RECOMBINANT FUSION PROTEINS TARGETING CD47 AND PD-L1, PREPARATION AND USE THEREOF

20230083670 · 2023-03-16

    Inventors

    Cpc classification

    International classification

    Abstract

    The present application provides a recombinant fusion protein containing an anti-PD-L1 antibody or an antibody fragment thereof, with each paratope of the anti-PD-L1 antibody or antibody fragment thereof linked via a linker to an extracellular Ig-like domain of a signal-regulatory protein (SIRP) at N-terminus of a heavy chain variable region or a light chain variable region constituting the paratope, wherein the recombinant fusion protein can bind to CD47, PD-L1 and FcR simultaneously. The present application also provides a nucleic acid molecule encoding the recombinant fusion protein, an expression vector containing the nucleic acid molecule, a method for producing the recombinant fusion protein and a method for treating a disease associated with over-expression of CD47 and/or PD-L1 using the recombinant fusion protein.

    Claims

    1. (canceled)

    2. (canceled)

    3. (canceled)

    4. The recombinant fusion protein of claim 19, wherein the anti-PD-L1 antibody or antibody fragment thereof is linked to the CD47 binding peptide at the N-terminus of the heavy chain variable region.

    5. The recombinant fusion protein of claim 19, wherein each paratope of the anti-PD-L1 antibody or antibody fragment thereof is linked to the CD47 binding peptide at N-terminus of the light chain variable region constituting the paratope.

    6. The recombinant fusion protein of claim 19, wherein the anti-PD-L1 antibody or antibody fragment thereof is linked to the CD47 binding peptide via a linker.

    7. The recombinant fusion protein of claim 6, wherein the linker is (SEQ ID NO: 4).

    8. The recombinant fusion protein of claim 4, comprising SEQ ID NO: 10.

    9. The recombinant fusion protein of claim 4, further comprising SEQ ID NO: 8.

    10. The recombinant fusion protein of claim 5, further comprising a light chain constant region linked to the light chain variable region, wherein the recombinant fusion protein comprises an anti-PD-L1 heavy chain variable region-heavy chain constant region fragment comprising SEQ ID NO: 6, and a CD47 binding peptide-linker-anti-PD-L1 light chain variable region-light chain constant region fragment having an amino acid sequence comprising SEQ ID NO: 16.

    11. The recombinant fusion protein of claim 19, wherein the heavy chain constant region comprising SEQ ID NO: 21.

    12. An isolated nucleic acid molecule encoding the recombinant fusion protein of claim 19.

    13. An isolated expression vector comprising the nucleic acid molecule of claim 12.

    14. An isolated host cell comprising the expression vector of claim 13.

    15. A pharmaceutical composition, comprising the recombinant fusion protein of claim 19, and at least one pharmaceutically acceptable excipient.

    16. The pharmaceutical composition of claim 15, further comprising at least one pharmaceutically acceptable adjuvant.

    17. A method for treating a disease associated with target cells that are double positive for CD47 and PD-L1 in a subject in need thereof, wherein the disease is non-Hodgkin's lymphoma (NHL) or colon cancer, comprising administering to the subject the pharmaceutical composition of claim 15.

    18. (canceled)

    19. A recombinant fusion protein, comprising an anti-PD-L1 antibody or an antigen binding fragment thereof, and a CD47 binding peptide, wherein the anti-PD-L1 antibody or antibody fragment thereof is linked to the CD47 binding peptide at the N-terminus of the heavy chain variable region or the light chain variable region, wherein each of the anti-PD-L1 antibody or the antigen binding fragment thereof comprises SEQ ID NO: 19 and SEQ ID NO: 20, wherein the CD47 binding peptide comprises a signal-regulatory protein (SIRP) extracellular domain comprising SEQ ID NO: 2, wherein the recombinant fusion protein is capable of binding to CD47 and PD-L1 simultaneously.

    Description

    DESCRIPTION OF THE DRAWINGS

    [0035] The following detailed description, given by way of example, but not intended to limit the application solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings.

    [0036] FIGS. 1A and 1B are schematic diagrams of structures of the recombinant fusion proteins, IMM2520 and IMM2521, of the present application. The top circular domain represents mutated extracellular domain 1 of SIRP alpha protein (SIRPαD1), which is linked to the N terminus of the heavy chain (A) or the light chain (B) of an anti-PD-L1 antibody via a peptide linker. The mutated SIRPαD1 has the nucleic acid and amino acid sequences set forth in SEQ ID NO: 1 and SEQ ID NO: 2, respectively. The linker having the amino acid sequence of SEQ ID NO: 4 may be encoded by the nucleic acid sequence of SEQ ID NO: 3. The heavy chain of the anti-PD-L1 antibody has the nucleic acid and amino acid sequences set forth in SEQ ID NO: 5 and SEQ ID NO: 6, respectively. The light chain of the anti-PD-L1 antibody has the nucleic acid and amino acid sequences set forth in SEQ ID NO: 7 and SEQ ID NO: 8, respectively.

    [0037] FIG. 2 is a schematic diagram showing action mechanism of the recombinant fusion protein of the present application.

    [0038] FIG. 3 shows the binding activity of IMM2520 and IMM2521 to PD-L1 on CHO cells expressing human PD-L1 (CHO-PDL1). IMM2505 is a fusion protein described in U.S. Pat. No. 10,973,878 B2 that shares similar overall design with IMM2520 and IMM2521 and comprises the mutated SIRPαD1 (SEQ ID NO: 2) and a different anti-PD-L1 antibody. IMM2515 is an anti-PD-L1 antibody that constitutes IMM2520 and IMM2521 and comprises the heavy chain of SEQ ID NO: 6 and the light chain of SEQ ID NO: 8. Atezolizumab is a commercially available anti-PD-L1 antibody, and hIgG1-Fc was used as the negative control.

    [0039] FIG. 4 shows the binding activity of IMM2520 and IMM2521 to CD47 on Jurkat cells. IMM2505 is a fusion protein described in U.S. Pat. No. 10,973,878 B2 that shares similar overall design with IMM2520 and IMM2521 and comprises the mutated SIRPαD1 (SEQ ID NO: 2) and a different anti-PD-L1 antibody. IMM01 was described in US 2021/0024598 A1 and comprises two mutated SIRPαD1s (SEQ ID NO: 2) linked to an Fc dimer fragment, whose monomer has the nucleic acid and amino acid sequences of SEQ ID NO: 11 and SEQ ID NO: 12, respectively. The hIgG1-Fc was used as the negative control.

    [0040] FIGS. 5A and 5B shows the capability of IMM2520 and IMM2521 to block binding of PD-1-Fc to PD-L1 on CD47.sup.− CHO-PD-L1 cells (A) or CD47.sup.+ Raji-PD-L1 cells (B). IMM2515 is an anti-PD-L1 antibody that constitutes IMM2520 and IMM2521 and comprises the heavy chain of SEQ ID NO: 6 and the light chain of SEQ ID NO: 8. The hIgG1-Fc was used as the negative control.

