FUNGAL-SPECIFIC METALLOPROTEASES AND USES THEREOF
20170198060 ยท 2017-07-13
Assignee
Inventors
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61P31/00
HUMAN NECESSITIES
C12Y203/01
CHEMISTRY; METALLURGY
C12N9/1029
CHEMISTRY; METALLURGY
A61K38/4886
HUMAN NECESSITIES
International classification
Abstract
The present invention relates to methods of reducing, delaying, preventing and/or inhibiting the progression of a Cryptococcus infection into the central nervous system (CNS) of a subject by inhibiting the activity of a M36 fungalysin metalloprotease (e.g., MPR1) secreted by the Cryptococcus. The invention further provides methods of increasing, promoting and/or enhancing delivery of a therapeutic agent across the blood-brain-barrier, comprising systemically administering the therapeutic agent in conjunction with a M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof.
Claims
1. A method of reducing, delaying, preventing and/or inhibiting the progression of a Cryptococcus infection into the central nervous system (CNS) of a subject in need thereof, comprising inhibiting the activity of a M36 fungalysin metalloprotease secreted by the Cryptococcus, wherein the M36 fungalysin metalloprotease has at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 1.
2. A method of reducing, inhibiting and/or preventing the transmigration of Cryptococcus across the blood-brain-barrier in a subject in need thereof, comprising inhibiting the activity of a M36 fungalysin metalloprotease secreted by the Cryptococcus, wherein the M36 fungalysin metalloprotease has at least 80% sequence identity to an amino acid sequence of SEQ ID NO:1.
3. The method of claim 1, wherein the subject is suspected of being infected with Cryptococcus.
4. The method of claim 1, wherein the subject has pulmonary cryptococcosis.
5. The method of claim 1, wherein the subject has tested positive for Cryptococcus infection in the cryptococcal antigen lateral flow assay (CrAg LFA).
6. The method of claim 1, wherein the subject has no detectable Cryptococcus infection of the CNS.
7. The method of claim 1, wherein the subject is immunocompromised.
8. The method of claim 1, wherein the subject is human.
9. The method of claim 1, wherein the Cryptococcus is selected from the group consisting of Cryptococcus gattii, Cryptococcus neoformans, Cryptococcus neoformans var. grubii, Cryptococcus neoformans var grubii H99, Cryptococcus sp. Y13-1, Cryptococcus laurentii and Cryptococcus albidus.
10. The method of claim 1, wherein the M36 fungalysin metalloprotease is inhibited from binding to its substrate.
11. The method of claim 1, wherein the catalytic activity of the M36 fungalysin metalloprotease is inhibited.
12. The method of claim 1, wherein an antigen binding molecule that specifically binds to the M36 fungalysin metalloprotease is administered to the subject.
13. The method of claim 12, wherein the antigen binding molecule is an antibody or fragment thereof.
14. The method of claim 1, wherein expression levels of the M36 fungalysin metalloprotease are reduced and/or inhibited.
15. The method of claim 14, wherein an inhibitory nucleic acid that inhibits expression of the M36 fungalysin metalloprotease is administered to the subject.
16. The method of claim 12, wherein the antigen binding molecule specifically binds to the peptidase_M36 domain of the M36 fungalysin metalloprotease.
17. The method of claim 12, wherein the antigen binding molecule specifically binds to the M36 GluZincin superfamily domain of the M36 fungalysin metalloprotease.
18. The method of claim 12, wherein the antigen binding molecule specifically binds to the zinc binding site of the M36 fungalysin metalloprotease.
19. The method of claim 12, wherein the antigen binding molecule is administered intravenously.
20-35. (canceled)
36. An expression cassette comprising a nucleic acid encoding a M36 fungalysin metalloprotease having at least 80% sequence identity to an amino acid sequence of SEQ ID NO: 1, or a fragment thereof that retains protease activity, operably linked to a promoter that promotes expression in a mammalian cell.
37-46. (canceled)
47. A host cell comprising the expression cassette of claim 36.
48-65. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
DETAILED DESCRIPTION
[0089] 1. Introduction
[0090] Immunocompromised populations worldwide are at risk for developing a life-threatening infection of the brain caused by Cryptococcus neoformans, a pathogenic fungus. See, e.g., World Health Organization. (2003) HIV/AIDS Epidemiological surveillance update for the W.H.O. African region. World Health Organization, Geneva, Switzerland; Mitchell, et al., (1995) Clin. Microbiol. Rev. 8:515-548; Sorvillo, et al., (1997) AIDS 11, 673-679; Bicanic, et al., (2004) British Med. Bulletin, 72, 99-118; Zuger, et al., (1986) Ann Intern Med 104:234-240; Casadevall and Perfect (1998) Cryptococcus neoformans. American Society for Microbiology, Washington, D.C.; and Ecevit, et al., (2006) Clin Infect Dis 42:1443-1447. Why C. neoformans has this remarkable tropism for the central nervous system (CNS) is not clear. Recent research on cerebral pathogenesis of C. neoformans revealed a predominantly transcellular migration of cryptococci across the brain endothelium. See, e.g., Chang, et al., (2004) Infect Immun 72:4985-4995; Vu, et al., (2009) Eukaryotic Cell 8:1803-1807; and Shi, et al., (2010) J. Clinical Invest 120:1683-1693. The identity of key fungal virulence factors that function specifically to invade the CNS remains unresolved. The present invention is based, in part, on the discovery of a metalloprotease (MPR1) through our examination of the extracellular proteome of C. neoformans (Eigenheer, et al., (2007) FEMS Yeast Research 7:499-510) and the finding that MPR1 is required for establishing fungal disease in the CNS. A strain of C. neoformans lacking the gene encoding MPR1 (mpr1) failed to breach the endothelium in an in vitro model of the blood-brain barrier (BBB). Also, infection of a mammalian host with the mpr1 null mutant strain greatly improved survival due to a significantly reduced fungal burden in the brain. The brain pathology commonly associated with cryptococcal disease was not detected in brains from hosts infected with the mpr1 strain. The central role of MPR1 in the pathogenesis of CNS cryptococcosis provides a target for preventing, reducing, delaying and/or inhibiting Cryptococcus neoformans infection of the CNS.
[0091] 2. Methods of Preventing, Reducing, Delaying and/or Inhibiting Cryptococcus neoformans Infection of the CNS
[0092] a. Subjects Who May Benefit
[0093] Subjects who may benefit from methods of inhibiting the activity of the fungal-specific MPR1 metalloprotease may already have or be suspected of having a Cryptococcus infection, or may be at risk of developing a Cryptococcus infection.
[0094] In subjects who may already have or be suspected of having a Cryptococcus infection, administration of an agent that inhibits the activity of the fungal-specific MPR1 metalloprotease can ameliorate progression of infection, reduce further infection of the CNS and/or the brain tissues, and/or prevent penetration and crossing of the blood-brain-barrier by Cryptococcus organisms. The subject may or may not be exhibiting symptoms of Cryptococcus infection (e.g., a cough that lasts weeks or months, sharp chest pains, unexplained shortness of breath, severe headache, confusion, fever, night sweats, and/or unintended weight loss). In some embodiments, the subject has no detectable Cryptococcus infection of the CNS and/or in the brain tissues. In various embodiments, the subject may have, be suspected of having and/or exhibiting symptoms of pulmonary cryptococcosis or cryptococcal endocarditis. In various embodiments, the subject may have, be suspected of having and/or exhibiting symptoms of cryptococcal meningitis.
[0095] Subjects at risk of developing a Cryptococcus infection include those with compromised immunity, e.g., resulting from HIV infection, cancer chemotherapy, immunosuppressant therapy, and/or metabolic immunosuppression. Subjects at risk of developing a Cryptococcus infection also include those in an environment or geographical location that increases the risk of contracting a Cryptococcal infection, e.g., in Africa, India, Thailand and other Asian-Pacific countries, and the North American Pacific Northwest, including Canada and the U.S (e.g., Washington, Oregon, Northern California).
[0096] In some embodiments, the subject has tested positive in a serum assay for detecting for Cryptococcus infection. For example, the subject may have tested positive for Cryptococcus infection in the cryptococcal antigen lateral flow assay (CrAg LFA). See, e.g., Lindsley, et al., Clin Infect Dis. (2011) 53(4):321-5.
[0097] In various embodiments, the subject is infected with, suspected of being infected with, or at risk of being infected with a Cryptococcus species selected from the group consisting of Cryptococcus gattii, Cryptococcus neoformans, Cryptococcus neoformans var. grubii, Cryptococcus neoformans var grubii H99, Cryptococcus sp. Y13-1, Cryptococcus laurentii and Cryptococcus albidus.
[0098] b. Inhibiting the Metalloprotease Activity of MPR1
[0099] MPR1 activity can be inhibited at either or both the protein level or the transcriptional level. In various embodiments, an agent that inhibits the enzymatic or catalytic activity or substrate binding activity of a fungal-specific MPR1 protein is administered. In some embodiments, an agent that inhibits the expression, e.g., the transcription and or translation of a fungal-specific MPR1 protein is administered.
[0100] i. Cryptococcus MPR1 Metalloproteases to be Inhibited
[0101] Generally, the metalloprotease activity of a MPR1 or Cryptococcus M36 fungalysin metalloprotease, e.g., having at least 80% sequence identity, e.g., at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity, to an amino acid sequence of SEQ ID NOs: 1, 3, 5 or 7, is inhibited or reduced, thereby preventing, reducing, delaying or inhibiting transmigration of Cryptococcus across the blood-brain-barrier and into the CNS. In some embodiments, the M36 fungalysin metalloprotease has an amino acid sequence of SEQ ID NOs: 1, 3, 5 or 7.
[0102] In various embodiments, the MPR1 metalloprotease or Cryptococcus M36 fungalysin metalloprotease to be reduced or inhibited is from a Cryptococcus species or strain selected from Cryptococcus gattii, Cryptococcus neoformans, Cryptococcus neoformans var. grubii, Cryptococcus neoformans var grubii H99, Cryptococcus sp.Y13-1, Cryptococcus laurentii and Cryptococcus albidus.
[0103] ii. Inhibiting MPR1 Enzymatic Activity
[0104] In one embodiment, the methods involve reducing, inhibiting or preventing penetration and crossing of the blood-brain-barrier by Cryptococcus and cryptococcal infection of the CNS and/or brain tissues by inhibiting a fungal-specific MPR1 metalloprotease. Preferably, the inhibitory agent specifically or preferentially inhibits the metalloprotease activity of a Cryptococcus-specific MPR1 in comparison to inhibiting the metalloprotease activity of metalloproteases endogenous to the subject.
[0105] Examples of agents capable of inhibiting enzyme activity include substrate analogs, suicide substrates, alkylating agents, and inhibitory nucleic acids (reviewed in Ferscht, Structure and Mechanism in Protein Science: A Guide to Enzyme Catalysis and Protein Folding, 3rd Edition, 1999, W.H. Freeman & Co.). The methods of decreasing, inhibiting or preventing MPR1 activity can involve administering to a subject, including a mammal such as a human, a compound that is an analog of a substrate for a fungal-specific or Cryptococcus-specific MPR1, including small organic compound or peptidomimetic substrate analogs.
[0106] The preferred MPR1 inhibitors have no other adverse effects on cellular metabolism, so that other cellular functions proceed while the specific reaction of MPR1 metalloprotease activity is inhibited. The blocking agents are preferably relatively small molecules, thereby avoiding immunogenicity and allowing passage through the cell membrane. Ideally, they have a molecular weight of between about 100-2000 daltons, but may have molecular weights up to 5000 or more, depending upon the desired application. In most preferred embodiments, the inhibitors have molecular weights of between about 200-600 daltons.
[0107] The inhibitors of the present invention preferably have strong affinity for the target enzyme, so that at least about 60-70% inhibition of MPR1 activity is achieved, more preferably about 75%-85% and most preferably 90%-95% or more. In some embodiments, the inhibitors will completely inhibit MPR1 activity. The affinity of the enzyme for the inhibitor is preferably sufficiently strong that the dissociation constant, or Ki, of the enzyme-inhibitor complex is less than about 10.sup.5 M, typically between about 10.sup.6 and 10.sup.8M.
[0108] Enzyme inhibition generally involves the interaction of a substance with an enzyme so as to decrease the rate of the reaction catalyzed by that enzyme. Inhibitors can be classified according a number of criteria. For example, they may be reversible or irreversible. An irreversible inhibitor dissociates very slowly, if at all, from its target enzyme because it becomes very tightly bound to the enzyme, either covalently or noncovalently. Reversible inhibition, in contrast, involves an enzyme-inhibitor complex which may dissociate.
[0109] Inhibitors can also be classified according to whether they are competitive, noncompetitive or uncompetitive inhibitors. In competitive inhibition for kinetically simple systems involving a single substrate, the enzyme can bind either the substrate or the inhibitor, but not both. Typically, competitive inhibitors resemble the substrate or the product(s) and bind the active site of the enzyme, thus blocking the substrate from binding the active site. A competitive inhibitor diminishes the rate of catalysis by effectively reducing the affinity of the substrate for the enzyme. Typically, an enzyme may be competitively inhibited by its own product because of equilibrium considerations. Since the enzyme is a catalyst, it is in principle capable of accelerating a reaction in the forward or reverse direction.
[0110] Noncompetitive inhibitors allow the enzyme to bind the substrate at the same time it binds the inhibitor. A noncompetitive inhibitor acts by decreasing the turnover number of an enzyme rather than diminishing the proportion of free enzyme. Another possible category of inhibition is mixed or uncompetitive inhibition, in which the inhibitor affects the binding site and also alters the turnover number of the enzyme. Enzyme inhibition of kinetically complex systems involving more than one substrate, as can be the case for MPR1 enzymes, are described in Segel, Enzyme Kinetics, (Wiley, N.Y. 1975).
[0111] MPR1 metalloprotease activity and its inhibition or enhancement is typically assayed according to standard methods for determining enzyme activity. For a general discussion of enzyme assays, see, Rossomando, Measurement of Enzyme Activity in Guide to Protein Purification, Vol. 182, Methods in Enzymology (Deutscher ed., 1990). Assays for the measurement of MPR1 metalloprotease activity are described herein, and for example, in Naumann, et al., (2011) J Biol Chem, August 30 (PMID:21878653); Monod, et al., (1993) Infect. & Immun. 61:4099-4104; and Markaryan, A., et al., (1994) Infect. & Immun. 62:2149-2157.
[0112] An assay for measuring MPR1 metalloprotease activity typically contains a buffered solution adjusted to physiological pH. General proteolytic activity of MPR1 can be measured employing a casein assay (azocasein). The substrate (e.g., azocasein) is dissolved in a buffered solution of about neutral pH and added to the enzyme (Mpr1) sample. The hydrolysis of the azo dye into the supernatant is detected by absorbance at 440 nm and the proteolytic activity of MPR1 is expressed in arbitrary units. When testing for the ability of a test compound to decrease or inhibit MPR1 metalloprotease activity, the metalloprotease activity of an MPR1 enzyme exposed to the test compound is compared to the metalloprotease activity of an MPR1 enzyme in a control unexposed to the test compound.
[0113] 1. Anti-MPR1 Antigen Binding Molecule Inhibitors
[0114] Antigen binding molecules that bind to and reduce or inhibit the metalloprotease activity of a MPR1 or Cryptococcus M36 fungalysin metalloprotease can be non-antibody binding molecules, or antibodies and fragments thereof. The antigen binding molecules can bind to any region of the enzyme that inhibits or reduces its metalloprotease activity, e.g., by interfering directly with catalytic activity or substrate binding. In various embodiments, the antigen binding molecule binds to the peptidase_M36 domain of the M36 fungalysin metalloprotease. In some embodiments, the antigen binding molecule binds to the M36 GluZincin superfamily domain of the M36 fungalysin metalloprotease. In some embodiments, the antigen binding molecule binds to the zinc binding site of the M36 fungalysin metalloprotease.
[0115] a. Non-Antibody Antigen Binding Molecules
[0116] In various embodiments, the antigen binding molecule is a non-antibody binding protein. Protein molecules have been developed that target and bind to targets in a manner similar to antibodies. Certain of these antibody mimics use non-immunoglobulin protein scaffolds as alternative protein frameworks for the variable regions of antibodies.
[0117] For example, Ladner et al. (U.S. Pat. No. 5,260,203) describe single polypeptide chain binding molecules with binding specificity similar to that of the aggregated, but molecularly separate, light and heavy chain variable region of antibodies. The single-chain binding molecule contains the antigen binding sites of both the heavy and light variable regions of an antibody connected by a peptide linker and will fold into a structure similar to that of the two peptide antibody. The single-chain binding molecule displays several advantages over conventional antibodies, including, smaller size, greater stability and are more easily modified.
[0118] Ku et al. (Proc. Natl. Acad. Sci. U.S.A. 92(14):6552-6556 (1995)) discloses an alternative to antibodies based on cytochrome b562. Ku et al. (1995) generated a library in which two of the loops of cytochrome b562 were randomized and selected for binding against bovine serum albumin. The individual mutants were found to bind selectively with BSA similarly with anti-BSA antibodies.
[0119] Lipovsek el al. (U.S. Pat. Nos. 6,818,418 and 7,115,396) discloses an antibody mimic featuring a fibronectin or fibronectin-like protein scaffold and at least one variable loop. Known as Adnectins, these fibronectin-based antibody mimics exhibit many of the same characteristics of natural or engineered antibodies, including high affinity and specificity for any targeted ligand. Any technique for evolving new or improved binding proteins can be used with these antibody mimics.
[0120] The structure of these fibronectin-based antibody mimics is similar to the structure of the variable region of the IgG heavy chain. Therefore, these mimics display antigen binding properties similar in nature and affinity to those of native antibodies. Further, these fibronectin-based antibody mimics exhibit certain benefits over antibodies and antibody fragments. For example, these antibody mimics do not rely on disulfide bonds for native fold stability, and are, therefore, stable under conditions which would normally break down antibodies. In addition, since the structure of these fibronectin-based antibody mimics is similar to that of the IgG heavy chain, the process for loop randomization and shuffling can be employed in vitro that is similar to the process of affinity maturation of antibodies in vivo.
