therapeutic models. To explore whether 7E5 has the similar therapeutic effects of EN10 mAb on MS, a mouse EAE therapeutic model was used in the next study. 18 seven-to-10-week-old female CB57/BL/6 mice were provided subcutaneously with 100 microgram of MOG p35-55 in Freud's complete adjuvant, and then 100 ng of pertussis toxin was injected intra-peritoneally. On the third day, another dose of 100 ng of pertussis toxin was administered. Animals were observed daily and the clinical symptoms were assessed as follows: 0, no sign; 1, decreased tail tone; 2, mild monoparesis or paraesis; 3, severe paraparesis; 4, paraplegia and or quadraparesis; 5 moribund or death. Until about day 10, at which time the average clinical score of mice was about 0.5, mice were randomly divided into 3 groups with 6 mice in each group. On days 11, 13, and 15, mice of group 1 were injected with 5 mpk of 7E5 mAb subcutaneously. Mice of group 2 were injected with 20000 units of Betaferon subcutaneously. The group 3 was the control group injected with PBS vehicle subcutaneously.

(76) At the end of the study, the three mice with close to the average maxima clinical scores from each group were collected, and their whole bodies were perfused with the Bouin's solution. The brains and spinal cords of these mice were fixed with 10% formalin, sectioned and stained with Luxol fast blue, as well as hematoxylin and eosin (H&E). Histopathology scores of meningeal and parenchymal inflammatory lesions of demyelination were evaluated by a pathologist based on the Shackelford score method (Toxicologic Pathology, Vol 30, No 1, pp 93-96, 2002) as follows: 1, minimal; 2, slight; 3, moderate; 4, moderate/severe; 5, severe/high. Data are presented as meanSEM. The T-test was used to compare each groups. P values <0.05 were considered statistically significant. All studies were performed in accordance with guidelines prescribed by the Animal Care and Use committee at the Development Center for Biotechnology, Taiwan.

(77) The results are shown in the FIGS. 14A, 14B, 14C, and 14D. Each group of mice started to show the EAE syndromes on day 10, and at that time the average clinical score was about 0.5. After mice started to receive testing drugs on day 11, mice administered with 5 mpk 7E5 mAb, and 20000 units of Betaferon, respectively, began to show slowdown in the onset of EAE syndromes. Mice in every group reach the disease plateau around day 27. At that time, the average maxima clinical scores of vehicle, 5 mpk 7E5 mAb, and 20000 units of Betaferon groups are 2.60.9 (N=6), 1.60.5 (N=6), and 2.10.4 (N=6), respectively (FIG. 14A). There was no statistical difference in the average maxima clinical scores in each group, even though mice treated with 7E5 mAb, and 20000 units of Betaferon showed benefits of the treatments, as evidenced in the decrease in average maxima clinical scores, about 1.0, and 0.5, respectively, as compared to that of the vehicle group. These results indicate that 7E5 antibody has the similar inhibition of ENO1 plasminogen receptor activity as that of EN 10 mAb showed clinical benefits in the mouse EAE therapeutic model, even though they bind to different species of ENO1 with similar epitope.

(78) To study the EAE disease benefits of mice treated with 7E5 mAb and Betaferon, the histopathology incidences of these mouse CNS sections were further analyzed. The items analyzed include total clinical histpathology, demyelination and inflammatory scores of CNS and the tissues examined include cerebrum, cerebellum, medulla, cervical vertebrae, thoracic vertebrae, lumbar vertebrae, and sacrum. The results are shown in the FIGS. 14B, 14C, and 14D.

(79) The average total histopathology incidence scores of mice of the vehicle, 5 mpk 7E5 mAb, and 20000 units of Betaferon groups are 40.76.8 (N=3), 14.79. (N=3), and 41.83.4 (N=3), respectively. Mice in the 7E5 mAb treatment group showed statistical difference in the average total histopathology incidence scores per mice, as compared to that of the vehicle group, with P values of 0.025 (FIG. 14B). This result indicates that mice treated with 7E5 mAb have total pathology and lesions benefits on the CNS of EAE disease. When the demyelination scores of CNS were compared, results are shown in the FIG. 14C. The average total demyelination scores per mice in CNS of the vehicle, 5 mpk 7E5 mAb, and 20000 units of Betaferon groups are 12.20.8 (N=3), 5.11.4 (N=3) and 9.11.1(N=3), respectively. The 7E5 mAb group shows statistic difference in the average total demyelination incidence scores per mice in CNS, as compared to that of the vehicle group, with P values of 0.01. This result indicates that mice treated with 7E5 mAb are protected, by the drugs tested in this study, from the CNS demyelination damages in the EAE disease course.

(80) Leukocyte infiltration incidence score in CNS is the other parameter examined. The results are shown in FIG. 14D. The average total inflammation score per mice in CNS of the vehicle, 5 mpk 7E5 mAb, and 20000 units of Betaferon groups are 10.1.9 (N=3), 4.62.7 (N=3), and 9.22.6 (N=3), respectively. Mice in the 7E5 mAb treatment group shows statistical difference in the average total inflammation score per mice in CNS, as compared to that of the vehicle group, with P values of 0.05 (FIG. 14D). However, Betaferon seems to have no statistical effects in preventing inflammatory cells from entering the affected CNS sites. This result suggests that the same as EN10 mAb 7E5 mAb is able to prevent leukocytes from infiltrating the CNS, thereby decreasing the pathology incidences in the CNS, more importantly to ameliorate the demyelination of CNS neuron on MS symptoms. Our results suggests that the peptide region of human ENO1 from amino acid number 296 to 336 (SEQ ID NO:39) including peptide sequences FDQDDWGA WQKFTA (SEQ ID NO:40) and KRIAKAVNEKS (SEQ ID NO:41) are very important for an antibody to inhibit the plasminogen receptor activity and as a therapeutic agent to treat immune monocyte relative immune diseases, even in the mice the MOA is effective.

(81) Results from Examples 9, 10 11 and 14 indicate that inhibition of ENO1 plasminogen receptor activity by ENO1 antibodies, regardless species, can decrease plasminogen activation, inhibit the UPAS cascade, and reduce the degradation of extracellular matrix activity. As a result, infiltration of inflammatory monocytes to damage affected cells is inhibited, and this inhibition ameliorates the symptoms of inflammations in NII, MS in EAE, and RA in CAIA models. Therefore, targeting ENO1 plasminogen receptor on the surface of activated cells (such as monocytes) can be used to treat inflammatory diseases, and the ENO1 antibody against the peptide region of human ENO1 from amino acid number 296 to 336 (SEQ ID NO:39) including peptide sequences FDQDDWGA WQKFTA (SEQ ID NO:40) and KRIAKAVNEKS (SEQ ID NO:41) is useful as a therapeutic drug for the immune disease patients.

(82) While the invention has been described with respect to a limited number of embodiments, those skilled in the art, having benefit of this disclosure, will appreciate that other embodiments can be devised which do not depart from the scope of the invention as disclosed herein. Accordingly, the scope of the invention should be limited only by the attached claims.