    [0041] FIGS. 6A and 6B shows the capability of IMM2520 and IMM2521 to block binding of SIRPα-Fc with CD47 on PD-L1.sup.− Raji cells (A) or Raji-PD-L1 cells (B). IMM01 was described in US 2021/0024598 A1 and comprises two mutated SIRPαD1s (SEQ ID NO: 2) linked to an Fc dimer fragment, whose monomer has the nucleic acid and amino acid sequences of SEQ ID NO: 11 and SEQ ID NO: 12, respectively. The hIgG1-Fc was used as the negative control.

    [0042] FIG. 7 shows the capability of IMM2520 to induce antibody-dependent cellular cytotoxicity (ADCC) against Raji-PD-L1 cells. IMM2515 is an anti-PD-L1 antibody that constitutes IMM2520 and IMM2521 and comprises the heavy chain of SEQ ID NO: 6 and the light chain of SEQ ID NO: 8.

    [0043] FIG. 8 shows the capability of IMM2520 to induce antibody-dependent cellular phagocytosis (ADCP) against Raji-PD-L1 cells. IMM2515 is an anti-PD-L1 antibody that constitutes IMM2520 and IMM2521 and comprises the heavy chain of SEQ ID NO: 6 and the light chain of SEQ ID NO: 8. IMM01 was described in US 2021/0024598 A1 and comprises two mutated SIRPαD1s (SEQ ID NO: 2) linked to an Fc dimer fragment, whose monomer has the nucleic acid and amino acid sequences of SEQ ID NO: 11 and SEQ ID NO: 12, respectively. The hIgG1-Fc was used as the negative control.

    [0044] FIG. 9 shows in vivo anti-tumor efficacy of IMM2520 in syngeneic BALB/c-hPD1/hSIRPα mice bearing CT26-hPDL1hCD47 tumor. IMM01 was described in US 2021/0024598 A1 and comprises two mutated SIRPαD1s (SEQ ID NO: 2) linked to an Fc dimer fragment, whose monomer has the nucleic acid and amino acid sequences of SEQ ID NO: 11 and SEQ ID NO: 12, respectively. IMM2505 is a fusion protein described in U.S. Pat. No. 10,973,878 B2 that shares similar overall design with IMM2520 and IMM2521 and comprises the mutated SIRPαD1 (SEQ ID NO: 2) and a different anti-PD-L1 antibody.

    [0045] FIG. 10 shows mice treated with IMM2520 had superior survival rate over those treated with IMM2505. IMM2505 is a fusion protein described in U.S. Pat. No. 10,973,878 B2 that shares similar overall design with IMM2520 and IMM2521 and comprises the mutated SIRPαD1 (SEQ ID NO: 2) and a different anti-PD-L1 antibody.

    [0046] FIG. 11 shows the binding capability of IMM2520, when saturated with PD-L1 binding, to CD47.

    [0047] FIG. 12 shows the binding capability of IMM2520, when saturated with CD47 binding, to PD-L1.

    DETAILED DESCRIPTION OF THE APPLICATION

    [0048] There are principally three different approaches to targeting two or more pharmacological targets of tumor growth. Most commonly, patients can be given a cocktail of two or more different drugs. Although this option allows for maximal flexibility with respect to possible drug combinations and different dosages, it suffers from (a) potentially poor adherence to treatment by the patient because of the increased pill burden and the different dosing schedules for the individual drugs, (b) possible incompatibilities because of drug-drug interactions, and (c) increased risk of drug side effects. These problems can reduce the effectiveness of therapy and hamper the attainment of treatment goals particularly in the management of chronic diseases such as cancer.

    [0049] The second approach relies on the use of fixed-dose combinations of drugs in a single dosage form. This approach reduces pill burden, resulting in improved patient compliance. The disadvantage of fixed-dose combinations is primarily the limited choice of possible dose ratios between the active ingredients, which makes it more difficult to properly titrate the individual patient to maximum efficacy with minimal adverse effects. In addition, different pharmacokinetic properties of the components in the combination might lead to a complex temporal mismatch in pharmacodynamic effects at the individual targets thereby compromising overall efficacy.

    [0050] The third approach is the use of multifunctional drugs that combine two or more pharmacologies in a single compound. The design and validation of such multifunctional molecules are more complex and require substantial investigation into the optimal ratio of target activities in the molecule, but the unified pharmacokinetics may yield matched pharmacodynamic activities at the molecular targets. Multifunctional molecules may also be amenable to fixed dose combination with other drugs thereby combining three or even four pharmacologies in a single pill to produce further increments in efficacy.

    [0051] Through diligent experimentation, the present inventor has invented a novel recombinant multi-functional fusion protein, which can attack tumors, via three mechanisms of actions, one to release the check or inhibition on T cells by PD-1-mediated inhibitory signals, one to release the check on macrophages by SIRP-mediated inhibitory signals, another to stimulate cancer cell killings by NK cells and/or macrophages.

    [0052] The recombinant fusion protein of the present application comprises an anti-PD-L1 antibody or an antibody fragment thereof, with at least one paratope of the anti-PD-L1 antibody or antibody fragment linked via a linker to an extracellular Ig-like domain of a signal-regulatory protein (SIRP) at the N-terminus of a heavy chain variable region or a light chain variable region constituting the paratope. The recombinant protein can bind to CD47, PD-L1 and FcR simultaneously, i) blocking the interaction of PD-L1 on cancer cells with PD-1 on T cells and thus releasing the check on T cells by PD-1-mediated inhibitory signals; ii) blocking the interaction of CD47 on cancer cells with SIRPs on macrophages and thus releasing the check on macrophages by SIRP-mediated inhibitory signals; and iii) binding Fc portion of the antibody to FcRs on NK cells or macrophages to stimulate cancer cell killings by NK cells or macrophages. In an embodiment, one paratope of the anti-PD-L1 antibody is linked via a linker to an extracellular Ig-like domain of a signal-regulatory protein (SIRP) at the N-terminus of a heavy chain variable region or a light chain variable region constituting the paratope. In another embodiment, each paratope of the anti-PD-L1 antibody is linked via a linker to an extracellular Ig-like domain of a signal-regulatory protein (SIRP) at the N-terminus of a heavy chain variable region or a light chain variable region constituting the paratope. In one embodiment, each paratope of the anti-PD-L1 antibody is linked via a linker to an extracellular Ig-like domain of a signal-regulatory protein (SIRP) at the N-terminus of a heavy chain variable region constituting the paratope. In one embodiment, each paratope of the anti-PD-L1 antibody is linked via a linker to an extracellular Ig-like domain of a signal-regulatory protein (SIRP) at the N-terminus of a light chain variable region constituting the paratope. The recombinant fusion protein of the present application is small in size (150-180 kDa) and has a long half-life of 5-10 days.

    [0053] The three main components contained in the fusion protein of the present application are the extracellular Ig-like domain of a signal-regulatory protein (SIRP), the linker, and the anti-PD-L1 antibody. A person of ordinary skills in the art will recognize that there are many design choices for selecting the above three components. Preferably, human-derived sequence is used in human cancer therapies, as the strong immunogenicity of the proteins or peptides from non-human animals may lead to allergy and other adverse effects. However, other animal proteins or peptides, humanized if appropriate, may also be used in the present application based on different application purposes.