[0121] Beste et al. (Proc. Natl. Acad. Sci. U.S.A. 96(5): 1898-1903 (1999)) discloses an antibody mimic based on a lipocalin scaffold (Anticalin). Lipocalins are composed of a -barrel with four hypervariable loops at the terminus of the protein. Beste (1999), subjected the loops to random mutagenesis and selected for binding with, for example, fluorescein. Three variants exhibited specific binding with fluorescein, with one variant showing binding similar to that of an anti-fluorescein antibody. Further analysis revealed that all of the randomized positions are variable, indicating that Anticalin would be suitable to be used as an alternative to antibodies. Anticalins are small, single chain peptides, typically between 160 and 180 residues, which provide several advantages over antibodies, including decreased cost of production, increased stability in storage and decreased immunological reaction.
[0122] Hamilton et al. (U.S. Pat. No. 5,770,380) discloses a synthetic antibody mimic using the rigid, non-peptide organic scaffold of calixarene, attached with multiple variable peptide loops used as binding sites. The peptide loops all project from the same side geometrically from the calixarene, with respect to each other. Because of this geometric confirmation, all of the loops are available for binding, increasing the binding affinity to a ligand. However, in comparison to other antibody mimics, the calixarene-based antibody mimic does not consist exclusively of a peptide, and therefore it is less vulnerable to attack by protease enzymes. Neither does the scaffold consist purely of a peptide, DNA or RNA, meaning this antibody mimic is relatively stable in extreme environmental conditions and has a long life span. Further, since the calixarene-based antibody mimic is relatively small, it is less likely to produce an immunogenic response.
[0123] Murali et al. (Cell. Mol. Biol. 49(2):209-216 (2003)) discusses a methodology for reducing antibodies into smaller peptidomimetics, they term antibody like binding peptidomimetics (ABiP) which can also be useful as an alternative to antibodies.
[0124] Silverman el al. (Nat. Biotechnol. (2005), 23: 1556-1561) discloses fusion proteins that are single-chain polypeptides comprising multiple domains termed avimers. Developed from human extracellular receptor domains by in vitro exon shuffling and phage display the avimers are a class of binding proteins somewhat similar to antibodies in their affinities and specificities for various target molecules. The resulting multidomain proteins can comprise multiple independent binding domains that can exhibit improved affinity (in some cases sub-nanomolar) and specificity compared with single-epitope binding proteins. Additional details concerning methods of construction and use of avimers are disclosed, for example, in U.S. Patent App. Pub. Nos. 20040175756, 20050048512, 20050053973, 20050089932 and 20050221384.
[0125] In addition to non-immunoglobulin protein frameworks, antibody properties have also been mimicked in compounds comprising RNA molecules and unnatural oligomers (e.g., protease inhibitors, benzodiazepines, purine derivatives and beta-turn mimics) all of which are suitable for use with the present invention.
[0126] b. Anti-MPR1 Antibodies
[0127] In various embodiments, the antigen binding molecule is an antibody or antibody fragment that binds to MPR1 and inhibits the metalloprotease activity of MPR1. Such anti-MPR1 antibodies are useful for preventing, delaying, inhibiting and treating the progression of a Cryptococcus infection and infection of the CNS and/or brain tissues of a subject by Cryptococcus.
[0128] An antibody suitable for treating, mitigating, delaying and/or preventing Cryptococcus infection in a subject is specific for at least one portion of the MPR1 polypeptide, e.g., the catalytic domain. For example, one of skill in the art can use peptides derived from the catalytic domain of a fungal-specific MPR1 to generate appropriate antibodies suitable for use with the invention. Illustrative, non-limiting amino sequences suitable for use in selecting peptides for use as antigens are published as GenBank accession numbers XP_567342.1 (Cryptococcus neoformans var. neoformans), XP_003196170.1 (Cryptococcus gattii), as well as SEQ ID NOs. 1, 3, 5 and 7.
[0129] Anti-MPR1 antibodies for use in the present methods include without limitation, polyclonal antibodies, monoclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, and fragments thereof.
[0130] The preparation of polyclonal antibodies is well-known to those skilled in the art. See, for example, Green et al., Production of Polyclonal Antisera, in IMMUNOCHEMICAL PROTOCOLS (Manson, ed), pages 1-5 (Humana Press 1992), Coligan et al, Production of Polyclonal Antisera in Rabbits, Rats. Mice and Hamsters, in CURRENT PROTOCOLS IN IMMUNOLOGY, section 2 4 1 (1992), which are hereby incorporated by reference.
[0131] The preparation of monoclonal antibodies likewise is conventional. See, for example, Kohler & Milstem, Nature 256 495 (1975). Coligan et al., sections 2.5.1-2.6.7, Harlow et al, ANTIBODIES A LABORATORY MANUAL, page 726 (Cold Spring Harbor Pub 1988, and Harlow, USING ANTIBODIES A LABORATORY MANUAL, Cold Spring Harbor Laboratory Press, 1998), which are hereby incorporated by reference Briefly, monoclonal antibodies can be obtained by injecting mice with a composition comprising an antigen, verifying the presence of antibody production by removing a serum sample, removing the spleen to obtain B lymphocytes, fusing the B lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas selecting positive clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures. Monoclonal antibodies can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion-exchange chromatography. See, e g., Coligan et al. sections 2.7.1-2.7.12 and sections 2.9.1-2.9.3, Barnes et al., Purification of Immunoglobulin G (IgG), in METHODS IN MOLECULAR BIOLOGY, VOL 10, pages 79-104 (Humana Press 1992).
[0132] Methods of in vitro and in vivo multiplication of monoclonal antibodies is well-known to those skilled in the art Multiplication in vitro can be carried out in suitable culture media such as Dulbecco's Modified Eagle Medium or RPMI 1640 medium, optionally replenished by a mammalian serum such as fetal calf serum or trace elements and growth-sustaining supplements such as normal mouse peritoneal exudate cells, spleen cells, bone marrow macrophages. Production in vitro provides relatively pure antibody preparations and allows scale-up to yield large amounts of the desired antibodies. Large scale hybridoma cultivation can be carried out by homogenous suspension culture in an airlift reactor, in a continuous stirrer reactor, or in immobilized or entrapped cell culture. Multiplication in vivo can be carried out by injecting cell clones into mammals histocompatible with the parent cells, e.g., syngeneic mice, to cause growth of antibody-producing tumors. Optionally, the animals are primed with a hydrocarbon, especially oils such as pristane (tetramethylpentadecane) prior to injection. After one to three weeks, the desired monoclonal antibody is recovered from the body fluid of the animal.
[0133] Anti-MPR1 antibodies can be altered or produced for therapeutic applications. For example, antibodies of the present invention can also be derived from subhuman primate antibody. General techniques for raising therapeutically useful antibodies in baboons can be found, for example, in Goldenberg et al., International Patent Publication WO 91/11465 (1991) and Losman et al., Int. J. Cancer 46:310 (1990), which are hereby incorporated by reference.
[0134] Alternatively, therapeutically useful anti-MPR1 antibodies can be derived from a humanized monoclonal antibody. Humanized monoclonal antibodies are produced by transferring mouse complementarity determining regions from heavy and light variable chains of the mouse immunoglobulin into a human variable domain, and then substituting human residues in the framework regions of the murine counterparts. The use of antibody components derived from humanized monoclonal antibodies obviates potential problems associated with the immunogenicity of murine constant regions. General techniques for cloning murine immunoglobulin variable domains are described, for example, by Orlandi, et al., Proc. Nat'l Acad. Sci. USA 86:3833 (1989), which is hereby incorporated in its entirety by reference. Techniques for producing humanized monoclonal antibodies are described, for example, by Jones et al., Nature 321:522 (1986); Riechmann et al., Nature 332:323 (1988); Verhoeyen et al., Science 239:1534 (1988); Carter et al. Proc. Nat'l Acad. Sci. USA 89:4285 (1992); Sandhu, Crit. Rev. Biotech. 12:437 (1992); and Singer et al., J. Immunol. 150:2844 (1993), which are hereby incorporated by reference.
[0135] Anti-MPR1 antibodies for use in the present methods also can be derived from human antibody fragments isolated from a combinatorial immunoglobulin library. See, for example, Barbas, et al., METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, VOL. 2, page 119 (1991); Winter et al., Ann. Rev. Immunol. 12:433 (1994), which are hereby incorporated herein by reference. Cloning and expression vectors that are useful for producing a human immunoglobulin phage library can be obtained, for example, from STRATAGENE Cloning Systems (now Agilent Technologies).
[0136] In addition, anti-MPR1 antibodies for the mitigation, delay, treatment and/or prevention of Cryptococcus infection of the CNS and/or brain tissues can be derived from a human monoclonal antibody. Such antibodies are obtained from transgenic mice that have been engineered to produce specific human antibodies in response to antigenic challenge. In this technique, elements of the human heavy and light chain loci are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous heavy and light chain loci. The transgenic mice can synthesize human antibodies specific for human antigens, and the mice can be used to produce human antibody-secreting hybridomas. Methods for obtaining human antibodies from transgenic mice are described by Green et al., Nature Genet. 7:13 (1994); Lonberg et al. Nature 368:856 (1994); and Taylor et al., Int. Immunol. 6:579 (1994), which are hereby incorporated by reference.
[0137] In various embodiments, the antibodies are human IgG immunoglobulin. As appropriate or desired, the IgG can be of an isotype to promote antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement-dependent cellular cytotoxicity (CDCC), e.g., human IgG1 or human IgG3.
[0138] Antibody fragments for use in the present methods can be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli of DNA encoding the fragment. Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods. For example, antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a fragment denoted F(ab).sub.2- This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce Fab monovalent fragments. Alternatively, an enzymatic cleavage using pepsin produces two monovalent Fab fragments and an Fc fragment directly. These methods are described, for example, by Goldenberg, U.S. Pat. No. 4,036,945 and U.S. Pat. No. 4,331,647, and references contained therein. These patents are hereby incorporated in their entireties by reference. See also, Nisonhoff, et al., Arch. Biochem. Biophys. 89:230 (1960); Porter, Biochem. J. 73:119 (1959): Edelman et al., METHODS IN ENZYMOLOG Y, VOL. 1, page 422 (Academic Press 1967); and Coligan et al. at sections 2.8.1-2.8.10 and 2.10.1-2.10.4.
[0139] Other methods of cleaving antibodies, such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques can also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.
[0140] For example, Fv fragments comprise an association of VH and VL chains. This association can be noncovalent, as described in Inbar et al., Proc. Nat'l Acad. Sci. USA 69:2659 (1972). Alternatively, the variable chains can be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. See. e.g. Sandhu, Crit Rev Biotechnol. 1992; 12(5-6):437-62. In some embodiments, the Fv fragments comprise VH and VL chains connected by a peptide linker. These single-chain antigen binding proteins (sFv) are prepared by constructing a structural gene comprising DNA sequences encoding the VH and VL domains connected by an oligonucleotide. The structural gene is inserted into an expression vector, which is subsequently introduced into a host cell such as E. coli. The recombinant host cells synthesize a single polypeptide chain with a linker peptide bridging the two V domains. Methods for producing sFv are described, for example, by Whitlow et al, METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, VOL. 2, page 97 (1991); Bird et al, Science 242:423-426 (1988); Ladner, et al, U.S. Pat. No. 4,946,778; Pack, et al, BioTechnology 11:1271 77 (1993); and Sandhu, supra.
[0141] Another form of an antibody fragment suitable for use with the methods of the present invention is a peptide coding for a single complementarity-determining region (CDR). CDR peptides (minimal recognition units) can be obtained by constructing genes encoding the CDR of an antibody of interest. Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody-producing cells. See, for example, Larrick et al, METHODS: A COMPANION TO METHODS IN ENZYMOLOG Y, VOL. 2, page 106 (1991), iv. Small Organic Compounds.
[0142] In some embodiments, the anti-MPR1 antibody is a single-domain antibody (sdAb) or a nanobody. A single-domain antibody or a nanobody is a fully functional antibody that lacks light chains; they are heavy-chain antibodies containing a single variable domain (VHH) and two constant domains (CH2 and CH3). Like a whole antibody, single domain antibodies or nanobodies are able to bind selectively to a specific antigen. With a molecular weight of only 12-15 kDa, single-domain antibodies are much smaller than common antibodies (150-160 kDa) composed of two heavy protein chains and two light chains, and even smaller than Fab fragments (50 kDa, one light chain and half a heavy chain) and single-chain variable fragments (25 kDa, two variable domains, one from a light and one from a heavy chain). Nanobodies are more potent and more stable than conventional four-chain antibodies which leads to (1) lower dosage forms, less frequent dosage leading to less side effects; and (2) improved stability leading to a broader choice of administration routes, comprising oral or subcutaneous routes and slow-release formulations in addition to the intravenous route. Slow-release formulation with stable anti-MPR1 nanobodies, find use for the mitigation, delay, treatment and prevention of Cryptococcus infection of the CNS and/or brain, avoiding the need of repeated inj ections and the side effects associated with it. Because of their small size, nanobodies have the ability to cross membranes and penetrate into physiological compartments, tissues and organs not accessible to other, larger polypeptides and proteins.
[0143] Preferably, the antibodies are humanized for use in treating or preventing Cryptococcus infections in humans.
[0144] iii. Inhibiting MPR1 Expression
[0145] Decreasing or inhibiting MPR1 gene expression can be achieved using any method in the art, including through the use of inhibitory nucleic acids (e.g., small interfering RNA (siRNA), micro RNA (miRNA), antisense RNA, ribozymes, etc.). Inhibitory nucleic acids can be single-stranded nucleic acids that can specifically bind to a complementary nucleic acid sequence. By binding to the appropriate target sequence, an RNA-RNA, a DNA-DNA, or an RNA-DNA duplex or triplex is formed. Such inhibitory nucleic acids can be in either the sense or antisense orientation. See, for example, Tafech, et al., Curr Med Chem (2006) 13:863-81; Mahato, et al., Expert Opin Drug Deliv (2005) 2:3-28; Scanlon, Curr Pharm Biotechnol (2004) 5:415-20; and Scherer and Rossi, Nat Biotechnol (2003) 21:1457-65.
[0146] In one embodiment, the inhibitory nucleic acid can specifically bind to a target nucleic acid sequence or subsequence that encodes a Cryptococcus MPR1. Administration of such inhibitory nucleic acids can decrease or inhibit the metalloprotease activity of MPR1 and consequently, cryptococcal infection of the CNS and/or brain tissues. Nucleotide sequences encoding a Cryptococcus MPR1 are known for several Cryptococcus MPR1 species, including e.g., nucleic acid sequences of SEQ ID NOs. 2, 4, 6 and 8, and nucleic acid sequences encoding the MPR1 metalloproteases of GenBank references XP_567342.1 (Cryptococcus neoformans var. neoformans), XP_003196170.1 (Cryptococcus gattii), as well as SEQ ID NOs. 1, 3, 5 and 7. From these nucleotide sequences, one can derive a suitable inhibitory nucleic acid.
[0147] 1. Antisense Oligonucleotides
[0148] In some embodiments, the inhibitory nucleic acid is an antisense molecule. Antisense oligonucleotides are relatively short nucleic acids that are complementary (or antisense) to the coding strand (sense strand) of the mRNA encoding a fungal specific MPR1. Although antisense oligonucleotides are typically RNA based, they can also be DNA based. Additionally, antisense oligonucleotides are often modified to increase their stability.
[0149] Without being bound by theory, the binding of these relatively short oligonucleotides to the mRNA is believed to induce stretches of double stranded RNA that trigger degradation of the messages by endogenous RNAses. Additionally, sometimes the oligonucleotides are specifically designed to bind near the promoter of the message, and under these circumstances, the antisense oligonucleotides may additionally interfere with translation of the message. Regardless of the specific mechanism by which antisense oligonucleotides function, their administration to a cell or tissue allows the degradation of the mRNA encoding a Cryptococcus MPR1. Accordingly, antisense oligonucleotides decrease the expression and/or activity of MPR1.
[0150] The oligonucleotides can be DNA or RNA or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double-stranded. The oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve stability of the molecule, hybridization, etc. The oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., 1989, Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaitre et al., 1987, Proc. Natl. Acad. Sci. 84:648-652; PCT Publication No. WO 88/09810) or the blood-brain barrier (see, e.g., PCT Publication No. WO 89/10134), hybridization-triggered cleavage agents (See, e.g., Krol et al., 1988, BioTechniques 6:958-976) or intercalating agents. (See, e.g., Zon, 1988, Pharm. Res. 5:539-549). To this end, the oligonucleotide can be conjugated to another molecule.
[0151] The antisense oligonucleotide may comprise at least one modified base moiety which is selected from the group including but not limited to 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxytriethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethyl aminomet-hyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methyl aminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methyl ester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine.
[0152] The antisense oligonucleotide may also comprise at least one modified sugar moiety selected from the group including but not limited to arabinose, 2-fluoroarabinose, xylulose, and hexose.
[0153] The antisense oligonucleotide can also contain a neutral peptide-like backbone. Such molecules are termed peptide nucleic acid (PNA)-oligomers and are described, e.g., in Perry-O'Keefe et al. (1996) Proc. Natl. Acad. Sci. U.S.A. 93:14670 and in Eglom et al. (1993) Nature 365:566. One advantage of PNA oligomers is their capability to bind to complementary DNA essentially independently from the ionic strength of the medium due to the neutral backbone of the DNA. In yet another embodiment, the antisense oligonucleotide comprises at least one modified phosphate backbone selected from the group consisting of a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphoramidate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.
[0154] In yet a further embodiment, the antisense oligonucleotide is an-anomeric oligonucleotide. An anomeric oligonucleotide forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual-units, the strands run parallel to each other (Gautier et al., 1987, Nucl. Acids Res. 15:6625-6641). The oligonucleotide is a 2-O-methylribonucleotide (Inoue et al., 1987, Nucl. Acids Res. 15:6131-6148), or a chimeric RNA-DNA analogue (Inoue et al., 1987, FEBS Lett. 215:327-330).
[0155] Oligonucleotides of the invention may be synthesized by standard methods known in the art, e.g., by use of an automated DNA synthesizer (such as are commercially available from Biosearch, Applied Biosystems, etc.). As examples, phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (1988, Nucl. Acids Res. 16:3209), methylphosphonate oligonucleotides can be prepared by use of controlled pore glass polymer supports (Sarin et al., 1988, Proc. Natl. Acad. Sci. U.S.A. 85:7448-7451), etc.
[0156] The selection of an appropriate oligonucleotide can be readily performed by one of skill in the art. Given the nucleic acid sequence encoding a fungal-specific MPR1, one of skill in the art can design antisense oligonucleotides that bind to a target nucleic acid sequence and test these oligonucleotides in an in vitro or in vivo system to confirm that they bind to and mediate the degradation of the mRNA encoding the fungal specific MPR1. To design an antisense oligonucleotide that specifically binds to and mediates the degradation of a fungal-specific MPR1 encoding nucleic acid, it is preferred that the sequence recognized by the oligonucleotide is unique or substantially unique to the fungal specific MPR1 to be inhibited. For example, sequences that are frequently repeated across an encoding sequence may not be an ideal choice for the design of an oligonucleotide that specifically recognizes and degrades a particular message. One of skill in the art can design an oligonucleotide, and compare the sequence of that oligonucleotide to nucleic acid sequences that are deposited in publicly available databases to confirm that the sequence is specific or substantially specific for a fungal specific MPR1.
[0157] A number of methods have been developed for delivering antisense DNA or RNA to cells; e.g., antisense molecules can be injected directly into the tissue site, or modified antisense molecules, designed to target the desired cells (e.g., antisense linked to peptides or antibodies that specifically bind receptors or antigens expressed on the target cell surface) can be administered systematically.
[0158] However, it may be difficult to achieve intracellular concentrations of the antisense sufficient to suppress translation on endogenous mRNAs in certain instances. Therefore another approach utilizes a recombinant DNA construct in which the antisense oligonucleotide is placed under the control of a strong pol III or pol II promoter. For example, a vector can be introduced in vivo such that it is taken up by a cell and directs the transcription of an antisense RNA. Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA. Such vectors can be constructed by recombinant DNA technology methods standard in the art. Vectors can be plasmid, viral, or others known in the art, used for replication and expression in mammalian cells. Expression of the sequence encoding the antisense RNA can be by any promoter known in the art to act in mammalian, preferably human cells. Such promoters can be inducible or constitutive. Such promoters include but are not limited to: the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304-310), the promoter contained in the 3 long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster et al, 1982, Nature 296:39-42), etc. Any type of plasmid, cosmid, YAC or viral vector can be used to prepare the recombinant DNA construct that can be introduced directly into the tissue site. Alternatively, viral vectors can be used which selectively infect the desired tissue, in which case administration may be accomplished by another route (e.g., systematically).
[0159] 2. Small Interfering RNA (siRNA or RNAi)
[0160] In some embodiments, the inhibitory nucleic acid is a small interfering RNA (siRNA or RNAi) molecule. RNAi constructs comprise double stranded RNA that can specifically block expression of a target gene. RNA interference or RNAi is a term initially applied to a phenomenon where double-stranded RNA (dsRNA) blocks gene expression in a specific and post-transcriptional manner. RNAi provides a useful method of inhibiting gene expression in vitro or in vivo. RNAi constructs can include small interfering RNAs (siRNAs), hairpin RNAs, and other RNA species which can be cleaved in vivo to form siRNAs. RNAi constructs herein also include expression vectors (RNAi expression vectors) capable of giving rise to transcripts which form dsRNAs or hairpin RNAs in cells, and/or transcripts which can produce siRNAs in vivo.
[0161] RNAi expression vectors express (transcribe) RNA which produces siRNA moieties in the cell in which the construct is expressed. Such vectors include a transcriptional unit comprising an assembly of (1) genetic element(s) having a regulatory role in gene expression, for example, promoters, operators, or enhancers, operatively linked to (2) a coding sequence which is transcribed to produce a double-stranded RNA (two RNA moieties that anneal in the cell to form an siRNA, or a single hairpin RNA which can be processed to an siRNA), and (3) appropriate transcription initiation and termination sequences. The choice of promoter and other regulatory elements generally varies according to the intended host cell.
[0162] The RNAi constructs contain a nucleotide sequence that hybridizes under physiologic conditions of the cell to the nucleotide sequence of at least a portion of the mRNA transcript for the gene to be inhibited (i.e., a fungal-specific MPR1-encoding nucleic acid sequence). The double-stranded RNA need only be sufficiently similar to natural RNA that it has the ability to mediate RNAi. Thus, the invention has the advantage of being able to tolerate sequence variations that might be expected due to genetic mutation, strain polymorphism or evolutionary divergence. The number of tolerated nucleotide mismatches between the target sequence and the RNAi construct sequence is no more than 1 in 5 basepairs, or 1 in 10 basepairs, or 1 in 20 basepairs, or 1 in 50 basepairs. Mismatches in the center of the siRNA duplex are most critical and may essentially abolish cleavage of the target RNA. In contrast, nucleotides at the 3 end of the siRNA strand that is complementary to the target RNA do not significantly contribute to specificity of the target recognition.
[0163] Sequence identity can be optimized by sequence comparison and alignment algorithms known in the art (see Gribskov and Devereux, Sequence Analysis Primer, Stockton Press, 1991, and references cited therein) and calculating the percent difference between the nucleotide sequences by, for example, the Smith-Waterman algorithm as implemented in the BESTFIT software program using default parameters (e.g., University of Wisconsin Genetic Computing Group). Greater than 90% sequence identity, for example, 95%, 96%, 97%, 98%, 99%, or even 100% sequence identity, between the inhibitory RNA and the portion of the target gene is preferred. Alternatively, the duplex region of the RNA may be defined functionally as a nucleotide sequence that is capable of hybridizing with a portion of the target gene transcript (e.g., 400 mM NaCl, 40 mM PIPES pH 6.4, 1 mM EDTA, 50 C. or 70 C. hybridization for 12-16 hours; followed by washing).
[0164] Production of RNAi constructs can be carried out by chemical synthetic methods or by recombinant nucleic acid techniques. Endogenous RNA polymerase of the treated cell may mediate transcription in vivo, or cloned RNA polymerase can be used for transcription in vitro. The RNAi constructs may include modifications to either the phosphate-sugar backbone or the nucleoside, e.g., to reduce susceptibility to cellular nucleases, improve bioavailability, improve formulation characteristics, and/or change other pharmacokinetic properties. For example, the phosphodiester linkages of natural RNA may be modified to include at least one of an nitrogen or sulfur heteroatom. Modifications in RNA structure may be tailored to allow specific genetic inhibition while avoiding a general response to dsRNA. Likewise, bases may be modified to block the activity of adenosine deaminase. The RNAi construct may be produced enzymatically or by partial/total organic synthesis, any modified ribonucleotide can be introduced by in vitro enzymatic or organic synthesis.
[0165] Methods of chemically modifying RNA molecules can be adapted for modifying RNAi constructs (see, for example, Heidenreich et al. (1997) Nucleic Acids Res, 25:776-780; Wilson et al. (1994) J Mol Recog 7:89-98; Chen et al. (1995) Nucleic Acids Res 23:2661-2668; Hirschbein et al. (1997) Antisense Nucleic Acid Drug Dev 7:55-61). Merely to illustrate, the backbone of an RNAi construct can be modified with phosphorothioates, phosphoramidate, phosphodithioates, chimeric methylphosphonate-phosphodie-sters, peptide nucleic acids, 5-propynyl-pyrimidine containing oligomers or sugar modifications (e.g., 2-substituted ribonucleosides, a-configuration).
[0166] The double-stranded structure may be formed by a single self-complementary RNA strand or two complementary RNA strands. RNA duplex formation may be initiated either inside or outside the cell. The RNA may be introduced in an amount which allows delivery of at least one copy per cell. Higher doses (e.g., at least 5, 10, 100, 500 or 1000 copies per cell) of double-stranded material may yield more effective inhibition, while lower doses may also be useful for specific applications. Inhibition is sequence-specific in that nucleotide sequences corresponding to the duplex region of the RNA are targeted for genetic inhibition.
[0167] In certain embodiments, the subject RNAi constructs are small interfering RNAs or siRNAs. These nucleic acids are around 19-30 nucleotides in length, and even more preferably 21-23 nucleotides in length, e.g., corresponding in length to the fragments generated by nuclease dicing of longer double-stranded RNAs. The siRNAs are understood to recruit nuclease complexes and guide the complexes to the target mRNA by pairing to the specific sequences. As a result, the target mRNA is degraded by the nucleases in the protein complex. In a particular embodiment, the 21-23 nucleotides siRNA molecules comprise a 3 hydroxyl group.
[0168] The siRNA molecules of the present invention can be obtained using a number of techniques known to those of skill in the art. For example, the siRNA can be chemically synthesized or recombinantly produced using methods known in the art. For example, short sense and antisense RNA oligomers can be synthesized and annealed to form double-stranded RNA structures with 2-nucleotide overhangs at each end (Caplen, et al. (2001) Proc Natl Acad Sci USA, 98:9742-9747; Elbashir, et al. (2001) EMBO J, 20:6877-88). These double-stranded siRNA structures can then be directly introduced to cells, either by passive uptake or a delivery system of choice, such as described below.
[0169] In certain embodiments, the siRNA constructs can be generated by processing of longer double-stranded RNAs, for example, in the presence of the enzyme dicer. In one embodiment, the Drosophila in vitro system is used. In this embodiment, dsRNA is combined with a soluble extract derived from Drosophila embryo, thereby producing a combination. The combination is maintained under conditions in which the dsRNA is processed to RNA molecules of about 21 to about 23 nucleotides.
[0170] The siRNA molecules can be purified using a number of techniques known to those of skill in the art. For example, gel electrophoresis can be used to purify siRNAs. Alternatively, non-denaturing methods, such as non-denaturing column chromatography, can be used to purify the siRNA. In addition, chromatography (e.g., size exclusion chromatography), glycerol gradient centrifugation, affinity purification with antibody can be used to purify siRNAs.
[0171] In certain preferred embodiments, at least one strand of the siRNA molecules has a 3 overhang from about 1 to about 6 nucleotides in length, though may be from 2 to 4 nucleotides in length. More preferably, the 3 overhangs are 1-3 nucleotides in length. In certain embodiments, one strand having a 3 overhang and the other strand being blunt-ended or also having an overhang. The length of the overhangs may be the same or different for each strand. In order to further enhance the stability of the siRNA, the 3 overhangs can be stabilized against degradation. In one embodiment, the RNA is stabilized by including purine nucleotides, such as adenosine or guanosine nucleotides. Alternatively, substitution of pyrimidine nucleotides by modified analogues, e.g., substitution of uridine nucleotide 3 overhangs by 2-deoxythyinidine is tolerated and does not affect the efficiency of RNAi. The absence of a 2 hydroxyl significantly enhances the nuclease resistance of the overhang in tissue culture medium and may be beneficial in vivo.
[0172] In other embodiments, the RNAi construct is in the form of a long double-stranded RNA. In certain embodiments, the RNAi construct is at least 25, 50, 100, 200, 300 or 400 bases. In certain embodiments, the RNAi construct is 400-800 bases in length. The double-stranded RNAs are digested intracellularly, e.g., to produce siRNA sequences in the cell. However, use of long double-stranded RNAs in vivo is not always practical, presumably because of deleterious effects which may be caused by the sequence-independent dsRNA response. In such embodiments, the use of local delivery systems and/or agents which reduce the effects of interferon are preferred.
[0173] In certain embodiments, the RNAi construct is in the form of a hairpin structure (named as hairpin RNA). The hairpin RNAs can be synthesized exogenously or can be formed by transcribing from RNA polymerase III promoters in vivo. Examples of making and using such hairpin RNAs for gene silencing in mammalian cells are described in, for example, Paddison et al., Genes Dev, 2002, 16:948-58; McCaffrey et al., Nature, 2002, 418:38-9; McManus et al., RNA, 2002, 8:842-50; Yu et al., Proc Natl Acad Sci USA, 2002, 99:6047-52). Preferably, such hairpin RNAs are engineered in cells or in an animal to ensure continuous and stable suppression of a desired gene. It is known in the art that siRNAs can be produced by processing a hairpin RNA in the cell.
[0174] In yet other embodiments, a plasmid is used to deliver the double-stranded RNA, e.g., as a transcriptional product. In such embodiments, the plasmid is designed to include a coding sequence for each of the sense and antisense strands of the RNAi construct. The coding sequences can be the same sequence, e.g., flanked by inverted promoters, or can be two separate sequences each under transcriptional control of separate promoters. After the coding sequence is transcribed, the complementary RNA transcripts base-pair to form the double-stranded RNA.
[0175] PCT application WO 01/77350 describes an exemplary vector for bi-directional transcription of a transgene to yield both sense and antisense RNA transcripts of the same transgene in a eukaryotic cell. Accordingly, in certain embodiments, the present invention provides a recombinant vector having the following unique characteristics: it comprises a viral replicon having two overlapping transcription units arranged in an opposing orientation and flanking a transgene for an RNAi construct of interest, wherein the two overlapping transcription units yield both sense and antisense RNA transcripts from the same transgene fragment in a host cell.
[0176] RNAi constructs can comprise either long stretches of double stranded RNA identical or substantially identical to the target nucleic acid sequence or short stretches of double stranded RNA identical to substantially identical to only a region of the target nucleic acid sequence. Exemplary methods of making and delivering either long or short RNAi constructs can be found, for example, in WO 01/68836 and WO 01/75164.
[0177] Exemplary RNAi constructs that specifically recognize a particular gene, or a particular family of genes can be selected using methodology outlined in detail above with respect to the selection of antisense oligonucleotide. Similarly, methods of delivery RNAi constructs include the methods for delivery antisense oligonucleotides outlined in detail above.
[0178] 3. Ribozymes
[0179] In some embodiments, the inhibitory nucleic acid is a ribozyme. Ribozymes molecules designed to catalytically cleave an mRNA transcripts can also be used to prevent translation of mRNA (See, e.g., PCT International Publication WO 90/11364; Sarver et al., 1990, Science 247:1222-1225 and U.S. Pat. No. 5,093,246). While ribozymes that cleave mRNA at site-specific recognition sequences can be used to destroy particular mRNAs, the use of hammerhead ribozymes is preferred. Hammerhead ribozymes cleave mRNAs at locations dictated by flanking regions that form complementary base pairs with the target mRNA. The sole requirement is that the target mRNA have the following sequence of two bases: 5-UG-3. The construction and production of hammerhead ribozymes is well known in the art and is described more fully in Haseloff and Gerlach, 1988, Nature, 334:585-591.
[0180] The ribozymes of the present invention also include RNA endoribonucleases (hereinafter Cech-type ribozymes) such as the one which occurs naturally in Tetrahymena thermophila (known as the IVS, or L-19 IVS RNA) and which has been extensively described by Thomas Cech and collaborators (Zaug, et al., 1984, Science, 224:574-578; Zaug and Cech, 1986, Science, 231:470-475; Zaug, et al., 1986, Nature, 324:429-433; WO 88/04300; Been and Cech, 1986, Cell, 47:207-216). The Cech-type ribozymes have an eight base pair active site that hybridizes to a target RNA sequence whereafter cleavage of the target RNA takes place. The invention encompasses those Cech-type ribozymes that target eight base-pair active site sequences.
[0181] As in the antisense approach, the ribozymes can be composed of modified oligonucleotides (e.g., for improved stability, targeting, etc.) and can be delivered to cells in vitro or in vivo. A preferred method of delivery involves using a DNA construct encoding the ribozyme under the control of a strong constitutive pol III or pol II promoter, so that transfected cells will produce sufficient quantities of the ribozyme to destroy targeted messages and inhibit translation. Because ribozymes unlike antisense molecules, are catalytic, a lower intracellular concentration is required for efficiency.
[0182] DNA enzymes incorporate some of the mechanistic features of both antisense and ribozyme technologies. DNA enzymes are designed so that they recognize a particular target nucleic acid sequence, much like an antisense oligonucleotide, however much like a ribozyme they are catalytic and specifically cleave the target nucleic acid.
[0183] There are currently two basic types of DNA enzymes, and both of these were identified by Santoro and Joyce (see, for example, U.S. Pat. No. 6,110,462). The 10-23 DNA enzyme comprises a loop structure which connect two arms. The two arms provide specificity by recognizing the particular target nucleic acid sequence while the loop structure provides catalytic function under physiological conditions.
[0184] Briefly, to design an ideal DNA enzyme that specifically recognizes and cleaves a target nucleic acid, one of skill in the art must first identify the unique target sequence. This can be done using the same approach as outlined for antisense oligonucleotides. Preferably, the unique or substantially sequence is a G/C rich of approximately 18 to 22 nucleotides. High G/C content helps insure a stronger interaction between the DNA enzyme and the target sequence.
[0185] When synthesizing the DNA enzyme, the specific antisense recognition sequence that will target the enzyme to the message is divided so that it comprises the two arms of the DNA enzyme, and the DNA enzyme loop is placed between the two specific arms.
[0186] Methods of making and administering DNA enzymes can be found, for example, in U.S. Pat. No. 6,110,462. Similarly, methods of delivery DNA ribozymes in vitro or in vivo include methods of delivery RNA ribozyme, as outlined in detail above. Additionally, one of skill in the art will recognize that, like antisense oligonucleotide, DNA enzymes can be optionally modified to improve stability and improve resistance to degradation.
[0187] c. Screening for Inhibitors of MPR1
[0188] One can identify lead compounds that are suitable for further testing to identify those that are therapeutically effective inhibitory agents by screening a variety of compounds and mixtures of compounds for their ability to decrease or inhibit fungal-specific MPR1 metalloprotease activity and/or prevent or inhibit Cryptococcus infection of the CNS and/or brain tissue in vivo and/or prevent, reduce or inhibit the ability of Cryptococcus to cross the blood-brain-barrier in in vivo and in vitro assays, as described herein.
[0189] The use of screening assays to discover naturally occurring compounds with desired activities is well known and has been widely used for many years. For instance, many compounds with antibiotic activity were originally identified using this approach. Examples of such compounds include monolactams and aminoglycoside antibiotics. Compounds which inhibit various enzyme activities have also been found by this technique, for example, mevinolin, lovastatin, and mevacor, which are inhibitors of hydroxymethylglutamyl Coenzyme A reductase, an enzyme involved in cholesterol synthesis. Antibiotics that inhibit glycosyltransferase activities, such as tunicamycin and streptovirudin have also been identified in this manner.
[0190] Thus, another important aspect of the present invention is directed to methods for screening samples for inhibition or reduction of fungal-specific MPR1 activity. A sample as used herein can be any mixture of compounds suitable for testing in a MPR1 metalloprotease assay. A typical sample comprises a mixture of synthetically produced compounds or alternatively a naturally occurring mixture, such as a cell culture broth. Suitable cells include any cultured cells such as mammalian, insect, microbial or plant cells. Microbial cell cultures are composed of any microscopic organism such as bacteria, protozoa, yeast, fungi and the like.