    [0054] Any extracellular Ig-like domain of any SIPR (SIRPα, SIRPβ, and SIRPγ) capable of binding with CD47 may be selected for construction of the fusion protein. In one embodiment, the signal-regulatory protein in the recombinant fusion protein is SIRPα, and the extracellular Ig-like domain of the signal-regulatory protein is the first extracellular Ig-like domain of SIRPα (SIRPαD1). In certain embodiments, SIRPαD1 is a SIRPαD1 mutant that contains an N.fwdarw.A mutation at position 80 of SEQ ID NO: 2 to remove a glycosylation site.

    [0055] In one embodiment, the recombinant fusion protein comprises SIRPαD1 having the nucleic acid and amino acid sequences set forth in SEQ ID NOs: 1 and 2, respectively. In another embodiment, the SIRPαD1 may comprise an amino acid sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity to SEQ ID NO: 2, wherein the SIRPαD1 can bind to CD47 on the cell surface of cancer/tumor cells and block the interaction of CD47 with SIRPs on the cell surfaces of macrophages.

    [0056] Linkers serve primarily as a spacer between the extracellular Ig-like domain of SIRP and the N-terminus of the heavy chain or light chain of an anti-PD-L1 antibody. The linker may be made up of amino acids linked together by peptide bonds, preferably from 5 to 30 amino acids, from 10 to 30 amino acids, from 10 to 20 amino acids, or 15 amino acids, linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. One or more of these amino acids may be glycosylated, as is understood by those of skill in the art. In one embodiment, the 5 to 30 amino acids may be selected from glycine, alanine, proline, asparagine, glutamine, serine and lysine. In one embodiment, a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine. Exemplary linkers are polyglycines (particularly (Glys, poly(Gly-Ala), and polyalanines. One exemplary suitable linker as shown in the Examples below is (Gly-Ser), such as -(Gly-Gly-Gly-Gly-Ser).sub.3- (SEQ ID NO: 4).

    [0057] Linkers may also be non-peptide linkers. For example, alkyl linkers such as —NH—, —(CH.sub.2)s-C(O)—, wherein s=2-20 can be used. These alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (e.g., C.sub.1-4) lower acyl, halogen (e.g., CI, Br), CN, NH.sub.2, phenyl, etc.

    [0058] In some embodiments, the anti-PD-L1 antibody is an isolated monoclonal antibody comprising two heavy chains each having an amino acid sequence of SEQ ID NO: 6, and two light chains each having an amino acid sequence of SEQ ID NO: 8, which two may be encoded by nucleic acid sequences of SEQ ID NOs: 5 and 7, respectively. The Fab portion (or paratope) of the anti-PD-L1 antibody can bind to PD-L1 on the cell surfaces of cancer/tumor cells to block the interaction of PD-L1 with PD-1 on the cell surfaces of T cells and thus release the check on T cells by PD-1-mediated inhibitory signals, while the Fc portion of the anti-PD-L1 antibody can bind to FcRs on the cell surfaces of NK cells or macrophages to stimulate cancer cell killings by the NK cells or macrophages. In some embodiments, the heavy chain may comprise an amino acid sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity to SEQ ID NO: 6, wherein the anti-PD-L1 antibody is able to bind to PD-L1 and block the interaction of PD-L1 with PD-1 on the cell surfaces of T cells, and is also able to bind to FcRs on the cell surfaces of NK cells or macrophages and thus activate the NK cells or macrophages for killing the cancer cells. In some embodiments, the light chain may comprise an amino acid sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity to SEQ ID NO: 8, wherein the anti-PD-L1 antibody is able to bind to PD-L1 and block the interaction of PD-L1 with PD-1 on the cell surfaces of T cells.

    [0059] The term “antibody” as referred to herein includes whole antibodies of e.g., IgG, IgA, IgD, IgE and IgM, and any antigen binding fragment (i.e., “antigen-binding portion”) or single chains thereof. Whole antibodies are glycoproteins comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant region. The light chain constant region is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system.

    [0060] The term “antibody fragment” herein refers to a portion or fragment of an anti-PD-L1 antibody of the disclosure that retains the ability to specifically bind to a PD-L1, and optionally the ability to bind Fc receptors.

    [0061] As used herein, “sequence identity” refers to the percent of nucleotides/amino acid residues in a subject sequence that are identical to nucleotides/amino acid residues in a reference sequence, after aligning the sequences and, if necessary, introducing gaps, to achieve the maximum percent sequence identity between the sequences. Pairwise and multiple sequence alignment for the purposes of determining percent sequence identity between two or more amino acid or nucleic acid sequences can be achieved in various ways known to a person of skill in the art, for instance, using the publicly available computer software such as ClustalOmega, T-coffee, Kalign and MAFFT. When using such softwares, the default parameters, e.g. for gap penalty and extension penalty, are preferably used.

    [0062] Also, the present application provides a polynucleotide molecule encoding the recombinant fusion protein and an expression vector expressing the recombinant bi-functional fusion protein. Examples of vectors include but are not limited to plasmids, viral vectors, yeast artificial chromosomes (YACs), bacterial artificial chromosomes (BACs), transformation-competent artificial chromosomes (TACs), mammalian artificial chromosomes (MACs) and human artificial episomal chromosomes (HAECs).

    [0063] The present application provides host cells comprising the above expression vectors. The host cells may be transformed or transfected with the expression vectors. Suitable host cells include Escherichia coli, yeasts and other eukaryotes. Preferably, Escherichia coli, yeast or mammalian cell lines (such as COS or CHO) are used.

    [0064] In another aspect, the present disclosure provides a pharmaceutical composition comprising the fusion protein of the present application formulated together with a pharmaceutically acceptable. The composition may optionally contain one or more additional pharmaceutically active ingredients, such as another antibody or a drug. The pharmaceutical compositions of the application also can be administered in a combination therapy with, for example, another immune-stimulatory agent, anti-cancer agent, an anti-viral agent, or a vaccine.

    [0065] The pharmaceutical composition can comprise any number of excipients. Excipients that can be used include carriers, surface active agents, thickening or emulsifying agents, solid binders, dispersion or suspension aids, solubilizers, colorants, flavoring agents, coatings, disintegrating agents, lubricants, sweeteners, preservatives, isotonic agents, and combinations thereof. The selection and use of suitable excipients are taught in Gennaro, ed., Remington: The Science and Practice of Pharmacy, 20th Ed. (Lippincott Williams & Wilkins 2003), the disclosure of which is incorporated herein by reference.

    [0066] The primary vehicle or carrier in a pharmaceutical composition may be either aqueous or non-aqueous in nature. For example, a suitable vehicle or carrier may be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in injection. For example, the vehicle or carrier may be neutral buffered saline or saline mixed with serum albumin. Other exemplary pharmaceutical compositions comprise Tris buffers, or acetate buffers, which may further include sorbitol or a suitable substitute thereof. In one embodiment of the present application, compositions may be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, the therapeutic composition may be formulated as a lyophilizate using appropriate excipients such as sucrose.

    [0067] Preferably, the pharmaceutical composition is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active molecule can be coated in a material to protect it from the action of acids and other natural conditions that may inactivate it. The phrase “parenteral administration” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion. Alternatively, an antibody of the application can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, e.g., intranasally, orally, vaginally, rectally, sublingually or topically.

    [0068] Pharmaceutical compositions can be in the form of sterile aqueous solutions or dispersions. They can also be formulated in a microemulsion, liposome, or other ordered structure suitable to high drug concentration.

    [0069] The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated and the particular mode of administration and will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01% to about 99% of active ingredient in combination with a pharmaceutically acceptable carrier.

    [0070] Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, several divided doses can be administered over time or the dose can be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. Alternatively, the fusion protein can be administered as a sustained release formulation, in which case less frequent administration is required.

    [0071] For administration of the fusion protein, the dosage ranges from about 0.0001 to 100 mg/kg of the host body weight. An exemplary treatment regime entails administration twice per week.

    [0072] A “therapeutically effective dosage” of a fusion protein of the application preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. For example, for the treatment of tumor-bearing subjects, a “therapeutically effective dosage” preferably inhibits tumor growth by at least about 40%, more preferably by at least about 60%, even more preferably by at least about 80%, and still more preferably by at least about 99% relative to untreated subjects. A therapeutically effective amount of a fusion protein of the present application can decrease tumor size, or otherwise ameliorate symptoms in a subject, which is typically a human or can be another mammal.

    [0073] The pharmaceutical composition can be a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.

    [0074] Therapeutic compositions can be administered via medical devices such as (1) needleless hypodermic injection devices (e.g., U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; and 4,596,556); (2) micro-infusion pumps (U.S. Pat. No. 4,487,603); (3) transdermal devices (U.S. Pat. No. 4,486,194); (4) infusion apparatuses (U.S. Pat. Nos. 4,447,233 and 4,447,224); and (5) osmotic devices (U.S. Pat. Nos. 4,439,196 and 4,475,196); the disclosures of which are incorporated herein by reference.

    [0075] In certain embodiments, the fusion protein of the application can be formulated to ensure proper distribution in vivo. For example, to ensure that the therapeutic fusion proteins of the application cross the blood-brain barrier, they can be formulated in liposomes, which may additionally comprise targeting moieties to enhance selective transport to specific cells or organs. See, e.g. U.S. Pat. Nos. 4,522,811; 5,374,548; 5,416,016; and 5,399,331.

    [0076] A gene therapy in vivo is also envisioned wherein a nucleic acid molecule encoding the recombinant fusion protein of the present application, or a derivative thereof is introduced directly into the subject. For example, a nucleic acid sequence encoding a recombinant fusion protein of the present application is introduced into target cells via local injection of a nucleic acid construct with or without an appropriate delivery vector, such as an adeno-associated virus vector. Alternative viral vectors include, but are not limited to, retroviruses, adenovirus, herpes simplex vims and papilloma virus vectors. Physical transfer of the virus vector may be achieved in vivo by local injection of the desired nucleic acid construct or other appropriate delivery vector containing the desired nucleic acid sequence, liposome-mediated transfer, direct injection (naked DNA), or microparticle bombardment (gene-gun).

    [0077] The compositions of the present disclosure may be used alone or in combination with other therapeutic agents to enhance their therapeutic effects or decrease potential side effects.

    [0078] Another object of the present application is to provide a method for preparing the above recombinant fusion protein and the pharmaceutical composition comprising the same. In one embodiment, the method comprises (1) providing a protein-encoding polynucleotide molecule; (2) constructing an expression vector comprising the polynucleotide molecule of (1); (3) transfecting or transforming suitable host cells with the expression vector of (2) and cultivating the host cells to express the protein; and (4) purifying the protein. The preparation may be carried out with well-known technologies by an ordinarily skilled artisan.

    [0079] Another object of the present application is to provide a method of treating cancer using the pharmaceutical composition of the present application, comprising administrating an effective amount of the aforementioned pharmaceutical composition to the patients or subjects in need thereof. In one embodiment, the pharmaceutical composition is used to treat CD47 and/or PD-L1-overexpressing tumors or cancers, including but not limited to acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphoblastic leukemia (ALL), non-hodgkins lymphoma (NHL), multiple myeloma (MM), bladder cancer, ovarian cancer, prostate cancer, lung cancer, colon cancer, breast cancer, pancreatic cancer and renal cancer.

    [0080] In one embodiment, the diseases related to over-expressions of CD47 and/or PD-L1 include, but are not limited to, Crohn's disease, allergic asthma, and rheumatoid arthritis.

    [0081] The present application is now further described with the non-limiting examples below.

    EXAMPLES

    [0082] The recombinant proteins described herein and below will be introduced first.

    [0083] IMM2515 is a monoclonal anti-PD-L1 antibody that comprises two heavy chains each having the amino acid sequence of SEQ ID NO: 6, and two light chains each having the amino acid sequence of SEQ ID NO: 8, which two may be encoded by nucleic acid sequences of SEQ ID NOs: 5 and 7, respectively.

    [0084] IMM01, as described in US 2021/0024598 A1, comprises two mutated SIRPαD1s (SEQ ID NO: 2) linked to an Fc dimer fragment, whose monomer has the nucleic acid and amino acid sequences of SEQ ID NO: 11 and SEQ ID NO: 12, respectively.

    [0085] IMM2520 is a recombinant fusion protein, containing two mutated SIRPαD1s each linked via a GS-linker, to IMM2515 at the N-terminus of each heavy chain, wherein the mutated SIRPαD1 has an nucleic acid sequence and amino acid sequence of SEQ ID NO: 1 and SEQ ID NO: 2, respectively, and the linker having an amino acid sequence of SEQ ID NO: 4 can be encoded by the nucleic acid sequence of SEQ ID NO: 3.

    [0086] IMM2521 is a recombinant fusion protein, containing two mutated SIRPαD1s each linked via a GS-linker, to IMM2515 at the N-terminus of each light chain, wherein the mutated SIRPαD1 has an nucleic acid sequence and amino acid sequence of SEQ ID NO: 1 and SEQ ID NO: 2, respectively, and the linker having an amino acid sequence of SEQ ID NO: 4 can be encoded by the nucleic acid sequence of SEQ ID NO: 3.

    [0087] IMM2505 is a fusion protein disclosed in U.S. Pat. No. 10,973,878 B2 that shares a similar overall design with IMM2520 and IMM2521, comprising the mutated SIRPαD1 (SEQ ID NO: 2) and a different anti-PD-L1 antibody.

    Example 1. Construction of Vectors Expressing IMM2520 and IMM2521

    [0088] The structures of IMM2520 and IMM2521 were shown in FIGS. 1A and 1B. Full length coding sequences of the recombinant fusion proteins IMM2520 and IMM2521 were designed artificially.

    [0089] Specifically, for the SIRPα Dl-linker-anti-PD-L1 heavy chain in IMM2520, the coding sequence of the mutated SIRPαD1 (SEQ ID NO: 1) was linked through a GS-linker coding sequence (SEQ ID NO: 3) to the 5′ end of the anti-PD-L1 heavy chain coding sequence of IMM2515 (SEQ ID NO:5); 57 nucleotides encoding the signal peptide of mouse IgG1 heavy chain (SEQ ID NO: 13) were added to the 5′ end of mutated SIRPα Dl-coding sequence, and a Kozak sequence (SEQ ID NO: 14) was added to the 5′ end of the signal peptide sequence. Lastly, HindIII and NheI restriction sites were added to the 5′ and 3′ ends of the resulting sequence, respectively. For the anti-PD-L1 light chain in IMM2520, the same signal peptide sequence as well as the Kozak sequence was added to the 5′ end of the anti-PD-L1 light chain coding sequence (SEQ ID NO: 7), and the HindIII and the XbaI restriction sites were added to the 5′ and 3′ ends of the resulting sequence, respectively.