[0191] In the typical screening assay, a sample, for example a fungal broth, is added to a standard fungal-specific MPR1 assay. If inhibition or enhancement of activity as compared to control assays is found, the mixture is usually fractionated to identify components of the sample providing the inhibiting or enhancing activity. The sample is fractionated using standard methods such as ion exchange chromatography, affinity chromatography, electrophoresis, ultrafiltration, HPLC and the like. See, e.g., Scopes, Protein Purification, Principles and Practice, 3rd Edition, 1994, Springer-Verlag. Each isolated fraction is then tested for inhibiting or enhancing activity. If desired, the fractions are then further subfractionated and tested. This subfractionation and testing procedure can be repeated as many times as desired.
[0192] By combining various standard purification methods, a substantially pure compound suitable for in vivo therapeutic testing can be obtained. A substantially pure modulating agent as defined herein is an activity inhibiting or enhancing compound which migrates largely as a single band under standard electrophoretic conditions or largely as a single peak when monitored on a chromatographic column. More specifically, compositions of substantially pure modulating agents will comprise less than ten percent miscellaneous compounds.
[0193] In preferred embodiments, the assays are designed to screen large chemical libraries by automating the assay steps and providing compounds from any convenient source to assays, which are typically run in parallel (e.g., in microtiter formats on microtiter plates in robotic assays).
[0194] As noted, the invention provides in vitro assays for fungal-specific MPR1 metalloprotease activity in a high throughput format. For each of the assay formats described, no inhibitor control reactions which do not include an inhibitory agent provide a background level of MPR1 metalloprotease activity. In the high throughput assays of the invention, it is possible to screen up to several thousand different modulators in a single day. In particular, each well of a microtiter plate can be used to run a separate assay against a selected potential modulator, or, if concentration or incubation time effects are to be observed, every 5-10 wells can test a single modulator. Thus, a single standard microtiter plate can assay about 100 (e.g., 96) modulators. If 1536 well plates are used, then a single plate can easily assay from about 100- about 1500 different compounds. It is possible to assay many different plates per day; assay screens for up to about 6,000-20,000, and even up to about 100,000-1,000,000 different compounds is possible using the integrated systems of the invention. The steps of labeling, addition of reagents, fluid changes, and detection are compatible with full automation, for instance using programmable robotic systems or integrated systems commercially available, for example, through BioTX Automation, Conroe, Tex.; Qiagen, Valencia, Calif.; Beckman Coulter, Fullerton, Calif.; and Caliper Life Sciences, Hopkinton, Mass.
[0195] In some assays it will be desirable to have positive controls to ensure that the components of the assays are working properly. For example, a known inhibitor of MPR1 metalloprotease activity can be incubated with one sample of the assay, and the resulting increase or decrease in signal determined according to the methods herein.
[0196] Essentially any chemical compound can be screened as a potential inhibitor of fungal-specific MPR1 metalloprotease activity in the assays of the invention. Most preferred are generally compounds that can be dissolved in aqueous or organic (especially DMSO-based) solutions and compounds which fall within Lipinski's Rule of 5 criteria. The assays are designed to screen large chemical libraries by automating the assay steps and providing compounds from any convenient source to assays, which are typically run in parallel (e.g., in microtiter formats on multiwell plates in robotic assays). It will be appreciated that there are many suppliers of chemical compounds, including Sigma-Aldrich (St. Louis, Mo.); Fluka Chemika-Biochemica Analytika (Buchs Switzerland), as well as numerous providers of small organic molecule libraries ready for screening, including Chembridge Corp. (San Diego, Calif.), Discovery Partners International (San Diego, Calif.), Triad Therapeutics (San Diego, Calif.), Nanosyn (Menlo Park, Calif.), Affymax (Palo Alto, Calif.), ComGenex (South San Francisco, Calif.), Tripos, Inc. (St. Louis, Mo.), Reaction Biology Corp. (Malvern, Pa.), Biomol Intl. (Plymouth Meeting, Pa.), TimTec (Newark, Del.), and AnalytiCon (Potsdam, Germany), among others.
[0197] In one preferred embodiment, inhibitors of fungal-specific MPR1 metalloprotease activity are identified by screening a combinatorial library containing a large number of potential therapeutic compounds (potential inhibitor compounds). Such combinatorial chemical or peptide libraries can be screened in one or more assays, as described herein, to identify those library members particular chemical species or subclasses) that display a desired characteristic activity. The compounds thus identified can serve as conventional lead compounds or can themselves be used as potential or actual therapeutics.
[0198] A combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical building blocks such as reagents. For example, a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks (amino acids) in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.
[0199] Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Pat. No. 5,010,175, Furka, Int. J. Pept. Prot. Res. 37:487-493 (1991) and Houghton et al., Nature 354:84-88 (1991)). Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (PCT Publication No. WO 91/19735), encoded peptides (PCT Publication WO 93/20242), random bio-oligomers (PCT Publication No. WO 92/00091), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al., Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al., J. Amer. Chem. Soc. 114:6568 (1992)), nonpeptidal peptidomimetics with .beta.-D-glucose scaffolding (Hirschmann et al., J. Amer. Chem. Soc. 114:9217-9218 (1992)), analogous organic syntheses of small compound libraries (Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbamates (Cho et al., Science 261:1303 (1993)), and/or peptidyl phosphonates (Campbell et al., J. Org. Chem. 59:658 (1994)), nucleic acid libraries (see, Ausubel and Sambrook, all supra), peptide nucleic acid libraries (see, e.g., U.S. Pat. No. 5,539,083), antibody libraries (see, e.g., Vaughn et al., Nature Biotechnology, 14(3):309-314 (1996) and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang et al., Science, 274:1520-1522 (1996) and U.S. Pat. No. 5,593,853), small organic molecule libraries (see, e.g., benzodiazepines, Baum C&EN, January 18, page 33 (1993); isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No. 5,506,337; benzodiazepines, U.S. Pat. No. 5,288,514, and the like).
[0200] Devices for the preparation of combinatorial libraries are commercially available (see, e.g., 357 MPS, 390 MPS, Advanced Chem. Tech, Louisville Ky., Symphony, Rainin, Woburn, Mass., 433A Applied Biosystems, Foster City, Calif., 9050 Plus, Millipore, Bedford, Mass.).
[0201] Lead compounds that have been identified for their capability to reduce or inhibit the metalloprotease activity of a fungal-specific MPR1 in vitro are then evaluated for their ability to prevent, reduce or inhibit the ability of Cryptococcus to cross the blood-brain-barrier in in vivo and in vitro assays, as described herein, and/or to prevent or inhibit Cryptococcus infection of the CNS and/or brain tissue in vivo. The ability of a particular compound to prevent, reduce or inhibit manifestations of disease in an animal model can be measured using any known technique. For example, test and control samples in in vitro assays and test and control animals in in vivo assays can be comparatively tested for disease signs, i.e., Cryptococcus infection and penetration of the blood-brain-barrier.
[0202] d. Formulation and Administration
[0203] In therapeutic applications, the MPR1 inhibitors can be administered to an individual already suffering from or at risk for contracting a Cryptococcus infection. Compositions that contain MPR1 inhibitors are administered to a patient in an amount sufficient to suppress the undesirable infection and to eliminate or at least partially arrest symptoms and/or complications. An amount adequate to accomplish this is defined as a therapeutically effective dose. Amounts effective for this use will depend on, e.g., the inhibitor composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. Inhibitors of MPR1 activity can be administered chronically or acutely to treat or prevent a Cryptococcus infection. In certain instances, it will be appropriate to administer an inhibitor of MPR1 activity prophylactically, for instance in subjects at risk of or suspected of being infected with Cryptococcus.
[0204] Alternatively, DNA or RNA that inhibits expression of one or more sequences encoding a MPR1 metalloprotease, such as an antisense nucleic acid, a small-interfering nucleic acid (i.e., siRNA), a micro RNA (miRNA), or a nucleic acid that encodes a peptide that blocks expression or activity of a MPR1 can be introduced into patients to achieve inhibition. U.S. Pat. No. 5,580,859 describes the use of injection of naked nucleic acids into cells to obtain expression of the genes which the nucleic acids encode.
[0205] Therapeutically effective amounts of MPR1 inhibitor or enhancer compositions of the present invention generally range for the initial administration (that is for therapeutic or prophylactic administration) from about 0.1 g to about 10 mg of MPR1 inhibitor for a 70 kg patient, usually from about 1.0 g to about 1 mg, for example, between about 10 g to about 0.1 mg (100 Gg). Typically, lower doses are initially administered and incrementally increased until a desired efficacious dose is reached. These doses can be followed by repeated administrations over weeks to months depending upon the patient's response and condition by evaluating symptoms associated with Cryptococcus infection (e.g., a cough that lasts weeks or months, sharp chest pains, unexplained shortness of breath, severe headache, confusion, fever, night sweats, and/or unintended weight loss).
[0206] For prophylactic use, administration should be given to subjects at risk for or suspected of having a Cryptococcus infection. Therapeutic administration may begin at the first sign of disease or the detection or shortly after diagnosis of infection. This is often followed by repeated administration until at least symptoms are substantially abated and for a period thereafter.
[0207] The MPR1 inhibitors for therapeutic or prophylactic treatment are intended for parenteral, topical, oral, intrathecal, intracranial, or local administration. Preferably, the compositions are formulated for oral administration. In certain embodiments, the pharmaceutical compositions are administered parenterally, e.g., intravenously, intranasally, inhalationally, subcutaneously, intradermally, or intramuscularly. In some embodiments, the MPR1 inhibitors are administered directly to the brain or CNS, e.g., intrathecally or intracranially. Compositions of the invention are also suitable for oral administration. Thus, the invention provides compositions for parenteral administration which comprise a solution of the MPR1 inhibiting agent dissolved or suspended in an acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers may be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine or another suitable amino acid, hyaluronic acid and the like. These compositions may be sterilized by conventional, well known sterilization techniques, or may be sterile filtered. The resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
[0208] The concentration of MPR1 inhibiting agents of the invention in the pharmaceutical formulations can vary widely, i.e., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected primarily by fluid volumes, viscosities, etc., in accordance with the particular mode of administration selected.
[0209] The MPR1 inhibitors of the invention may also be administered via liposomes, which can be designed to target the conjugates to a particular tissue, for example lung, heart or CNS tissues, including brain tissue, as well as increase the half-life of the peptide composition. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations, the peptide, nucleic acid or organic compound to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to, e.g., a receptor prevalent among the desired cells, or with other therapeutic compositions. Thus, liposomes filled with a desired peptide, nucleic acid, small molecule or conjugate of the invention can be directed to the site of, for example, immune cells, leukocytes, lymphocytes, myeloid cells or endothelial cells, where the liposomes then deliver the selected MPR1 inhibitor compositions. Liposomes for use in the invention are formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid liability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728 and 4,837,028.
[0210] The targeting of liposomes using a variety of targeting agents is well known in the art (see, e.g., U.S. Pat. Nos. 4,957,773 and 4,603,044). For targeting to desired cells, a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the target cells. A liposome suspension containing a MPR1 inhibitor may be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the conjugate being delivered, and the stage of the disease being treated.
[0211] For solid compositions, conventional nontoxic solid carriers may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For oral administration, a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, one or more conjugates of the invention, and more preferably at a concentration of 25%-75%.
[0212] For aerosol administration, the inhibitors are preferably supplied in a suitable form along with a surfactant and propellant. Typical percentages of MPR1 inhibitors are 0.01%-20% by weight, preferably 1%-10%. The surfactant must, of course, be nontoxic, and preferably soluble in the propellant. Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides may be employed. The surfactant may constitute 0.1%-20% by weight of the composition, preferably 0.25-5%. The balance of the composition is ordinarily propellant. A carrier can also be included, as desired, as with, e.g., lecithin for intranasal delivery.
[0213] An effective anti-infective treatment is indicated by a decrease in observed symptoms (e.g., a cough that lasts weeks or months, sharp chest pains, unexplained shortness of breath, severe headache, confusion, fever, night sweats, and/or unintended weight loss), and/or Cryptococcus burden, as measured according to a clinician or reported by the patient. Alternatively, methods for detecting levels of specific MPR1 activities can be used. Standard assays for detecting MPR1 activity are described herein. Again, an effective anti-infective treatment is indicated by a substantial reduction in activity of MPR1. As used herein, a substantial reduction in MPR1 activity refers to a reduction of at least about 30% in the test sample compared to an untreated control. Preferably, the reduction is at least about 50%, more preferably at least about 75%, and most preferably MPR1 activity levels are reduced by at least about 90% in a sample from a treated mammal compared to an untreated control. In some embodiments, the MPR1 activity is completely inhibited.
[0214] 3. Methods of Delivering Therapeutic into the Central Nervous System
[0215] The MPR1 enzyme, and fragments thereof, as described herein, also finds use to facilitate, increase and/or enhance delivery of therapeutic agents across the blood-brain-barrier and into the CNS tissues.
[0216] a. Subjects Who May Benefit
[0217] Subjects who are currently receiving therapeutic agents intended to be delivered across the blood-brain-barrier, e.g., to the central nervous system (CNS) and/or brain tissues can benefit from methods of using the MPR1 enzyme, and fragments thereof, to facilitate and/or enhance delivery of the therapeutic agent. Subjects may have or be diagnosed as having a disease that affects the CNS, for example, a neurodegenerative disease. Illustrative neurodegenerative diseases include without limitation, multiple sclerosis, Alzheimer's disease, Parkinson's disease, and Huntington's disease. In some embodiments, the subject may have or be diagnosed as having a cancer of a CNS tissue. Illustrative nervous and sensory system cancers that can be treated or prevented by delivering therapeutic agents across the blood-brain-barrier include without limitation neuroblastoma, brain tumors, meningioma, ependymoma, medulloblastoma, peripheral neuroectodermal tumors, glioblastoma, astrocytoma, oligodendroglioma and retinoblastoma. In various embodiments, the subject may have or be diagnosed as having an infection and/or inflammation within the brain and/or CNS. Illustrative infections and/or inflammations within the CNS include without limitation meningitis and encephalitis. In various embodiments, the subject may have or be diagnosed as having epilepsy or migraines.
[0218] b. MPR1 and Enzymatically Active Fragments Thereof
[0219] For methods of increasing, promoting and/or enhancing delivery of a therapeutic agent across the blood-brain-barrier, a therapeutic agent is systemically administered in conjunction with a M36 fungalysin metalloprotease (e.g., MPR1) having at least 80% sequence identity, e.g., at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity, to an amino acid sequence of SEQ ID NO: 1, or a fragment thereof, that retains protease activity. In some embodiments, the M36 fungalysin metalloprotease has an amino acid sequence of SEQ ID NOs: 1, 3, 5 or 7.
[0220] In some embodiments, the M36 fungalysin metalloprotease is the full length enzyme. In some embodiments, the M36 fungalysin metalloprotease is a fragment comprising the peptidase_M36 domain (e.g., comprises a fragment corresponding to residues 446-722 of SEQ ID NOs: 1, 3 and/or 5 and/or corresponding to residues 446-706 of SEQ ID NO:7). In some embodiments, the M36 fungalysin metalloprotease is a fragment comprising and no longer than the peptidase_M36 domain. In some embodiments, the M36 fungalysin metalloprotease is a fragment comprising and no longer than the M36 GluZincin superfamily domain. In some embodiments, the M36 fungalysin metalloprotease is a fragment, and the propeptide FTP domain is removed (e.g., wherein amino acid residues corresponding to positions 95-141 of SEQ ID NOs: 1, 3, 5 and/or 7 are removed). In some embodiments, the M36 fungalysin metalloprotease is a fragment, and the N-terminal signal peptide and propeptide FTP domain are removed (e.g., wherein amino acid residues corresponding to positions 1-20 and 95-141 of SEQ ID NOs: 1, 3, 5 and/or 7 are removed). In some embodiments, the M36 fungalysin metalloprotease is a fragment, and the N-terminal amino acid residues 1-300 are removed. In some embodiments, the M36 fungalysin metalloprotease is a fragment, and the N-terminal amino acid residues 1-375 are removed.
[0221] c. Therapeutic Agents
[0222] As appropriate, the therapeutic agent can be a cell, a small organic molecule, small inorganic molecule, a peptide, a polypeptide or a nucleic acid. In some embodiments, the therapeutic agent is effective in the treatment, mitigation or prevention of a cancer of the central nervous system or a neurodegenerative disease. Generally, the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof is administered in conjunction with a therapeutic agent already known in the art as useful for treating, mitigating or preventing the disease affecting the CNS, e.g., known to be useful for treating, mitigating or preventing a neurodegenerative disease (e.g., multiple sclerosis, Alzheimer's disease, Parkinson's disease, and Huntington's disease) or a cancer of the central nervous system (e.g., neuroblastoma, brain tumors, meningioma, ependymoma, medulloblastoma, peripheral neuroectodermal tumors, glioblastoma, astrocytoma, oligodendroglioma and retinoblastoma).
[0223] Therapeutic agents useful for the treatment, mitigation and/or prevention of Alzheimer's disease include without limitation cholinesterase inhibitors (e.g., e.g., tacrine, ipidacrine, galantamine, donepezil, icopezil, zanapezil, rivastigmine, huperzine A, phenserine, physostigmine, neostigmine, pyridostigmine, ambenonium, demarcarium, edrophonium, ladostigil, ungeremine, and the like), glutamate pathway modifiers (e.g., memantine), tropisetron, disulfiram, honokiol and nimetazepam. Further therapeutic agents useful for the treatment, mitigation and/or prevention of Alzheimer's disease are reviewed, e.g., in Mangialasche, et al., Lancet Neurol (2010) 9: 702-16. Alzheimer's may also be treated or prevented by administration of antibodies, or fragments thereof, that bind to Abeta. Therapeutic agents useful for the treatment, mitigation and/or prevention of Parkinson's disease include without limitation dopamine agonists (e.g., levodopa, Carbidopa/Levodopa (Sinemet); pramipexole (Mirapex), ropinirole (Requip), and apomorphine (Apokyn)); monoamine oxidase B (MAO B) inhibitors (e.g., selegiline (Eldepryl) and rasagiline (Azilect)); Catechol O-methyltransferase (COMT) inhibitors (e.g., Tolcapone (Tasmar) and Entacapone (Comtan)); Anticholinergics (e.g., benztropine (Cogentin), trihexyphenidyl and Rivastigmine); Glutamate (NMDA) blocking drugs (e.g., amantadine (Symmetrel); and anti-synuclein antibodies, or fragments thereof). Illustrative therapeutic agents useful to mitigate the symptoms of Huntington's disease, include without limitation Tetrabenazine (Xenazine); Antipsychotic drugs (e.g., haloperidol (Haldol) and clozapine (Clozaril)); antiseizure drugs (e.g., clonazepam (Klonopin); and antianxiety drugs (e.g., diazepam (Valium)). Illustrative therapeutic agents useful for the treatment, mitigation and/or prevention of multiple sclerosis include without limitation, e.g., Beta interferons (e.g., Avonex, Betaseron, Extavia and Rebif); Glatiramer (Copaxone); Fingolimod (Gilenya); Natalizumab (Tysabri); and Mitoxantrone (Novantrone).