    [0090] For the SIRPαD1-linker-anti-PD-L1 light chain in IMM2521, the coding sequence of the mutated SIRPαD1 (SEQ ID NO: 1) was linked through a GS-linker coding sequence (SEQ ID NO: 3) to the 5′ end of the anti-PD-L1 light chain coding sequence of IMM2515 (SEQ ID NO: 7). For the anti-PD-L1 heavy chain in IMM2521, the same signal peptide sequence as well as the Kozak sequence was added to the 5′ end of the anti-PD-L1 heavy chain coding sequence (SEQ ID NO: 5).

    [0091] The resulting sequences were synthesized by Genscript and subcloned, respectively, into the pMac-H and pMac-L vectors.

    Example 2. Protein Expression and Purification

    [0092] To manufacture the recombinant proteins IMM2520 and IMM2521, the expression vectors were electroporated into Chinese Hamster Ovary (CHO) cells (ATCC, Cat #CCL-61) which were subjected to several rounds of pressure selection of neomycin. The selected stable cells were adapted to a serum-free Balan CD CHO Growth A medium (Irvine Scientific, Cat #94120). For protein expression, cells were seeded in a 3 liter bioreactor and cultured in a fed-batch process. When the cell viability dropped to ˜80%, the cell culture supernatants were harvested from the bioreactor and subjected to protein purification by affinity chromatography. The purity of recombinant proteins was above 95%, and the content of endotoxin was below 0.5 U/g.

    Example 3. IMM2520 and IMM2521 Bound to PD-L1 and CD47

    [0093] CHO-PD-L1 cells (over-expressing PD-L1, in house made) or Jurkat cells (naturally expressing CD47) were incubated at 4° C. for 1 hour with serially diluted IMM2520, IMM2521 and control agents, respectively. Cells were washed with cold PBS twice, and then incubated with FITC-conjugated secondary antibody against human IgG-Fc (Cat #F9512, Sigma) for 45 min. Cells were washed twice and re-suspended in 200 ml PBS. Then, the cells were subject to FACS analysis using a flow cytometer (Merck Millipore, Guava® easyCyte 5HT).

    [0094] IMM2520 bound to PD-L1 on CHO cells with an EC.sub.50 value of 0.09 nM (FIG. 3), and to CD47 on Jurkat cells with an EC.sub.50 value of 0.80 nM (FIG. 4), slightly inferior to the traditional single antigen targeting proteins. IMM2521 bound to PD-L1 on CHO cells with an EC.sub.50 value of 0.11 nM (FIG. 3), and to CD47 on Jurkat cells with an EC.sub.50 value of 0.70 nM (FIG. 4), slightly inferior to the traditional single antigen targeting proteins.

    Example 4. IMM2520 and IMM2521 Blocked PD-L1-PD-1 Interaction

    [0095] Biotin-hPD1-mFc proteins (SEQ ID NO: 22), 1 μg/ml, were mixed with serially diluted IMM2520, IMM2521, IMM2515 and hIgG1-Fc, respectively, and the mixtures were then added to a 96-well plate containing CD47.sup.+ or CD47.sup.− CHO-PD-L1 cells. Cells were incubated at 4° C. for 45 minutes, washed with PBS, and then further incubated at 4° C. for another 45 minutes with PE-conjugated mouse Anti-human CD279 (Cat #557946, BD BioScience). Cells were washed and re-suspended in 200 ml PBS, and then subjected to FACS analysis for hPD1-mFc-PD-L1 binding/interaction.

    [0096] As shown in FIG. 5A, IMM2520, IMM2521 and IMM2515 all inhibited interaction of PD1-mFc with CD47.sup.−PD-L1.sup.+ cells with IC.sub.50 values less than 1 nM.

    [0097] On PD-L1 and CD47 double positive cells (FIG. 5B), the PD-L1×CD47 bispecifics, namely IMM2520 and IMM2521, revealed higher inhibitory activity than the monospecific anti-PD-L1 antibody IMM2515.

    Example 5. IMM2520 and IMM2521 Blocked CD47-SIRPα Interaction

    [0098] FITC-conjugated SIRPα-Fc (wild type human SIRPα conjugated with human IgG1 Fc, SEQ ID NO: 23), 80 nM, was mixed with serially diluted IMM2520, IMM2521, IMM01, and hIgG1-Fc, respectively. The mixtures were added to a 96-well plate containing PD-L1.sup.− or PD-L1.sup.+ CD47-expressing Raji cells, and the plate was incubated at 4° C. for 45 minutes. Cells were washed with PBS and then subjected to FACS analysis for SIRPα-Fc-CD47 interaction.

    [0099] As shown in FIG. 6A, IMM2520 inhibited interaction of SIRPα-Fc with PD-L1.sup.− CD47.sup.+ cells with an IC.sub.50 value of 127.7 nM, while IMM2521 inhibited interaction of SIRPα-Fc with PD-L1.sup.−CD47.sup.+ cells with an IC.sub.50 value of 139.8 nM.

    [0100] On PD-L1 and CD47 double positive cells (FIG. 6B), the PD-L1×CD47 bispecifics, namely IMM2520 and IMM2521, revealed much higher inhibitory activity than the monospecific IMM01.

    Example 6. IMM2520 Induced High Level of Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC) Against PD-L1 Positive Cells

    [0101] CFSE-labeled Raji-PD-L1 cells (used as target cells) were mixed with NK92MI cells (effector cells) stably expressing FcγRIIIa at a 1:2 ratio, and the mixed cells were cultured for 4 hours at 37° C. under 5% CO.sub.2 in the presence of serially diluted IMM2515 or IMM2520. Then propidium iodide (PI) (Cat #P4170, Sigma) was added to the cell culture at a concentration of 5 μg/ml, and the cell culture was subjected to FACS analysis for PI signals. Percentage of cell lysis caused by ADCC was calculated based on the following formula:


    % Lysis=(% PI Positive Cell treated with IMM2515 or IMM2520−% PI Positive Cell treated with negative control protein)/(100−% PI Positive Cell treated with negative control protein)*100

    [0102] As shown in FIG. 7, IMM2520 induced higher ADCC level compared to that of the monospecific anti-PD-L1 antibody IMM2515.

    Example 7. IMM2520 Induced High Level of Antibody-Dependent Cellular Phagocytosis (ADCP) Against PD-L1 Positive Cells

    [0103] Ana-1 cells (a mouse macrophage cell line, as effector cells) were seeded in a 96-well cell culture plate, 1×10.sup.5 cells per well, and cultured for 16-18 hours at 37° C. and 5% CO.sub.2. Raji-PD-L1 cells (as target cells) were labeled with CFSE, and then respectively incubated with serially diluted IMM2520, IMM2515, IMM01, the combination of IMM01 and IMM2515, and hIgG1-Fc for 45 minutes. The target cell solutions were transferred to the plate containing Ana-1 cells, the ratio of Ana-1 cells to Raji-PD-L1 cells being 1:1. The mixtures were cultured for 2 hours at the cell culture incubator and then subject to analysis by FACS for the density of CFSE in Ana-1 cells.

    [0104] FIG. 8 showed that IMM2520 induced a high level of antibody-dependent cellular phagocytosis (ADCP) against PD-L1.sup.+ tumor cells.

    Example 8. IMM2520 Showed Potent Anti-Tumor Activity

    [0105] Twenty four 5-7 week old SCID mice were injected subcutaneously with CT26-hPDL1/hCD47 colorectal carcinoma cells, 2×10.sup.6 cells per mouse, at the right flank. When tumor volumes reached 100-150 mm.sup.3, mice were randomly allocated into four groups with 6 mice in each group, and this day was designated as Day 0. Starting from Day 0, these mice were respectively given intraperitoneal injection of PBS, IMM2505 (6.0 mg/kg), IMM2520 (6.0 mg/kg), and IMM01 (3.0 mg/kg) for 4 weeks, twice per week. Administrations were stopped at the end of week 4 and mice were observed till termination of experiment. For the group with PBS treatment, the test was terminated when the average tumor volume reached 3000 mm.sup.3; while for the other groups, the test was terminated at Day 60. Tumor volume and body weight were measured every 3-4 days.

    [0106] The tumor volume (V) was calculated as (length×width.sup.2)/2. Tumor growth inhibition rate (TGI) was calculated by the formula: Tumor growth inhibition rate=(1-tumor volume change in administration group/tumor volume change in control group)×100%.

    [0107] The test regime and results were summarized in Table 1.

    [0108] As shown in Table 1 above and FIGS. 9 and 10, Group 4 had a tumor growth inhibition rate of 97.89%, which was much higher than those of other groups, including the group with IMM2505 treatment. IMM2505 is fusion protein that shares similar overall design with IMM2520 and comprises the mutated SIRPαD1 (SEQ ID NO: 2) and a different anti-PD-L1 antibody. In U.S. Pat. No. 10,973,878 B2, IMM2505 showed superior anti-tumor efficacy over combination of monospecific agents (i.e., anti-PD-L1 antibody combined with IMM01) in a mouse model.

    TABLE-US-00001 TABLE 1 Anti-tumor effect of IMM2520 and other agents Dose P Group Drug Animal# (mg/kg) Treatment TGI value 1 PBS 6 n/a i.p.b.w. × 4 2 IMM01 6 3.0 i.p.b.w. × 4 75.13% 0.007 3 IMM2505 6 6.0 i.p.b.w. × 4 81.74% 0.007 4 IMM2520 6 6.0 i.p.b.w. × 4 97.89% 0.001

    [0109] As shown in FIG. 9, the tumor sizes of mice in Group 1 kept increasing during the test; in Group 2 and Group 3, with the administration of IMM01 (mutated SIRPαD1-Fc) and IMM2505, respectively, the tumor sizes began to decrease at around Day 40; while in Group 4, the tumor volume declined immediately after IMM2520 administration. The data suggested that IMM2520 acted quickly on the tumors and provided superior anti-tumor efficacy as compared to IMM01 and IMM2505.

    [0110] As shown in FIG. 10, Group 2 and Group 3 shared similar survival curves, the survival rates decreased to about 80% around Day 40 and later to about 70%; while the survival rate in Group 4 remained at 100% till Day 60.

    Example 9. IMM2520 Simultaneously Bound to PD-L1 and CD47

    [0111] Molecular interaction device (Probe Life, Gator) was used to detect the simultaneous binding of IMM2520 to CD47 and PD-L1. Anti-human IgG probe was used to capture 10 μg/ml IMM2520 protein until the shift reached ˜1.0 nm. The probe was subsequently rinsed in buffer for 30 seconds and then transferred to 10 μg/ml PD-L1-His (FIG. 11) or 10 μg/ml CD47-His solution (FIG. 12) until the binding strength reached saturation levels. Finally, the probe was transferred to 10 μg/ml CD47-His (FIG. 11) or 10 μg/ml PD-L1-His solution (FIG. 12) for 120 seconds.

    [0112] As shown in FIG. 11, IMM2520 was able to bind CD47 even when it was saturated with PD-L1 binding; while as shown in FIG. 12, IMM2520 was able to bind PD-L1 after it was saturated with CD47 binding.

    [0113] Altogether, the data showed that IMM2520, after saturation binding with one antigen, was able to bind to the other antigen, suggesting that it was capable of simultaneously binding to PD-L1 and CD47.