[0224] In various embodiments, the therapeutic agent is a chemotherapeutic agent useful to treat, mitigate or prevent a cancer of the central nervous system or cancer that has metastasized into the CNS and/or brain tissues. Examples of chemotherapeutic agents that can be administered in conjunction with a M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, include without limitation alkylating agent(s) (e.g., nitrogen mustards, nitrogen ureas, ethylenimines, methylmelamines, alkyl sulfonates, carmustine, triazenes), platinum-coordination complexes (e.g., cisplatin, carboplatin, and oxaliplatin), anti-metabolite(s) (e.g., folic acid analogs (e.g., methotrexate), pyrimidine analogs (e.g., capecitabine, 5-fluorouracil, 5 fluorodeoxyuridine, 5-fluorodeoxyuridine monophosphate, cytosine arabinoside, 5 azacytidine, gemcitabine), purine analogs (e.g., mercaptopurine, thioguanine, azathioprine, pentostatin, erythrohydroxynonyladenine, fludarabine, cladribine)), plant alkaloid(s) and/or terpenoid(s), vinca alkaloid(s) (e.g., vincristine, vinblastine, vinorelbine, and vindesine), podophyllotoxin(s) (e.g., etoposide and teniposide), camptothecin(s) (e.g., irinotecan and topotecan), anthracycline(s), aromatase inhibitor(s), taxane(s) (e.g., paclitaxel, taxol and docetaxel), topoisomerase inhibitor(s) (e.g., (Type I inhibitors: camptothecins, including irinotecan and topotecan; Type II Inhibitors: amsacrine, etoposide, etoposide phosphate, and teniposide), antibiotic(s) (e.g., dactinomycin, daunorubicin, doxorubincin, idarubicin, epirubicin, bleomycins, mitomycin), hormone(s), differentiating agent(s), kinase inhibitor(s) (e.g., Bevacizumab, BIBW 2992, Cetuximab, Imatinib, Trastuzumab, Gefitinib, Ranibizumab, Pegaptanib, Sorafenib, Dasatinib, Sunitinib, Erlotinib, Nilotinib, Lapatinib, Panitumumab, Vandetanib, E7080, Pazopanib, Mubritinib and Fostamatinib) and antineoplastic agent(s) (e.g., (dactinomycin, doxorubicin, epirubicin, fludarabine and bleomycin). In some embodiments, the therapeutic agent is an antibody directed against a cancer-associated antigen.
[0225] Examples of therapeutic antibodies that can be administered in conjunction with a M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, include but are not limited to HERCEPTIN (Trastuzumab) (Genentech, CA) which is a humanized anti-HER2 monoclonal antibody; REOPRO (abciximab) (Centocor) which is an anti-glycoprotein IIb/IIIa receptor on the platelets for the prevention of clot formation; ZENAPAX (daclizumab) (Roche Pharmaceuticals, Switzerland) which is an immunosuppressive, humanized anti-CD25 monoclonal antibody for the prevention of acute renal allograft rejection; PANOREX which is a murine anti-17-IA cell surface antigen IgG2a antibody (Glaxo Wellcome/Centocor); BEC2 which is a murine anti-idiotype (GD3 epitope); IgG antibody (ImClone System); IMC-C225 which is a chimeric anti-EGFR IgG antibody; VITAXIN which is a humanized anti-aV33 integrin antibody (Applied Molecular Evolution/Medlmmune); Campath 1H/LDP-03 which is a humanized anti CD52 IgG1 antibody (Leukosite); Smart M195 which is a humanized anti-CD33 IgG antibody (Protein Design Lab/Kanebo); RITUXAN which is a chimeric anti-CD20 IgG1 antibody (IDEC Pharm/Genentech, Roche/Zettyaku); LYMPHOCIDE which is a humanized anti-CD22 IgG antibody (Immunomedics); ICM3 which is a humanized anti-ICAM3 antibody (ICOS Pharm); IDEC-114 which is a primate anti-CD80 antibody (IDEC Pharm/Mitsubishi); ZEVALIN which is a radiolabelled murine anti-CD20 antibody (IDEC/Schering AG); IDEC-131 which is a humanized anti-CD40L antibody (IDEC/Eisai); IDEC-151 which is a primatized anti-CD4 antibody (IDEC); IDEC-152 which is a primatized anti-CD23 antibody (IDEC/Seikagaku); SMART anti-CD3 which is a humanized anti-CD3 IgG (Protein Design Lab); 5G1.1 which is a humanized anti-complement factor 5 (CS) antibody (Alexion Pharm); D2E7 which is a humanized anti-TNF- antibody (CATIBASF); CDP870 which is a humanized anti-TNF- Fab fragment (Celltech); IDEC-151 which is a primatized anti-CD4 IgG1 antibody (IDEC Pharm/SmithKline Beecham); MDX-CD4 which is a human anti-CD4 IgG antibody (Medarex/Eisai/Genmab); CDP571 which is a humanized anti-TNF- IgG4 antibody (Celltech); LDP-02 which is a humanized anti-4,7 antibody (LeukoSite/Genentech); OrthoClone OKT4A which is a humanized anti-CD4 IgG antibody (Ortho Biotech); ANTOVA which is a humanized anti-CD40L IgG antibody (Biogen); ANTEGREN which is a humanized anti-VLA-4 IgG antibody (Elan); and CAT-152 which is a human anti-TGF-2 antibody (Cambridge Ab Tech).
[0226] Therapeutic agents useful for the treatment, mitigation and/or prevention of meningitis or encephalitis depend in the etiology of the meningitis or encephalitis and can include antiviral agents (e.g., agents that inhibit or reduce the replication of Herpes virus, e.g., Acyclovir (Zovirax), Ganciclovir (Cytovene)), antibiotics, antifungal agents, anticancer or antineoplastic agents and/or anti-inflammatory agents (e.g., a non-steroidal anti-inflammatory agent (NSAID), e.g., aspirin, acetaminophen, diclofenac potassium, diclofenac sodium, diclofenac sodium with misoprostol, diflunisal, etodolac, fenoprofen calcium, flurbiprofen, ibuprofen, indomethacin, ketoprofen, meclofenamate sodium, mefenamic acid, meloxicam, nabumetone, naproxen sodium, piroxicam, tolmetin sodium, magnesium salicylate, choline salicylate, salsalate, sodium salicylate, alkyl salicylate or disalicylate, or a selective inhibitor of COX-2 (e.g., celecoxib, valdecoxib, lumiracoxib, etoricoxib, or rofecoxib).
[0227] d. Host Cells
[0228] In various embodiments, the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, is expressed in or attached to a heterologous host cell (e.g., a cell other than a Cryptococcus host cell) to facilitate the delivery of the host cell across the blood-brain-barrier and into the CNS and/or brain of a subject. In various embodiments, the host cell is a mammalian cell. In some embodiments, the host cell is a stem cell, for example, a neuronal stem cell or a mesenchymal stem cell. The host cell is transformed with a nucleic acid encoding the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof.
[0229] A variety of methods are known in the art for expressing a gene in eukaryotes (Ausubel, et al. Editor, Current Protocols in Molecular Biology, USA, 1984-2012). These methods often achieve expression of a gene above basal.
Transfection of Cells with an Expression Cassette.
[0230] Cells can be transfected with an expression cassette containing the gene of interest and a promoter. The promoter used to direct expression of a heterologous nucleic acid depends on the particular application. The promoter is preferably positioned about the same distance from the heterologous transcription start site as it is from the transcription start site in its natural setting. As is known in the art, however, some variation in this distance can be accommodated without loss of promoter function. The promoter typically can also include elements that are responsive to transactivation, e.g., hypoxia responsive elements, Gal4 responsive elements, lac repressor responsive elements, and the like. The promoter can be constitutive or inducible, heterologous or homologous.
[0231] In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for the expression of the nucleic acid in host cells. A typical expression cassette thus contains a promoter operably linked, e.g., to the nucleic acid sequence encoding a M36 fungalysin metalloprotease (e.g., MPR1), or fragment thereof, and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. The nucleic acid sequence may typically be linked to a cleavable signal peptide sequence to promote secretion of the encoded protein by the transformed cell. Such signal peptides would include, among others, the signal peptides from tissue plasminogen activator, insulin, and neuron growth factor, and juvenile hormone esterase of Heliothis virescens. Additional elements of the cassette may include enhancers and, if genomic DNA is used as the structural gene, introns with functional splice donor and acceptor sites.
[0232] In addition to a promoter sequence, the expression cassette should also contain a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region may be obtained from the same gene as the promoter sequence or may be obtained from different genes.
[0233] The particular expression vector used to transport the genetic information into the cell is not particularly critical. Any of the conventional vectors used for expression in eukaryotic or prokaryotic cells may be used. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET23D, and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc.
[0234] Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
[0235] Some expression systems have markers that provide gene amplification such as thymidine kinase, hygromycin B phosphotransferase, and dihydrofolate reductase. Alternatively, high yield expression systems not involving gene amplification are also suitable, such as using a baculovirus vector in insect cells, with a M36 fungalysin metalloprotease (e.g., MPR1) encoding sequence under the direction of the polyhedrin promoter or other strong baculovirus promoters.
[0236] The elements that are typically included in expression vectors also include a replicon that functions in E. coli, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of eukaryotic sequences. The particular antibiotic resistance gene chosen is not critical, any of the many resistance genes known in the art are suitable. The prokaryotic sequences are preferably chosen such that they do not interfere with the replication of the DNA in eukaryotic cells, if necessary.
[0237] Standard transfection methods are used to produce bacterial, mammalian, yeast or insect host cell lines that express large quantities of protein, which are then purified using standard techniques (see, e.g., Colley et al., J. Biol. Chem. 264:17619-17622 (1989); Guide to Protein Purification, in Methods in Enzymology, vol. 182 (Deutscher, ed., 1990)). Transformation of eukaryotic and prokaryotic cells are performed according to standard techniques (see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss & Curtiss, Methods in Enzymology 101:347-362 (Wu et al., eds, 1983). In some embodiments, a viral vector comprising a polynucleotide encoding a M36 fungalysin metalloprotease (e.g., MPR1), or fragment thereof, is used to transfect the host cell.
[0238] Any of the well-known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, liposomes, microinjection, plasma vectors, viral vectors and any of the other well-known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Green and Sambrook, Molecular Cloning: A Laboratory Manual (Fourth Edition), Cold Spring Harbor Laboratory Press, 2012). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least one gene into the host cell capable of expressing the protein of choice. Techniques for transfecting stem cells are described, e.g., by Lakshmipathy, et al., Stem Cells. (2004) 22(4):531-43; Moore, et al., Stem Cell Research & Therapy (2010) 1:23 and find use. Reagents for transfection of stem cells and other cells are commercially available, e.g., from Life Technologies (lifetechnologies.com or invitrogen.com), GlobalStem (globalstem.com), AmsBio (amsbio.com), Miltenyi Biotec (miltenyibiotec.com), Dharmacon (dharmacon.com), Roche Applied Sciences (roche-applied-science.com), and MaxCyte (maxcyte.com).
[0239] After the expression vector is introduced into the cells, the transfected cells are cultured under conditions favoring expression of the M36 fungalysin metalloprotease (e.g., MPR1) protein, which is recovered from the culture using standard techniques identified below.
[0240] e. Formulation and Administration
[0241] i. Formulation
[0242] Compositions comprising the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent are particularly useful for parenteral administration, e.g., intravenous or intrapulmonary administration or administration into a body cavity or lumen of an organ. The compositions for administration will commonly comprise a solution of the polypeptide comprising the polypeptide dissolved in a pharmaceutically acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of polypeptide in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs.
[0243] Liquid form pharmaceutical preparations can include solutions, suspensions, and emulsions, for example, water or water/propylene glycol solutions. Aqueous solutions suitable for oral use can be prepared by dissolving the active component in water and adding suitable colorants, flavors, stabilizers, and thickening agents as desired. Aqueous suspensions suitable for oral use can be made by dispersing the finely divided active component in water with viscous material, such as natural or synthetic gums, resins, methylcellulose, sodium carboxymethylcellulose, and other well-known suspending agents. For parenteral injection, liquid preparations can be formulated in solution in aqueous polyethylene glycol solution. Transdermal administration can be performed using suitable carriers. If desired, apparatuses designed to facilitate transdermal delivery can be employed. Suitable carriers and apparatuses are well known in the art, as exemplified by U.S. Pat. Nos. 6,635,274, 6,623,457, 6,562,004, and 6,274,166.
[0244] In various embodiments, the therapeutic agent is encapsulated in a liposome. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations the composition of the invention to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to a desired target, such as antibody, or with other therapeutic or immunogenic compositions. Liposomes for use in the invention are formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka, et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), U.S. Pat. Nos. 4,235,871; 4,501,728; 4,837,028 and 5,019,369. M36 fungalysin metalloprotease (e.g., MPR1), and enzymatically active fragments thereof, can be integrated into, attached or conjugated directly to the liposome using methods known in the art. Anti-CD22 antibodies conjugated to liposome-encapsulated doxorubicin has been tested in in vivo animal models. See, e.g., O'Donnell, et al., Invest New Drugs. (2010) 28(3):260-7; O'Donnell, et al., Cancer Immunol Immunother. (2009) 58(12):2051-8 and Tuscano, et al., Clin Cancer Res. (2010) 16(10):2760-8. Those of skill in the art will readily appreciate that the anti-CD22 targeting moiety can be replaced with a M36 fungalysin metalloprotease (e.g., MPR1), and enzymatically active fragments thereof, and the doxorubicin can be exchanged with another therapeutic agent(s) of interest.
[0245] In some embodiments, the M36 fungalysin metalloprotease (e.g., MPR1), and enzymatically active fragments thereof, are attached or conjugated to a liposome or a nanoparticle that encapsulates the therapeutic agent. Nanoparticles for encapsulation and delivery of a therapeutic agent are known in the art and can find use. Illustrative nanoparticles include without limitation, e.g., semiconductor quantum dots (QDs), silicon (Si) nanoparticles (Park, et al., Nature Materials (2009) 8:331-336; Tu, et al., JACS, (2010) 132:2016-2023; Zhang, et al., JACS, (2007) 129:10668; Singh M P et al., ACS Nano, (2012) In press, (DOI: 10.1021/nn301536n); Rosso-Vasic, et al., J. Mater. Chem. (2009) 19:5926-5933; Bhattacharjee S., et al., Nanotoxicology, (2011) DOI 10.3109/17435390.2011.633714, 1-14; Chandra, et al., Nanoscale (2011) 3:1533-1540), polylactide-co-glycolide nanoparticles for controlled delivery of anticancer agents (Dinarvand, et al., Int J Nanomedicine. 2011; 6:877-95); polyethyleneimine (PEI)-As(2)O(3)/Mn(0.5)Zn(0.5)Fe(2)O(4) magnetic nanoliposomes (Wang, et al., Int J Nanomedicine. 2011; 6:871-5); redox-responsive poly(ethylene glycol)-b-poly(lactic acid) (MPEG-SS-PLA) nanoparticles (Song, et al., Colloids SurfB Biointerfaces. 2011, PMID 21719259); Thiolated Pluronic (Plu-SH) nanoparticles (Abdullah-Al-Nahain, et al., Macromol Biosci. 2011, PMID 21717576); and mesoporous silica nanoparticles (MSNs) (Wu, et al., Chem Commun (Camb). 2011, PMID 21716992). In one embodiment, the M36 fungalysin metalloprotease (e.g., MPR1), and enzymatically active fragments thereof are conjugated to biocompatible nanomicelles comprised of cholic acid, lysine and polyethylene glycol (PEG) covalently conjugated together, e.g., described in Xiao, et al., Biomaterials (2009) 30:6006-6016; and Luo, et al., Bioconjug Chem (2010) 21:1216-1224. Further nanomicelles that find use are described, e.g., in PCT Patent Publ. WO 2010/039496.
[0246] In one embodiment, the M36 fungalysin metalloprotease (e.g., MPR1), and enzymatically active fragments thereof, are attached or conjugated to biocompatible nanomicelles comprised of cholic acid, lysine and polyethylene glycol (PEG) covalently conjugated together, e.g., as described in Xiao, et al., Biomaterials (2009) 30:6006-6016; and Luo, et al., Bioconjug Chem (2010) 21:1216-1224. Recently, a biocompatible nanomicelle drug delivery system comprised of a unique amphiphilic polymers called telodendrimers was developed [Xiao, et al., Biomaterials (2009) 30:6006-6016; Luo, et al., Bioconjug Chem (2010) 21:1216-1224]. Telodendrimers consist of cholic acid, lysine and polyethylene glycol (PEG) covalently conjugated together, which impart the ability to self-assemble into a water-soluble spheroid with a hydrophobic core capable of sequestering many types of drugs. Cholic acid, a primary component of bile acid, possesses a facial amphiphilic structure: a rigid steroid scaffold with four hydrophilic groups on one surface, and hydrophobic methyl groups on the other surface of the scaffold. Lysine is a natural amino acid. PEG is biocompatible and has been used to improve the pharmacokinetics of therapeutic drugs. This nanocarrier system has many attractive characteristics for drug delivery, such as high drug loading capacity, narrow polydispersity, well-defined structure, easy chemical modification, superior physical, chemical stability and biocompatibility.