    TABLE-US-00002 Description Sequence/SEQ ID NO. Nucleic acid sequence of first extracellular Ig-like domain of SIRP alpha (SIRPαD1) with mutation GAGGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTATCAGTTGCAGCTGGAGAGTC GGCCATTCTGCACTGCACTGTGACCTCCCTGATCCCTGTGGGGCCCATCCAGTGGTTCAG AGGAGCTGGACCAGCCCGGGAATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGG TAACAACTGTTTCAGAGTCCACAAAGAGAGAAAACATGGACTTTTCCATCAGCATCAGT GCCATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAAGTTCCGGAAAGGGAGCCC TGACACGGAGTTTAAGTCTGGAGCAGGCACTGAGCTGTCTGTGCGTGCCAAACCCTCTGC CCCCGTGGTATCGGGCCCT (SEQ ID NO: 1) Amino acid sequence of SIRPαD1 mutant EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVS ESTKRENMDFSISISAITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGP (SEQ ID NO: 2) Nucleic acid sequence of linker GGCGGCGGTGGGAGCGGCGGCGGTGGGAGCGGCGGCGGGGGCTCG (SEQ ID NO: 3) Amino acid sequence of linker GGGGSGGGGSGGGGS (SEQ ID NO: 4) Nucleic acid sequence of heavy chain of anti-PD-L1 antibody CAAGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAGCCTGGCGCAAGCGTGAAGG TGAGCTGCAAGGCAAGCGGCTACACCTTCACAAGCAACTGGATGCACTGGGTGAGACAA GCCCCTGGCCAAGGCCTGGAGTGGATGGGCATGATCCACCCTAACAGCGGCAGCAGCAA CTACAACGAGAAGTTCAAGAGCAGAGTGACCATGACAAGAGACACAAGCACAAGCACC GTGTACATGGAGCTGAGCAGCCTGAGAAGCGAGGACACCGCCGTGTACTACTGCGCTAG AAGCTACTACGGCAGCAGCCCTTACTACTTCGACTACTGGGGCCAAGGCACCCTGGTGAC CGTGAGCAGCGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAG CACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGT GACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCT ACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGG CACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGA GAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAA CTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATC TCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGT CAAGTTCAACTGGTATGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGG AGGAGCAGTACAACGCCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAAGAC TGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCAT CGCCGCAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGC CCCCATCCCGGGAGGAGATGACCAAGAACCAAGTCAGCCTGACCTGCCTGGTCAAAGGC TTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTA CAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATTCCAAGCTCACC GTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGCAAATGA (SEQ ID NO: 5) Amino acid sequence of heavy chain of anti-PD-L1 antibody QVQLVQSGAEVKKPGASVKVSCKASGYTFTSNWMHWVRQAPGQGLEWMGMIHPNSGSSN YNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSYYGSSPYYFDYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNATYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIAATISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK (SEQ ID NO: 6) Nucleic acid sequence of light chain of anti-PD-L1 antibody GACATTCAGATGACACAGAGCCCTAGCAGCCTGAGCGCAAGCGTGGGCGACAGAGTGAC CATCACCTGCAGAGCAAGCCAAGACATCATCAACTACCTGAACTGGTATCAGCAGAAGC CTGGCAAGGCCCCTAAGCTGCTGATCTACTACACAAGCAGACTGCACAGCGGCGTGCCT AGCAGATTCAGCGGCAGCGGCAGCGGCACCGACTTCACCTTCACCATCAGCAGCCTGCA GCCTGAGGACATCGCCACCTACTACTGTCAGCAAGGCGACACCCTGCCTTGGACCTTCGG CCAAGGCACCAAGGTGGAGATCAAGCGAACTGTGGCTGCACCATCTGTCTTCATCTTCCC GCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTT CTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACT CCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCAC CCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCC ATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG (SEQ ID NO: 7) Amino acid sequence of light chain of anti-PD-L1 antibody DIQMTQSPSSLSASVGDRVTITCRASQDIINYLNWYQQKPGKAPKLLIYYTSRLHSGVPSRFSG SGSGTDFTFTISSLQPEDIATYYCQQGDTLPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 8) Nucleic acid sequence of SIRPαD1 mutant-linker-anti-PD-L1 heavy chain variable region-heavy chain constant region GAGGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTATCAGTTGCAGCTGGAGAGTC GGCCATTCTGCACTGCACTGTGACCTCCCTGATCCCTGTGGGGCCCATCCAGTGGTTCAG AGGAGCTGGACCAGCCCGGGAATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGG TAACAACTGTTTCAGAGTCCACAAAGAGAGAAAACATGGACTTTTCCATCAGCATCAGT GCCATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAAGTTCCGGAAAGGGAGCCC TGACACGGAGTTTAAGTCTGGAGCAGGCACTGAGCTGTCTGTGCGTGCCAAACCCTCTGC CCCCGTGGTATCGGGCCCTGGCGGCGGTGGGAGCGGCGGCGGTGGGAGCGGCGGCGGG GGCTCGCAAGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAGCCTGGCGCAAGCGT GAAGGTGAGCTGCAAGGCAAGCGGCTACACCTTCACAAGCAACTGGATGCACTGGGTGA GACAAGCCCCTGGCCAAGGCCTGGAGTGGATGGGCATGATCCACCCTAACAGCGGCAGC AGCAACTACAACGAGAAGTTCAAGAGCAGAGTGACCATGACAAGAGACACAAGCACAA GCACCGTGTACATGGAGCTGAGCAGCCTGAGAAGCGAGGACACCGCCGTGTACTACTGC GCTAGAAGCTACTACGGCAGCAGCCCTTACTACTTCGACTACTGGGGCCAAGGCACCCTG GTGACCGTGAGCAGCGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCC AAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGA ACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGG CTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCA GCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTG GACAAGAGAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGC ACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCT CATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACC CTGAGGTCAAGTTCAACTGGTATGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAG CCGCGGGAGGAGCAGTACAACGCCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCA CCAAGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAG CCCCCATCGCCGCAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTAC ACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAAGTCAGCCTGACCTGCCTGGT CAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGA ACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTATTCCA AGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATG CATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGCAAATG A (SEQ ID NO: 9) Amino acid sequence of SIRPαD1 mutant-linker-anti-PD-L1 heavy chain variable region-heavy chain constant region EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVS ESTKRENMDFSISISAITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGPGG GGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSNWMHWVRQAPGQGLE WMGMIHPNSGSSNYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSYYGSSPYY FDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNATYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIAATISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 10) Nucleic acid sequence of SIRPαD1 mutant-Fc GAGGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTATCAGTTGCAGCTGGAGAGTC GGCCATTCTGCACTGCACTGTGACCTCCCTGATCCCTGTGGGGCCCATCCAGTGGTTCAG AGGAGCTGGACCAGCCCGGGAATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGG TAACAACTGTTTCAGAGTCCACAAAGAGAGAAAACATGGACTTTTCCATCAGCATCAGT GCCATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAAGTTCCGGAAAGGGAGCCC TGACACGGAGTTTAAGTCTGGAGCAGGCACTGAGCTGTCTGTGCGTGCCAAACCCTCTGC CCCCGTGGTATCGGGCCCTGCGGCGAGGGCCACACCTCAGCACGAGCCCAAATCTTGTG ACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTC TTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACA TGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGA CGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACG TACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTAC AAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGC CAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGA CCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCG TGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTG GACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAG CAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAG AAGAGCCTCTCCCTGTCTCCGGGTTGA (SEQ ID NO: 11) Amino acid sequence of SIRPαD1 mutant-Fc EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVS ESTKRENMDFSISISAITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGPAAR ATPQHEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 12) Nucleic acid sequence of signal peptide of mouse IgG1 heavy chain ATGGGATGGTCATGTATCATCCTTTTTCTGGTAGCAACTGCAACTGGAGTACATTCA (SEQ ID NO: 13) Kozak GCCGCCACC (SEQ ID NO: 14) Nucleic acid sequence of SIRPαD1 mutant-linker-anti-PD-L1 light chain variable region-light chain constant region GAGGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTATCAGTTGCAGCTGGAGAGTC GGCCATTCTGCACTGCACTGTGACCTCCCTGATCCCTGTGGGGCCCATCCAGTGGTTCAG AGGAGCTGGACCAGCCCGGGAATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGG TAACAACTGTTTCAGAGTCCACAAAGAGAGAAAACATGGACTTTTCCATCAGCATCAGT GCCATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAAGTTCCGGAAAGGGAGCCC TGACACGGAGTTTAAGTCTGGAGCAGGCACTGAGCTGTCTGTGCGTGCCAAACCCTCTGC CCCCGTGGTATCGGGCCCTGGCGGCGGTGGGAGCGGCGGCGGTGGGAGCGGCGGCGGG GGCTCGGACATTCAGATGACACAGAGCCCTAGCAGCCTGAGCGCAAGCGTGGGCGACAG AGTGACCATCACCTGCAGAGCAAGCCAAGACATCATCAACTACCTGAACTGGTATCAGC AGAAGCCTGGCAAGGCCCCTAAGCTGCTGATCTACTACACAAGCAGACTGCACAGCGGC GTGCCTAGCAGATTCAGCGGCAGCGGCAGCGGCACCGACTTCACCTTCACCATCAGCAG CCTGCAGCCTGAGGACATCGCCACCTACTACTGTCAGCAAGGCGACACCCTGCCTTGGAC CTTCGGCCAAGGCACCAAGGTGGAGATCAAGCGTGAGTTCTAGAGGATCCATCTGGGAT AAGCATGCTGTTTTCTGTCTGTCCCTAACATGCCCTGTGATTATCCGCAAACAACACACC CAAGGGCAGAACTTTGTTACTTAAACACCATCCTGTTTGCTTCTTTCCTCAGGAACTGTGG CTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTC TGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGG ATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC AGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAA AGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCA ACAGGGGAGAGTGTTAG (SEQ ID NO: 15) Amino acid sequence of SIRPαD1 mutant-linker-anti-PD-L1 light chain variable region-light chain constant region EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVS ESTKRENMDFSISISAITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGPGG GGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDIINYLNWYQQKPGKAPKLLIYY TSRLHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQGDTLPWTFGQGTKVEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 16) Amino acid sequence of linker GGGGSGGGGS (SEQ ID NO: 17) Amino acid sequence of linker GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 18) Amino acid sequence of anti-PD-L1 heavy chain variable region QVQLVQSGAEVKKPGASVKVSCKASGYTFTSNWMHWVRQAPGQGLEWMGMIHPNSGSSN YNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSYYGSSPYYFDYWGQGTLVTVS S (SEQ ID NO: 19) Amino acid sequence of anti-PD-L1 light chain variable region DIQMTQSPSSLSASVGDRVTITCRASQDIINYLNWYQQKPGKAPKLLIYYTSRLHSGVPSRFSG SGSGTDFTFTISSLQPEDIATYYCQQGDTLPWTFGQGTKVEIK (SEQ ID NO: 20) Amino acid sequence of heavy chain constant region ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNATYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIAATISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK (SEQ ID NO: 21) Amino acid sequence of human PD-1 with mouse IgG1 Fc MGWSCIILFLVATATGVHSLDSPDRPWNPPTFSPALLVVTEGDAATFTCSFSNTSESFVLNWY RMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAP KAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQEFVPRDCGCKPCICTVPEVSSVFIFPPK PKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIM HQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDF FPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLH NHHTEKSLSHSPGK (SEQ ID NO: 22) Amino acid sequence of wild type human SIRPα with human IgG1 Fc MGWSCIILFLVATATGVHSSCAWSGVAGEEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPI QWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSP DTEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSD FQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTL EVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWL LVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNERNEFEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 23)