[0247] In some embodiments, the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent is formulated as a nanoparticle. Nanoparticle conjugates are known in the art and described, e.g., in Musacchio, et al., Front Biosci. (2011) 16:1388-412; Cuong, et al., Curr Cancer Drug Targets. (2011) 11(2):147-55; Jain, BMC Med. (2010) 8:83; Sunderland, et al., Drug Development Research (2006) 67(1):70-93; Gu, et al., Nanotoday (2007) 2(3):14-21; Alexis, et al., ChemMedChem. (2008) 3(12):1839-43; Fay, et al., Immunotherapy. (2011) 3(3):381-394; Minko, et al., Methods Mol Biol. (2010) 624:281-94; and PCT Publ. Nos. WO 2011/046842; WO 2010/040062; WO 2010/047765; and WO 2010/120385, the disclosures of which are hereby incorporated herein by reference in their entirety for all purposes. Known nanoparticle cores find use in encapsulating a therapeutic agent (e.g., a chemotherapeutic agent or an anti-neoplastic agent) for delivering to a lung cancer cell and/or to a prostate cancer cell. A M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, can be integrated into, attached or conjugated directly to the nanoparticle core using methods known in the art. In some embodiments, the encapsulating nanoparticle is a cylindrical PRINT nanoparticle, e.g., as described in Gratton, et al., Proc Natl Acad Sci USA. (2008) 105(33):11613-8. The nanoparticle can be biodegradable or non-biodegradable, as appropriate or desired. Poly(lactic acid-co-glycolic acid) (PLGA), biodegradable poly(L lactic acid) (PLLA) and PEG-based hydrogels find use as a matrix material in particle drug delivery systems because they are biocompatible, bioabsorbable, and have already shown promise in medical applications.
[0248] Peptide nanoparticles and methods for their preparation are known in the art and described, e.g., in U.S. Patent Publication No. 2006/0251726, U.S. Patent Publication No. 2004/0126900, U.S. Patent Publication No. 2005/0112089, U.S. Patent Publication No. 2010/0172943, U.S. Patent Publication No. 2010/0055189, U.S. Patent Publication No. 2009/0306335, U.S. Patent Publication No. 2009/0156480, and U.S. Patent Publication No. 2008/0213377, each of which is hereby incorporated herein by reference in its entirety for all purposes. Further nanoparticle formulations that find use are described, e.g., in Emerich and Thanos, Curr Opin Mol Ther (2008) 10(2):132-9; Kogan, et al., Nanomedicine (2007) 2(3):287-306; Zhang, et al., Bioconjug Chem (2008) 19(1):145-152; Scarberry, et al., J Am Chem Soc (2008) 130(31): 10258-10262; Fraysse-Ailhas, et al., Eur Cells Materials (2007) 14(Suppl. 3): 115; Corrias F, Lai F., Recent Pat Drug Deliv Formul. 2011 Aug. 12, PMID:21834772; Wang, et al., Biomaterials. (2011) 32(32):8281-90; and Kaur, et al., Artif Cells Blood Substit Immobil Biotechnol. 2011 Aug. 2., PMID:21806501.
[0249] Also contemplated are solid form pharmaceutical formulations which are intended to be converted, shortly before use, to liquid form preparations for oral administration. Such liquid forms include solutions, suspensions, and emulsions. These preparations may contain, in addition to the active component, colorants, flavors, stabilizers, buffers, artificial and natural sweeteners, dispersants, thickeners, solubilizing agents, and the like.
[0250] The pharmaceutical formulation is preferably in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component. The unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules. Also, the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
[0251] The term unit dosage form, as used in the specification, refers to physically discrete units suitable as unitary dosages for human subjects and animals, each unit containing a predetermined quantity of active material calculated to produce the desired pharmaceutical effect in association with the required pharmaceutical diluent, carrier or vehicle. The specifications for the novel unit dosage forms of this invention are dictated by and directly dependent on (a) the unique characteristics of the active material and the particular effect to be achieved and (b) the limitations inherent in the art of compounding such an active material for use in humans and animals, as disclosed in detail in this specification, these being features of the present invention.
[0252] In one embodiment, a pharmaceutical formulation is administered to a patient at a therapeutically effective dose to prevent, treat, mitigate or control a disease or malignant condition, such as a cancer of the CNS and/or a neurodegenerative disease. The pharmaceutical composition or medicament is administered to a patient in an amount sufficient to elicit an effective therapeutic or diagnostic response in the patient. An effective therapeutic or diagnostic response is a response that at least partially arrests or slows the symptoms or complications of the disease or malignant condition. An amount adequate to accomplish this is defined as therapeutically effective dose.
[0253] ii. Routes of Administration
[0254] The M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent can be formulated into pharmaceutical formulations for administration to a patient, e.g., to increase, enhance or facilitate delivery of the therapeutic agent across the blood-brain-barrier. Administration of the pharmaceutical formulations can be by a variety of methods. Methods can include systemic administration, wherein the polypeptide or composition of polypeptides is delivered to sites in the body, including the targeted site of pharmaceutical action, via the circulatory system. Systemic administration includes, but is not limited to, oral and parenteral (i.e., other than through the alimentary tract, e.g., intramuscular, intravenous, intrapulmonary, intranasally, inhalationally, intra-arterial, transdermal and subcutaneous) administration.
[0255] iii. Dosing
[0256] The M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent can be administered for prophylactic and/or therapeutic treatments. In therapeutic applications, compositions comprising the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent are administered to a patient suffering from or at risk of developing disease of the CNS (e.g., a neurodegenerative disorder or a cancer of the CNS) in an amount sufficient to cure or at least partially arrest the disease and its complications. An amount adequate to accomplish this is defined as a therapeutically effective dose. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health, and clinical studies are often done to determine the best dose for a given cancer type. An effective amount of the compound is that which provides either subjective relief of a symptom(s) or an objectively identifiable improvement as noted by the clinician or other qualified observer.
[0257] In prophylactic applications, compositions M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent are administered to a patient not already in a disease state to prevent or delay the onset or recurrence of disease. Such an amount is defined to be a prophylactically effective dose. In this use, the precise amounts again depend upon the patient's state of health.
[0258] Determination of an effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. Generally, an efficacious or effective amount of a combination of one or more polypeptides of the present invention is determined by first administering a low dose or small amount of a polypeptide or composition and then incrementally increasing the administered dose or dosages, adding a second or third medication as needed, until a desired effect of is observed in the treated subject with minimal or no toxic side effects. Applicable methods for determining an appropriate dose and dosing schedule for administration of a combination of the present invention are described, for example, in Brunton, et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, Twelfth Edition, 2010, McGraw-Hill Professional; in a Physicians' Desk Reference (PDR), 65th Edition, 2011; in Remington: The Science and Practice of Pharmacy, 21st Ed., 2006, supra; and in Martindale: The Complete Drug Reference, Sweetman, 2005, London: Pharmaceutical Press., and in Martindale, Martindale: The Extra Pharmacopoeia, 31st Edition., 1996, Amer Pharmaceutical Assn, each of which are hereby incorporated herein by reference. In various embodiments, where a known compound is administered in conjunction with a M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, the dose is equivalent to or less than the recommended published dose, e.g., as can be found in the published literature or in the references cited above.
[0259] Exemplary doses of the pharmaceutical formulations described herein, include milligram or microgram amounts of the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent per kilogram of subject or sample weight (e.g., about 1 microgram per-kilogram to about 500 milligrams per kilogram, about 100 micrograms per kilogram to about 5 milligrams per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram. It is furthermore understood that appropriate doses of the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent depend upon the potency of the composition with respect to the desired effect to be achieved. When the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent are to be administered to a mammal, a physician, veterinarian, or researcher may, for example, prescribe a relatively low dose at first, subsequently increasing the dose until an appropriate response is obtained. In addition, it is understood that the specific dose level for any particular mammal subject will depend upon a variety of factors including the activity of the specific composition employed, the age, body weight, general health, gender, and diet of the subject, the time of administration, the route of administration, the rate of excretion, any drug combination, and the degree of expression or activity to be modulated.
[0260] The appropriate dosage of the polypeptides of the present invention will vary according to several factors, including the chosen route of administration, the formulation of the composition, patient response, the severity of the condition, the subject's weight, and the judgment of the prescribing physician. The dosage can be increased or decreased over time, as required by an individual patient. Usually, a patient initially is given a low dose, which is then increased to an efficacious dosage tolerable to the patient.
[0261] The dosage of M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent administered is dependent on the species of warm-blooded animal (mammal), the body weight, age, individual condition, surface area of the area to be treated and on the form of administration. The size of the dose also will be determined by the existence, nature, and extent of any adverse effects that accompany the administration of a particular compound in a particular subject. A unit dosage for administration to a mammal of about 50 to 70 kg may contain between about 5 and 500 mg of the active ingredient. Typically, a dosage of the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, in conjunction with a therapeutic agent, is a dosage that is sufficient to achieve the desired effect.
[0262] Optimum dosages, toxicity, and therapeutic efficacy of compositions can further vary depending on the relative potency of individual compositions and can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, for example, by determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio, LD50/ED50. Compositions that exhibit large therapeutic indices are preferred. While compositions that exhibit toxic side effects can be used, care should be taken to design a delivery system that targets such compositions to the site of affected tissue to minimize potential damage to normal cells and, thereby, reduce side effects.
[0263] The data obtained from, for example, animal studies (e.g., rodents and monkeys) can be used to formulate a dosage range for use in humans. The dosage of polypeptides of the present invention lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration. For any composition for use in the methods of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma can be measured, for example, by high performance liquid chromatography (HPLC).
[0264] In general, the dose equivalent of a polypeptide or composition, is from about 1.0 ng/kg to 100 mg/kg for a typical subject. In various embodiments, a typical polypeptide composition of the present invention for intravenous administration can be in the range of about 1 ng/kg to 100 mg/kg per patient per day, for example, about 1.0 g/kg to 10 mg/kg per patient per day. In various embodiments, dosages from about 10 g/kg to 1.0 mg/kg per patient per day may be used. Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington: The Science and Practice of Pharmacy, 21st Ed., 2006, Lippincott Williams & Wilkins.
[0265] In one embodiment of the present invention, a pharmaceutical formulation of the present invention is administered, e.g., in a daily dose in the range from about 1 ng of compound per kg of subject weight (1 ng/kg) to about 100 mg/kg. In another embodiment, the dose is a dose in the range of about 1.0 g/kg to about 50 mg/kg. In yet another embodiment, the dose is about 10 g/kg to about 25 mg/kg. In another embodiment, the dose is about 25 g/kg to about 15 mg/kg.
[0266] Exemplary doses of the pharmaceutical formulations can include 100-500 mg daily doses as needed, depending on the therapeutic agent to be delivered. Pharmaceutical formulations can be administered at a concentration of about 25 mg/mL to about 50 mg/mL. Exemplary doses of the pharmaceutical formulations can include about 5-20 mg/kg, for example, about 10 mg/kg daily doses.
[0267] In embodiments involving the administration of the M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, attached or conjugated to a nanoparticle encapsulating a therapeutic agent (e.g., a chemotherapeutic agent or an agent to mitigate symptoms of a neurodegenerative disease), the decorated and loaded nanoparticle can be administered at a dose in the range of about 5 mg/kg to about 200 mg/kg, for example, at a dose in the range of about 10 mg/kg to about 100 mg/kg, for example at a dose of about 5, 10, 15, 25, 50, 75, 100, 150 or 200 mg/kg. Because the decorated nanoparticles are targeted to the CNS by the attached or conjugated M36 fungalysin metalloprotease (e.g., MPR1), or an enzymatically active fragment thereof, doses of encapsulated chemotherapeutic agent can be higher within the nanoparticle than if the chemotherapeutic agents were administered alone (i.e., not encapsulated in the nanoparticle). In some embodiments, the doses of nanoparticle-encapsulated chemotherapeutic agent are 1-fold, 2-fold, 3-fold, 4-fold, or more, in comparison to doses of the same chemotherapeutic agent administered without encapsulation in the nanoparticle. Doses of unencapsulated chemotherapeutic agents are known in the art. See, e.g., Brunton, et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, Twelfth Edition, 2010, McGraw-Hill Professional and Physicians' Desk Reference (PDR), 65th Edition, 2011.
[0268] Following successful treatment, it may be desirable to have the subject undergo maintenance therapy to prevent the recurrence of the disease or malignant condition treated.
[0269] iv. Scheduling
[0270] Dosing schedules can be calculated from measurements of polypeptides in the body of a subject. In general, dosage is from 1 ng to 1,000 mg per kg of body weight and may be given once or more daily, semiweekly, weekly, biweekly, semimonthly, monthly, bimonthly or yearly, as needed or appropriate. Persons of ordinary skill in the art can easily determine optimum dosages, dosing methodologies and repetition rates. One of skill in the art will be able to determine optimal dosing for administration of a polypeptide or polypeptide composition of the present invention to a human being following established protocols known in the art and the disclosure herein.
[0271] Single or multiple administrations of the pharmaceutical formulations may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the composition should provide a sufficient quantity of the polypeptides of this invention to effectively treat the patient. Preferably, the dosage is administered once but may be applied periodically until either a therapeutic result is achieved or until side effects warrant discontinuation of therapy. Generally, the dose is sufficient to treat or ameliorate symptoms or signs of disease without producing unacceptable toxicity to the patient.
[0272] The daily dose can be administered once per day or divided into subdoses and administered in multiple doses, e.g., twice, three times, or four times per day. However, as will be appreciated by a skilled artisan, compositions described herein may be administered in different amounts and at different times. The skilled artisan will also appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but not limited to the severity of the disease or malignant condition, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of a composition can include a single treatment or, preferably, can include a series of treatments.
[0273] In various embodiments, a pharmaceutical formulation thereof for intravenous administration would be about 0.01 to 100 mg/kg per patient per day. Dosages from 0.1 up to about 1000 mg/kg per patient per day may be used, particularly when the drug is administered to a secluded site and not into the blood stream, such as into a body cavity or into a lumen of an organ. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington: The Science and Practice of Pharmacy, 21st Ed., 2006, Lippincott Williams & Wilkins.
[0274] To achieve the desired therapeutic effect, pharmaceutical formulations may be administered for multiple days at the therapeutically effective daily dose. Thus, therapeutically effective administration of compositions to treat a disease or malignant condition described herein in a subject may require periodic (e.g., daily) administration that continues for a period ranging from three days to two weeks or longer. Typically, compositions will be administered for at least three consecutive days, often for at least five consecutive days, more often for at least ten, and sometimes for 20, 30, 40 or more consecutive days, or longer, as needed. While consecutive daily doses are a preferred route to achieve a therapeutically effective dose, a therapeutically beneficial effect can be achieved even if the compounds or compositions are not administered daily, so long as the administration is repeated frequently enough to maintain a therapeutically effective concentration of the composition in the subject. For example, one can administer a composition every other day, every third day, or, if higher dose ranges are employed and tolerated by the subject, once a week.
EXAMPLES
[0275] The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1
Invasion of the Central Nervous System by Cryptococcus neoformans Requires a Secreted Fungal Metalloprotease
Methods
Transcytosis Screen for Mutants Defective at Crossing the In Vitro Blood-Brain-Barrier (BBB) Model
[0276] The in vitro model of the BBB was established here as previously described (Vu, et al., Eukaryotic Cell 8:1803-1807). Briefly, the in vitro BBB model consists of a transwell apparatus separating the luminal (blood) and abluminal (brain) side of the BBB. HCMEC/D3 cells were grown in the top transwell chamber on collagen-coated microporous membrane (8 m). Fungal cells (110.sup.5 cells) were added to the top chamber and collected subsequently from the bottom chamber for CFU determination.
Adhesion/Cell Association Assay of C. neoformans with HCMEC/D3 Cells
[0277] HCMEC/D3 were grown to confluence on collagen-coated transwells as discussed above. An innoculum of 110.sup.6 C. neoformans cells in 50 l PBS volume was added to the endothelial barrier at the start of the experiment. After the indicated amount of incubation time, the endothelial barrier was washed 3 times with 1PBS and were either lysed with water to determine the number of yeast cells that adhered to and associated with the barrier or incubated overnight to assess the number of yeast cells that transmigrated the barrier after the initial adhesion step. This last transcytosis step was done to show that a transcytosis defect follows an initial adhesion defect.
Scanning Electron Microscopy (SEM)
[0278] HCMEC/D3 cells were grown on transwell filters (8 m; BD Biosciences) under the same conditions used for the transcytosis assays. Approximately 210.sup.6 cells of a wild-type strain of C. neoformans (H99) were added to the top chamber for 1 h. The transwell filters were then washed with 1PBS to remove nonspecific adhering yeast cells, fixed in Karnovsky's fixative, and sent to an on-campus SEM facility for sample processing (Electron Microscopy Lab, UC Davis). For SEM preparation of C. neoformans in the absence of an endothelial barrier, the fungal cells were grown overnight in YPD, washed in PBS, spun down, and fixed in Karnovsky's fixative.
Macrophage Intracellular Survival Assay
[0279] J774A.1 (ATCC TIB-67, from Dr. Renee Tsolis) is a macrophage-like cell line from a BALB/c haplotype H-2d, reticulum sarcoma used in the assay. Macrophages were grown at 37 C. with 10% CO.sub.2 in DMEM (Gibco #11995) supplemented with 10% heat-inactivated fetal bovine serum (Invitrogen #16140-071), 1% non-essential amino acids (Gibco #21340), 50 g/ml penicillin-streptomycin (Gibco #15070-063), and 10% NCTC-109 medium (Gibco #11140). J774A.1 was grown in 25 cm.sup.2 or 75 cm.sup.2 flasks (Thermo Sci Nunc #, 136196 or 156499) and used between passages 4-15.
[0280] For the assay, 2.510.sup.5 J774A. 1 cells were counted using a hemacytometer (Hausser Scientific #1475) and grown in 96-well culture plates (BD Falcon 353072) overnight. C. neoformans was cultured overnight in YPD+2% glucose at 30 C. with agitation. Cultures were then synchronized and normalized based on absorbance value measured at OD600 and allowed to grow overnight. Using a hemacytometer, 110.sup.6 C. neoformans cells were added to macrophages supplemented with 100 U/ml mouse IFN-gamma (Thermo Sci Pierce Protein Research products #RM200120), 0.3 g/ml LPS (Sigma #L4391), and 1 g/ml mAb18B7 (a gift from Arturo Casadevall) for 1 hour. Cells were washed 3 times with 1PBS and either incubated overnight with fresh DMEM+supplemental media or lysed with 100 of ice cold 0.05% SDS for CFU determination. The following day, the media was removed from wells and macrophages were lysed using 100 l of ice cold 0.05% SDS. Lysed macrophages were serially diluted and plated on YPD+P/S plate for 48 hours at 30 C. for yeast intracellular survival analysis.