    [0114] While the application has been described above in connection with one or more embodiments, it should be understood that the application is not limited to those embodiments, and the description is intended to cover all alternatives, modifications, and equivalents, as may be included within the spirit and scope of the appended claims. All references cited herein are further incorporated by reference in their entirety.

    REFERENCES

    [0115] 1. Fife B T, Pauken K E. The role of the PD-1 pathway in autoimmunity and peripheral tolerance. Annals of the New York Academy of Sciences. 2011, 1217: 45-59 [0116] 2. Francisco L M, Sage P T, Sharpe A H. The PD-1 pathway in tolerance and autoimmunity. Immunological Reviews. 2010, 236: 219-42 [0117] 3. Gardai S J, McPhillips K A, Frasch S C, Janssen W J, Starefeldt A, Murphy-Ullrich J E, Bratton D L, Oldenborg P A, Michalak M, Henson P M. Cell-surface calreticulin initiates clearance of viable or apoptotic cells through trans-activation of LRP on the phagocyte. Cell. 2005; 123:321-334 [0118] 4. Gennaro, ed., Remington: The Science and Practice of Pharmacy, 20th Ed., Lippincott Williams & Wilkins 2003 [0119] 5. J. R. Robinson, ed., Sustained and Controlled Release Drug Delivery Systems, Marcel Dekker, Inc., New York, 1978 [0120] 6. Lee W Y, Weber D A, Laur O, Severson E A, McCall I, Jen R P, Chin A C, Wu T, Gernert K M, Parkos C A. Novel Structural Determinants on SIRPα that Mediate Binding to CD47. J Immunol. 2007, 179:7741-7750 [0121] 7. Obeid M, Panaretakis T, Joza N, Tufi R, Tesniere A, van Endert P, Zitvogel L, Kroemer G. Calreticulin exposure is required for the immunogenicity of gamma-irradiation and UVC light induced apoptosis. Cell Death Differ. 2007, 14:1848-1850 [0122] 8. Orr A W, Pedraza C E, Pallero M A, Elzie C A, Goicoechea S, Strickland D K, Murphy-Ullrich J E. Low density lipoprotein receptor-related protein is a calreticulin coreceptor that signals focal adhesion disassembly. J Cell Biol. 2003, 161:1179-1189 [0123] 9. Shields R L, Namenuk A K, Hong K, Meng Y G, Rae J, Briggs J, Xie D, Lai J, Stadlen A, Li B, Fox J A, Presta L G. High Resolution Mapping of the Binding Site on Human IgG1 for FcγRI, FcγRII, FcγRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcgR. JBC. 2001, 276:6591-6604 [0124] 10. Suzanne L. Topalian, F. Stephen Hodi, Julie R. Brahmer, Scott N. Gettinger, David C. Smith, David F. McDermott, John D. Powderly, Richard D. Carvajal, Jeffrey A. Sosman, Michael B. Atkins, Philip D. Leming, David R. Spigel, Scott J. Antonia, Leora Horn, Charles G. Drake, Drew M. Pardoll, Lieping Chen, William H. Sharfman, Robert A. Anders, Janis M. Taube, Tracee L. McMiller, Haiying Xu, Alan J. Korman, Maria Jure-Kunkel, Shruti Agrawal, Daniel McDonald, Georgia D. Kollia, Ashok Gupta, Jon M. Wigginton, and Mario Sznol. Safety, Activity, and Immune Correlates of Anti-PD-1 Antibody in Cancer, N Engl J Med 2012; 366:2443-2454 [0125] 11. Theocharides, A. P. A.; Jin, L. Q.; Cheng, P. Y.; Prasolava, T. K.; Malko, A. V.; Ho, J. M.; Poeppl, A. G.; Rooijen, N. van; Minden, M. D.; Danska, J. S.; Dick, J.; Wang, J. C. Y. J. Exp. Med. 2012, Vol. 209 No. 10 1883-1899 [0126] 12. Thompson R H, Gillett M D, Cheville J C, Lohse C M, Dong H, Webster W S, Krejci K G, Lobo J R, Sengupta S, Chen L, Zincke H, Blute M L, Strome S E, Leibovich B C, Kwon E D. Costimulatory B7-H1 in renal cell carcinoma patients: Indicator of tumor aggressiveness and potential therapeutic target. PNAS. 2004, 101 (49): 17174-9 [0127] 13. Tseng D, Volkmer J P, Willingham S B, Contreras-Trujillo H, Fathman J W, Fernhoff N B, Seita J, Inlay M A, Weiskopf K, Miyanishi M, Weissman I L. Anti-CD47 antibody-mediated phagocytosis of cancer by macrophages primes an effective antitumor T-cell response. PNAS. 2013, 110:11103-11108 [0128] 14. Vlahopoulos, S A. Aberrant control of NF-κB in cancer permits transcriptional and phenotypic plasticity, to curtail dependence on host tissue: molecular mode. Cancer biology & medicine. 2017, 14: 254-270 [0129] 15. Shim H. Bispecific Antibodies and Antibody-Drug Conjugates for Cancer Therapy: Technological Considerations. Biomolecules. 2020 Feb. 26; 10(3):360 [0130] 16. Wang S, Chen K, Lei Q, Ma P, Yuan A Q, Zhao Y, Jiang Y, Fang H, Xing S, Fang Y, Jiang N, Miao H, Zhang M, Sun S, Yu Z, Tao W, Zhu Q, Nie Y, Li N. The state of the art of bispecific antibodies for treating human malignancies. EMBO Mol Med. 2021 Aug. 24:e14291. doi: 10.15252/emmm.202114291