Inhalation Model (Survival Study and CFU Analysis)
[0281] Experimental Parameters.
[0282] 110.sup.7 yeast cells in 50 ml volume were used to innoculate mice. Mice (A/J strain, Jackson Laboratories, 000646) were 5 weeks old, inbred, and housed with 3-4 animals per cage. The number of animals used per groups (WT, reconstituted, and mutant) was 7.
[0283] Preparation of Yeast Innoculum.
[0284] Frozen stocks of the 3 yeast strains used in the study (WT, mp102, and Rec1) were streaked on YPD plates and incubated overnight at 30 C. Colonies were then grown in liquid YPD overnight at 30 C. until log phase (approx. 16 hours). Cultures were re-grown a second time (to log phase) by adding 100 L of liquid culture into fresh YPD to ensure yeast colonies are robust. 10 ml of each cultured strain were cleaned with sterile 1PBS (4000 rpm, 4 minutes, @ 25 C.) and re-suspended in YPD. The concentration of the original culture was determined by hemacytometer count (Brite-Line) and was diluted in 1sterile PBS to a final concentration of 210.sup.8 cells/ml (equates to 110.sup.7 cells/50 ml volume).
[0285] Inoculation (Survival Assay).
[0286] Upon arrival to our animal facilities, 4 week old mice were given 1 week to acclimate, and given food and water ad libitum. Experiments were conducted in a separate surgical room. Mice were placed under 5% isoflurane anesthesia (2.5% maintenance dose), inoculated with 110.sup.7 cells in 50 l volume through the nares. The animals were suspended by their top incisors to hold their head back, ensuring that the inoculum was inhaled smoothly with minimal obstruction. Upon applying the inoculum, mice were suspended for another 30 seconds to ensure all of the inoculum was inhaled. Changes in the health status of the animals were monitored and bodyweight recorded daily until they showed signs of sickness due to the infection. Mice were sacrificed when a loss of 15% of body peak body weight was observed or when a loss of 1 g of body weight was observed for 3 consecutive days. Other signs of sickness monitored included lethargy, lack of activity and grooming (indicated by ruffled fur). Mice were sacrifice by an overdose of pentobarbital (Fatal Plus, MWI Veterinary Supply) at 150 mg/kg bodyweight. Survival data was collected and analyzed on Prism 5.0 software.
[0287] Tissue Homogenization (CFU Analysis).
[0288] Lung and brain were collected for homogenization as soon as possible after the animals were sacrificed. Lungs were cut into several pieces and mashed dry with a mortar and pestle for 1 min and suspended in 5 ml of 1PBS. Brains were mashed dry for 30 seconds and suspended in 1PBS. Original homogenized tissue was designated as 1. Lung tissue was serially diluted with 1PBS into 100, 1000, and 10000 dilutions; brain tissue was diluted to 10, 100, and 1000 dilutions. 100 ml of each respective dilution was spread on YPD plates containing Penicillin/Streptomycin and incubated for 2 days at 30 C. Total CFUs were calculated based on the number of colonies counted on the plate, plating volume (100 ml), dilution (from 1 to 10000), and the original volume of the homogenized tissue (5 mL). With a few exceptions, we tried to count plates with at least 100 colonies to maximize accuracy. CFU data was analyzed on Prism 5.0 software.
Intravenous Model (Survival Study and CFU Analysis)
[0289] Experimental Parameters:
[0290] 1.210.sup.6 yeast cells in 200 ml volume were used to inoculate mice. Mice (A/J strain, Jackson Laboratories, 000646) were 8 weeks old, inbred, and housed with 3-4 animals per cage. The number of animals used per groups (WT, reconstituted, and mutant) was 8.
[0291] Preparation of Yeast Inoculum:
[0292] As described above. The concentration of the original culture was diluted in YPD to a final concentration of 610.sup.6 cells/ml (equates to 1.210.sup.6 cells/200 ml total volume.
[0293] Inoculation (Survival Assay).
[0294] Upon arrival to our animal facilities, 7 week old mice were given 1 week to acclimate, and given food and water ad libitum. Experiments were conducted in a separate surgical room. A/J mice, under 3% isoflurane anesthesia (1% maintenance dose as needed), were inoculated with 1.210.sup.6 cells in 200 l total volume through the lateral tail vein. Mice were held briefly in a restrainer (Kent Scientific) during anesthesia and injection. Once the tail vein became dilated by heat lamp it was disinfected with alcohol swabs (Becton-Dickinson). 30G1/2 needles (Becton-Dickinson) and 1 ml tuberculin syringes (Kendall) were used. In the event that an injection was done incorrectly, the syringe was refilled with more inoculum to replace any lost during the incomplete injection. After injection was complete, mice were given fresh oxygen until they become awake. Mice were monitored as discussed above and sacrificed with an overdose of pentobarbital (Fatal Plus, MWI Veterinary Supply) at 150 mg/kg bodyweight.
[0295] CFU Analysis.
[0296] Brains were collected for homogenization immediately after the animals were sacrificed. Brains were mashed on a mortar and pestle dry for 30 seconds and resuspended in 5 ml of 1PBS. Original homogenized tissue was designated as 1. Brain tissue was serially diluted with 1PBS into 10, 100, and 1000 dilutions (1 mL of homogenate into 9 ml 1PBS). 100 ml of each respective dilution was spread on YPD containing Penicillin/Streptomycin, and incubated for 2 days at 30 C. Total CFUs was calculated based on the number of colonies counted on the plate, plating volume (100 ml), dilution (from 1 to 1000), and the original volume of the homogenized tissue (5 mL).
Intravenous ModelBrain Burden Time Course (CFU Analysis and Histology)
[0297] Experimental Parameters.
[0298] 510.sup.5 yeast cells in 200 l volume were used to inoculate mice. Mice (A/J strain, Jackson Laboratories, 000646) were 8 weeks old, inbred, and housed with 3-4 animals per cage. The number of animals used per groups (WT and mutant) was 4 per time point (12 hr, 48 hr, 72 hr). 3 animals per group used for CFU analysis, and 1 was saved for histology.
[0299] Preparation of Yeast Inoculum.
[0300] (As described above). The concentration of the original culture was diluted in 1 sterile PBS to a final concentration of 2.510.sup.6 cells/ml (equates to 510.sup.5 cells/200 ml total volume).
[0301] Inoculation (CFU Analysis).
[0302] Injection protocols were the same as discussed above. Mice were sacrificed at 12, 24, and 72 hours, respectively, with Pentobaritol (150 mg/kg of bodyweight). Brains, extracted immediately following euthanasia, were mashed dry for 30 seconds and suspended in 3 mL YPD (designated as 1). The homogenate was serially diluted to 100 and 100 (200 ml of homogenate diluted in 1800 ml YPD). 200 ml of each respective dilution was spread on YPD plates containing Pen/Strep and incubated for 2 days at 30 C. Total CFUs were calculated based on the number of colonies counted on the plate, plating volume (200 ml), dilution (from 1 to 100), and the original volume of the homogenized tissue (3 mL).
[0303] Histology.
[0304] Brains were fixed in 4% paraformaldehyde prior to sectioning. Sectioning was carried about by UC Davis veterinary laboratory (slice thickness, stain used, and how tissue was analyzed for lesions).
Intra-Parenchyma Survival Study (CFU Analysis Only)
[0305] Experimental Parameters.
[0306] 110.sup.4 yeast cells in 60 ml volume were used to inoculate mice. Mice (A/J strain, Jackson Laboratories, 000646) were 10 weeks old, inbred, and housed with 3-4 animals per cage. The number of animals used per groups (WT, reconstituted, and mutant) was 6 (WT and mp102).
[0307] Preparation of Yeast Inoculum.
[0308] (As described above). The concentration of the original culture was diluted in 1 sterile PBS to a final concentration of 1.6710.sup.6 cells/ml (equates to 110.sup.4 cells/60 ml total volume).
[0309] Inoculation (CFU Analysis).
[0310] Mice were anesthetized using isoflurane anesthesia and randomized for intracranial inoculation of C. neoformans (wild type and mpr1 mutant strains). Inoculation was delivered as a 60 l volume through a 27-gauge needle fastened to a tuberculin syringe with a cuff to prevent penetration of more than 1 mm. A midline puncture through the cranial vault approximately 6 mm posterior to the orbit was made and the inoculum was injected after which the mice allowed to recover. Euthanasia protocol was the same as described above. Mice were sacrificed at 48 hours with Pentobarbitol (150 mg/kg of bodyweight). Brains, extracted immediately following euthanasia, were mashed dry for 30 seconds and suspended in 3 mL of YPD (designated as 1). The homogenate was serially diluted to 10 and 100 dilutions (200 ml of homogenate was diluted in 1800 ml YPD). 200 ml of each respective dilution was spread on YPD+Pen/Strep and incubated for 2 days at 30 C. Total CFUs were calculated based on the number of colonies counted on the plate, plating volume (200 ml), dilution (from 1 to 100), and the original volume of the homogenized tissue (3 ml).
Results and Discussion
[0311] In order for C. neoformans to breach the brain endothelium and colonize the brain parenchyma, we proposed that proteins on the surface of cryptococcal cells were likely to have a crucial role. Since so little was known about the extracellular proteome of C. neoformans we performed the first proteomic analysis and discovered that many of the proteins that C. neoformans secretes include several different types of proteases (Eigenheer, et al., (2007) FEMS Yeast Research 7:499-510). Among the secreted proteases we identified were, serine proteases, aspartic proteases and metalloproteases (Eigenheer, et al., (2007) FEMS Yeast Research, supra). Although it had been suspected that C. neoformans produced extracellular enzymes, their identity and role in the pathogenesis of C. neoformans was unknown (Pinti, et al., (2007) FEBS Lett 581:3882-3886; and Aoki, et al., (1994) Mycopathologia 128:143-150).
[0312] To determine whether extracellular proteases of C. neoformans played a role in the transmigration of cryptococci into the CNS, strains of C. neoformans that lacked proteases were examined in an in vitro model of the BBB (
[0313] In silico analysis revealed that MPR1 is 525 aa long, it has a predicted signal peptide at the N-terminus, a predicted propeptide (FTP domain), and a peptidase M36 catalytic domain with a highly-conserved Zn2+ binding motif near the C-terminus (
[0314] We constructed an MPR1-dsRED fusion protein and expressed it in the mpr1 mutant background strain to assess its localization. Fluorescence microscopy demonstrated that MPR1 localized to the surface of Cryptococcus strongly suggesting that it is an extracellular protein (
[0315] The transmigration of C. neoformans (wild type strain) across the brain endothelium observed here is consistent with a transcellular mechanism whereby cryptococci cross the endothelial cells with little or no disruption of the intercellular tight junctions (i.e., paracellular mechanism). This observation is supported by previous reports that have shown both in vitro and in vivo that cryptococci breach the endothelium through an active process that involves the formation of microvilli on the surface of endothelial cells that presumably facilitate the transcellular movement (Chang, et al., (2004) Infect Immun 72:4985-4995; and Vu, et al., (2009) Eukaryotic Cell 8:1803-1807). The inability of the mp1 mutant strain to cross the brain endothelium suggests that MPR1 promotes transcellular migration by facilitating an aspect of this multistep processadhesion, invasion, transmigration and/or extrusion from the brain endothelium.
[0316] To examine if MPR1 was required for adherence of cryptococcal cells to the brain endothelium we performed an adherence assay with the in vitro BBB model. Here, cryptococci (110.sup.6) of a wild type strain, the mpr1 mutant strain and the reconstituted strain were added to the top chamber of a transwell insert of the BBB model described above (
[0317] Interestingly, we found that MPR1 is required for adhering cryptococcal cells to the surface of brain endothelial cells as demonstrated by the low CFU counts for the mp102 mutant strain (
[0318] A major objective of this study was to determine the contribution of MPR1 to the virulence of C. neoformans in terms of survival and CNS invasion after pulmonary infection in a mammalian host. To do this, mice were inoculated via the intranasal route to mimic the natural path of infection. We then examined cumulative survival and lung and brain pathologies. We found that by day 40 post-infection no mortality had occurred in mpr1-infected mice whereas 100% of wild type-infected mice died (
[0319] Total lung CFU analysis at the time of death revealed high cryptococcal burden in mpr1-infected mice that was similar to CFU in lungs of mice infected with the wild type strain (
[0320] It is not surprising however, that at the time of death some cryptococcal cells could be detected in brains from mpr1-infected mice (
[0321] When mice were inoculated by tail vein injection, as a means to bypass the lungs and allow a direct route to the brain, we found that by day 21 post-infection 100% of mpr1-infected mice were alive and 100% of wild type-infected mice had died suggesting that the lack of mpr1 significantly prolonged survival in this murine model as well (
[0322] In contrast, whole brain CFUs at 24 h and 48 h post-infection revealed significantly less fungal burden in the brains from mpr1-infected mice (
[0323] At 16-days post-infection, the brain fungal burden in mice inoculated with mpr1 was significantly less than the fungal burden in brains of mice infected with the wild type strain (
[0324] Extensive histochemical analysis was performed in order to determine the extent of brain pathology in mice inoculated with mpr1 and wild type strains. Mice were inoculated by tail vein injection and brains were examined at 12 h, 24 h and 48 h post-infection by taking consecutive, longitudinal brain sections and staining with mucicarmine or hematoxylin and eosin (H&E). A significant number of cryptococcal filled-lesions (cysts) were observed in the brain parenchyma of wild type-infected mice 48 h post-infection often in close proximity to the microvessels (
[0325] In contrast, cryptococci-filled cysts were not detected in brains from mice inoculated with the mpr1 mutant strain at 12 h, 24 h, or 48 h post-infection. Remarkably, here, we observed intact brain tissue with healthy microvessels that were devoid of cryptococci (
Example 2
Determination of Substrates of MPR1
[0326] Substrates define protease function so that in order to fully understand the role of MPR1 in the virulence and pathogenesis of C. neoformans, the substrates must be identified and their functional consequences resolved. MPR1 may be targeting proteins on the surface of the brain endothelium and/or targeting key proteins in C. neoformans that are involved in shaping the extracellular environment of cryptococcal cells. Based on what we know about metalloproteases in mammalian cells, it is very likely that MPR1 has multiple targets and likely functions as a key modulator within a protease web. A system-wide approach offers one approach to resolving MPR1 proteolysis in order to understand its role in the transmigration of C. neoformans into the CNS. Proteomics or degradomics encompasses a powerful technique that can permit an unbiased high-throughput substrate discovery screen of MPR1. Liquid chromatography (LC)-mass spectrometry (MS)-based proteomic techniques allow substrate identification in complex biological systems like the Cryptococcus-brain endothelium interface. High-content proteomic screens have been highly successful in identifying substrates of metalloproteases. See, e.g., Dean and Overall, Mol Cell Proteomics. (2007) 6(4):611-23; Morrison, et al., (2009) Curr Opin Cell Biol. (2009) 21(5):645-53. Native substrates of MPR1 (degradome) can be screened with a mass-spectrometry approach known as isobaric peptide tag labeling (iTRAQ LC-MS/MS)an innovative, high-content and state-of-the-art proteomics technique that can identify and quantify proteins from different complex biological sources. See, e.g., Wu, et al., (2006) J Proteome Res. 5:651-658; Ow, et al., (2009) J Proteome Res 8:5347-5355).
iTRAQ LC-MS/MS as a High-Content Proteomic Screen to Identify the Degradome of MPR1.
[0327] Native substrates of MPR1 (degradome) are screened in the cellular context of the brain endothelium-cryptococcal interface using iTRAQ LC-MS/MS by comparing cells expressing MPR1 (H99 wild type strain) to control cells lacking the expression of MPR1 (mpr1 mutant strain). Tryptic peptides of cleaved proteins will be released into the culture medium, collected, tryptically digested, labeled with iTRAQ tags, and identified by LC-MS/MS (
[0328] The in vitro model of the BBB is used to perform part of these studies (
[0329] The location within a protein (substrate) of the released cleaved fragment (peptide mapping) can also be determined because we can map identified peptides to the corresponding protein sequence and compare their iTRAQ abundance. Cleavage sites within the native substrate are identified.
Expected Outcome and Benchmarks:
[0330] 1) anchored proteins targeted (substrates) by MPR1 that shed peptides from the cell surface microenvironment of brain endothelial cells (or cryptococcal cells) into the culture medium would show higher iTRAQ ratios for their tryptic peptides in H99 versus mpr1 mutant samples. In other words, the putative substrates will remain anchored to the surface if MPR1 is not around to cleave them, therefore fewer tryptic peptides would be seen in the mpr1 sample.
[0331] 2) On the other hand, secreted proteins that are putative substrates of MPR1 will show low iTRAQ ratios in H99 compared to mpr1 reflecting proteolytic clearance. In this case, secreted substrates would be selectively degraded by MPR1. Therefore, tryptic peptides would be cleared in the H99 sample but would persist in the mpr1 mutant sample. Because of the high-proteome coverage provided by the iTRAQ approach we expect to successfully resolve a nearly complete degradome of MPR1.
[0332] The use of iTRAQ for identification and relative and absolute quantification of proteins in different samples has been a major breakthrough in quantitative proteomics. See, e.g., Wu, et al., (2006) J Proteome Res. 5:651-658; Ow, et al., (2009) J Proteome Res 8:5347-5355). High-content proteomic screens using iTRAQ have been highly successful in identifying substrates of metalloproteases expressed in mammalian cells. See, e.g., Dean and Overall, Mol Cell Proteomics. (2007) 6(4):611-23. Although we realize that we are dealing with a complex biological interface (Cryptococcus-brain endothelium), the amount of information that we will gain from using this approach will significantly contribute to our understanding of the highly neurotropic nature of C. neoformans. A successful outcome will not only establish this approach as an innovative and highly useful technique for the field of fungal pathogenesis, but it will also open the way for resolving the substrates and therefore function of other proteases we previously identified but whose functions remain unknown.
Example 3
Transformation with MPR1 or Conjugation to MPR1 Facilitates the Migration of Therapeutics into the Brain for the Treatment of Brain Disorders
[0333] In order to examine whether the expression of Mpr1 alone could promote the movement of a non-pathogenic yeast across the blood-brain barrier, the cDNA of Mpr1 (from Cryptococcus neoformans var. grubii, H99 serotype A) was sub-cloned into a yeast expression plasmid and transformed into a wild type strain of yeast (Saccharomyces cerevisiae, W303). S. cerevisiae does not normally express the Mpr1 metalloprotease since this gene is not present in its genome. Using RT-PCR (reverse transcriptase polymerase chain reaction) we confirmed that S. cerevisiae does not normally express Mpr1 mRNA transcript, as expected, and that we successfully engineered S. cerevisiae to constitutively express CnMpr1 mRNA (
[0334] We performed transcytosis assays with our in vitro model of the blood-brain barrier (
[0335] Conjugation/attachment of Mpr1 to a therapeutic moiety (e.g., nanoparticles, liposomes, therapeutic agents, stem cells, and/or antibodies) finds use in specifically targeting the migration of the therapeutic moiety across the blood-brain barrier, providing a new therapeutic delivery system for the brain. The Mpr1-bioconjugated carriers can be engineered to carry a therapeutic payload (e.g., drug or antibodies) for the treatment of a specific brain disorder. Using MPR1 to promote delivery of a therapeutic moiety across the blood-brain barrier can facilitate and improve the treatment of brain disorders.
[0336] Mpr1-conjugated carriers can be used to specifically deliver to the brain therapeutic doses of a therapeutic agent and to maintain the therapeutic agent in the brain at levels that are effective in treating a specific brain disorder. In one embodiment, Mpr1-conjugated carriers are useful in the treatment of glioblastoma multiforme where patient survival rates are extremely low.
Example 4
Targeting Potential of Nanocarriers to the Brain by Engineering Mpr1-Conjugated Nanoparticles
[0337] This example describes the generation of recombinant Mpr1 protein using a well-established eukaryotic expression system and the conjugation of Mpr1 to silicon-based nanoparticles. Silicon nanoparticles or quantum dots represent an exciting new type of nanoparticle with minimal cytotoxicity as well as being biodegradable. These nanoparticles have a large capacity for drug loading and they can be linked to an Mpr1 protein or peptide via the 300 or so amine groups on the surface of the nanoparticle for targeted penetration. In addition, because silicon nanoparticles are intrinsically luminescent and they can be doped, e.g., with Fe.sup.2+ or Mn.sup.2+, and can be monitored, e.g., either by a fluorescence microscopy or MRI, respectively. Silicon nanoparticles or use are known in the art (Park, et al., Nature Materials (2009) 8:331-336; Tu, et al., JACS, (2010) 132:2016-2023; Zhang, et al., JACS, (2007) 129:10668; Singh M P et al., ACS Nano, (2012) In press, (DOI: 10.1021/nn301536n); Rosso-Vasic, et al., J. Mater. Chem. (2009) 19:5926-5933; Bhattacharjee S., et al., Nanotoxicology, (2011) DOI 10.3109/17435390.2011.633714, 1-14; Chandra, et al., Nanoscale (2011) 3:1533-1540) and find use for the generation of Mpr1-conjugated-sillicon based nanoparticles. Mpr1-bioconjugated nanoparticles are examined in our in vitro model of the BBB in order to determine efficiency of binding to- and crossing the brain endothelium and to establish the biodegradability and biocompatibility of the bioconjugated nanoparticles. The Mpr1-bioconjugated nanoparticles are also evaluated in vivo in order to establish their biodistribution, in vivo degradation and cytotoxicity, e.g., employing positron emission tomography (PET), magnetic resonance imaging (MRI), optical fluorescence and other types of animal imaging approaches.
[0338] Bioconjugation of Mpr1, or a fragment thereof, increases the permeability of the BBB to a new type of silicon nanoparticle that can carry a therapeutic payload and is biodegradable. This drug delivery system improves the treatment of brain disorders. The combination of these two novel and specialized entities makes this approach highly innovative, uncomplicated and offers promising strategy for the treatment of brain disorders. This technology creates a doorway in the BBB that promotes the movement of clinically relevant drugs into the brain. Mpr1-conjugated nanoparticles allows existing therapeutic agents to be: 1) specifically delivered to the brain at optimal therapeutic doses and 2) maintained in the brain at levels that are effective in treating a specific brain disorder. This technology is particularly useful in the treatment of glioblastoma multiforme where patient survival rates are extremely low. Delivery of just a fraction of an anticancer drug into the brain improves patient survival.
[0339] Silicon nanoparticles as non-toxic, nanovectors and multimodal reporters. Semiconductor quantum dots (QDs) such as silicon (Si) nanoparticles, have recently received significant attention because they are multipotent and biocompatible (Tu, et al., JACS, (2010) 132:2016-2023; Rosso-Vasic, et al., J. Mater. Chem. (2009) 19:5926-5933; Bhattacharjee S., et al., Nanotoxicology, (2011) DOI 10.3109/17435390.2011.633714, 1-14) Si can be used as vehicles for drug delivery and bioimaging. The Si nanoparticles, due to their very small sizes (<5 nm) and intrinsic fluorescence, enjoy an edge over other nanoparticles (such as polymers and carbon based nanoparticles) that need to be functionalized to be fluorescent (Bhattacharjee S., et al., Nanotoxicology, (2011) DOI 10.3109/17435390.2011.633714, 1-14; Chandra, et al., Nanoscale (2011) 3:1533-1540). In addition, unlike the popular but intrinsically toxic Cd-based bioimaging agents such as CdSe/ZnS QDs, Si nanoparticles are mostly non-toxic. It has recently been shown that with appropriate surface coating there is no toxicity in a rat lung and human colon cell lines (Bhattacharj ee S et al., (2012) Cytotoxicity of surface-functionalized silicon and germanium nanoparticles: The dominant role of surface charges. ACS Nano, In press).
[0340] Mpr1, and fragments thereof, increase the permeability of the BBB. Eliminating Mpr1 from C. neoformans prevents brain infection and expressing Mpr1 in non-pathogenic yeast enables yeast to penetrate the BBB. Accordingly, conjugation of Mpr1 to silicon-based nanoparticles finds use in specifically targeting the migration of Mpr1-conjugated nanocarriers to the BBB resulting in a drug delivery system for the brain. The Mpr1-bioconjugated nanoparticles can be engineered to carry a therapeutic payload (e.g., a drug) for the treatment of a specific brain disorder.
[0341] Recombinant Mpr1 protein is produced using a eukaryote protein expression system and Mpr1 is conjugated to silicon-based nanoparticles. These nanoparticles are fast becoming the particles of choice due to their small size, biocompatibility and biodegradation. Once engineered, the Mpr1-conjugated nanoparticles are examined in our already established in vitro model of the human BBB. The biodistribution of Mpr1-conjugated-particles is investigated in mice through the use of PET or MRI at specific time points. For this kind of monitoring, the Mpr1-conjugating-particles are attached to a bifunctional DO3A derivative for chelation of .sup.64Cu for PET or doped with Fe.sup.2+ or Mn.sup.2+ for MRI. The biodegradability and biocompatibility of Mpr1-conjugated silicon nanoparticles in vivo are also monitored. We do this by: i) using confocal microscopy to observe the internalization and crossing of Mpr1-conjugated nanoparticles; ii) using Mpr1-conjugated nanoparticles radiolabeled with .sup.64Cu-DO3A to quantify the number of particles internalized and crossing the BBB; iii) using TEM (Transmission Electron Microscopy) and SEM (Scanning Electron Microscopy) to observe the behavior of the Mpr1-nanoparticles within human brain endothelial cells and to look for any possible cell or organelle structural damage and iv) assessing the biodegradability and biocompatibility of Mpr1-conjugated nanoparticles.
[0342] Examination of Mpr1-Conjugated Nanoparticles In Vivo to Investigate the Biodistribution of Mpr1-Conjugated Nanoparticles.
[0343] A/Jr mice that are between 4-6 weeks old are inoculated via tail vein with silicon-nanoparticles alone or with Mpr1-conjugated-particles. A previous in vivo biodistribution study of mice inoculated with silicon-nanoparticles alone, found that the silicon-based particles accumulated largely in the liver, kidney and intestine with very little accumulation in the brain (Park et al., Nature Materials (2009) 8:331-336; Tu, et al., Med. Chem. Letts. (2011) 2:285-288, Bhattacharjee S et al., (2012). Cytotoxicity of surface-functionalized silicon and germanium nanoparticles: The dominant role of surface charges. ACSNano, In press). They also found that these particles were biodegradable and had negligible in vivo toxicity (Park et al., Nature Materials (2009) 8:331-336; Tu, et al., Med. Chem. Letts. (2011) 2:285-288, Bhattacharjee S et al., (2012). Cytotoxicity of surface-functionalized silicon and germanium nanoparticles: The dominant role of surface charges. ACSNano, In press). In our study, mice will be monitored either by PET or MRI at specific time points (1 h, 4 h, 24 h, 48 h) following the tail vein inoculations. For this kind of monitoring, the Mpr1-conjugating-particles will be attached to a bifunctional DO3A (1,4,7,10-tetraazacyclododecane-1,4,7-triacetic acid) derivative for chelation of .sup.64Cu for PET or doped with Fe2.sup.+ or Mn.sup.2+ for MRI (Tu, et al., Med. Chem. Letts. (2011) 2:285-288). To prevent rapid degradation after injection and increase their blood half-life, Mpr1-conjugated nanoparticles can be coated with the biopolymer dextran (Park et al., Nature Materials (2009) 8:331-336; Tu, et al., Med. Chem. Letts. (2011) 2:285-288). The concentrations of Mpr1-conjugated nanoparticles radiolabeled with .sup.64Cu-DO3A are established semiquantitatively from PET images and used to analyze the biodistribution of Mpr1-nanoparticles in living mice over time. The biodistribution and deposition for Mpr1-conjugated particles is quantified in mice by gamma counting of ex vivo tissues. Mice used for PET are sacrificed following a PET scan at 48 h, and organs are harvested and analyzed quantitatively by a gamma-counter detector (and corrected for the natural decay of .sup.64Cu).
[0344] Investigating the In Vivo Degradation and Toxicity of Mpr1-Conjugated Silicon Nanoparticles.
[0345] In order to examine the in vivo degradation of the Mpr1-particles, mice are sacrificed 1 day, 1 week and 4 weeks following tail vein injection. The brain, heart, kidney, liver, lung, and spleen are collected. The tissues are weighed, digested and then analyzed for silicon content using ICP-OES (inductively coupled plasma optical emission spectrometry, used for the detection of trace metals). To assess any potential in vivo toxicity with Mpr1-conjugated nanoparticles we perform toxicity studies. Here mice are weighed and monitored for any change in overall appearance, or behavior for 4 weeks following injection with Mpr1-particles and compared to control mice (tail vein injected with PBS). Tissue sections from brain, kidney, liver and spleen will be collected from mice 1 day and 4 weeks after injection with Mpr1-particles. Sections are stained with haematoxyline and eosin (H&E) and then examined by a pathologist.
[0346] An immune attack on the nanoparticles themselves can be avoided by coating the particles with biocompatible polymers like polyethylene glycol (PEG). It has been shown that nanoparticles coated with PEG are only minimally taken up by macrophages (Zahr, et al., Langmuir (Am Chem Soc) (2006) 22:8178-8185.). However, we may find that Mpr1 is immunogenic, which would imply that the Mpr1-conjugated-nanoparticles might be targeted for destruction by the immune system. We can address the potential immunogenicity of Mpr1 by: 1) immunosuppressing the animals by chemical induction before inoculation with the conjugate and 2) delivery vehicles can be further conjugated with specific peptides that will modulate the immune system and minimize an attack on the conjugate (Fang, et al., Expt. Op. Bio. Ther. (2012) 12:385-389, Zolnik et al., Endocrinology (2010) 151:458-465).
Example 5
Using Mpr1 to Target Stem Cells
[0347] Mpr1, or fragments thereof, can be expressed in stem cells. In varying embodiments, the FTP or pro-domain can be removed since this may act as an inhibitory domain. Normally Mpr1 is able to cleave this site and produce the active form of the protein, however, cells that normally do not produce Mpr1 may not be able to produce enzymatically active Mpr1 without removal of the FTP domain.
[0348] Standard molecular biology methods would be used to subclone Mpr1 into a commercially available mammalian expression vector under the control of a promoter (e.g., constitutive or inducible) in order to express Mpr1 in stem cells. Stem cells (e.g., neuronal, mesenchymal, induced pluripotent stem cells) are transfected (e.g., using commercially available methods) with the Mpr1-expression vector. Mpr1 expressed by the stem cells specifically targets the stem cells to the brain by facilitating their migration across the blood-brain barrier. The Mpr1-expressing stem cells are used as direct therapy in the case of neurodegeneration and/or are engineered to carry an antibody or peptide that acts to block tumor formation.
[0349] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, sequences identified by GenBank accession numbers, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
TABLE-US-00001 INFORMALSEQUENCELISTING SequenceIDNo:1-aminoacidsequenceofMPR1from Strain:Cryptococcusneoformansvar.neoformansB-3501A SerotypeD CNBJ1810(locustag) Chromosome10 Protein:831aa Signalpeptide:residues1-20(MRSSALIALLPLLATLVTAR) FTPdomain:residues95-141 (DSYTDARTGVTHIFARQLLNGLEVSDGDINLNIDRDGRIISWGNSFH) PeptidaseM36domain:residues446-722 (TVGNNAYAHENWEGRNNFLLNSRPINDSHIFVYDYGEPEGLAPKEYVDMVVTQLFYTANM YHDLLYRLGFDEISGNFQAYNFRLGGKGGDPVVCNAQDGSGYNNANFLTPPDGQAPRMRMY IWDTATPYRDGDLEAGIVIHEYSHGLSTRLTGGPANSGCLGYGEAGGMGEGWGDAIATLVR QVEEHKNFENGTDVFSMGAWAANTDRGIRNYKYSTNFTINPSTYKTLDKPGYWGVHAIGEV WAEFLFVLSQRLVEKYGFGTTLFPPTDTSKPND) ZincBindingDomain:residues586-590(HEYSH) 1MRSSALIALLPLLATLVTARPHHHEHKHSASRTRKSLSFGPAHSHASFEVLDDAVHAIEP 61RGLIGEPIDVNRVAQTFLGSQLGAQEGEGFYIREDSYTDARTGVTHIFARQLLNGLEVSD 121GDINLNIDRDGRIISWGNSFHPGSAPSLSDIHSSSSGETEKVCATLHQQLDEHKAHLAEL 181KGETGVWGLVKSAAQVVLGSSLPQGEVDHHEIKKVHKSMRHIENHLHAVCRQSAASTQSM 241LSPVEALVSLLPRLSPIDDLEDISPLDLTCTPHHTLKPKPAFAEPPTEVISGAALSKAGV 301VSDVSARLMYTQVSEGAPRLVWKYEVEMKDSWYEAYVDVLSGELIRVVDWASDFDIDELR 361EKIEMMKGGKQKPLPSPPKTIKPYSYQVFPWGINDPVSGNLSVVTEPWDTVASPLGWHTF 421PTSANPWDVTIPGQTTNHNYTVFNTTVGNNAYAHENWEGRNNFLLNSRPINDSHIFVYDY 481GEPEGLAPKEYVDMVVTQLFYTANMYHDLLYRLGFDEISGNFQAYNFRLGGKGGDPVVCN 541AQDGSGYNNANFLTPPDGQAPRMRMYIWDTATPYRDGDLEAGIVIHEYSH GLSTRLTGGP 601ANSGCLGYGEAGGMGEGWGDAIATLVRQVEEHKNFENGTDVFSMGAWAANTDRGIRNYKY 661STNFTINPSTYKTLDKPGYWGVHAIGEVWAEFLFVLSQRLVEKYGFGTTLFPPTDTSKPN 721DYYTRTSEESIDAGGRSLPLVPKHGNTLAIQLIVDAMKLQPCRPSFFDARNAIIQADQIL 781TGGENACLIWEAFAERGLGEDAAVVGQTPWGGGVRSDGFRVPKKVCGSKKA SequenceIDNo:2-nucleicacidsequenceofMPR1from Strain:Cryptococcusneoformansvar.neoformansB-3501A SerotypeD CNBJ1810(locustag) Chromosome10 Gene:2496nt 1atgcgctcctccgcgctcatcgcgcttcttcctctccttgccactctggttactgctcgt 61ccccatcatcatgagcacaagcacagtgcatctagaactcgcaagtcattatcctttgga 121cctgctcattctcatgcctccttcgaggttcttgatgatgctgttcatgccatcgagcca 181cgtggcctcataggcgagcctatcgatgtcaaccgagtggctcaaaccttcctcggatct 241cagctgggtgcccaggagggcgaaggattctacatccgagaagacagctataccgatgcc 301cgaaccggcgtgacccatatcttcgctcgtcaactcctcaatggtcttgaagtgtctgat 361ggcgatatcaacctcaacattgaccgtgatggtcgaatcatatcttggggtaattctttc 421cacccaggatcagcccctagcctttccgacatccattcttcctcttcaggagaaactgaa 481aaggtctgcgcgacccttcaccaacagcttgacgagcacaaggcccatttggctgagctg 541aagggtgagaccggcgtctggggacttgttaagtcagccgcacaagttgtccttggttct 601tccttgcctcagggtgaggttgaccaccacgagatcaagaaggttcacaagtccatgaga 661cacattgaaaaccacttgcatgccgtgtgtcgccagtccgctgccagcacccagtctatg 721ctctcaccggtggaagcccttgtttctcttcttccccgtctctctcccattgatgatctc 781gaggacatttcacctttagacctaacctgtacaccccaccacactctcaagcccaagccc 841gcctttgctgaacctcctacagaggtcatttctggcgccgctctttccaaggctggcgtt 901gtatctgatgtctctgctcgtctcatgtacacacaggtctctgagggtgctcctcgcctt 961gtctggaaatatgaggttgagatgaaggacagttggtacgaggcttatgtggatgtcctc 1021tctggcgagctcattcgagtggtagactgggcgagtgactttgacattgatgaactcagg 1081gagaaaattgagatgatgaagggcggcaagcagaagcctttgccctctcctccgaagacg 1141attaagccctattcttaccaagtcttcccttggggtatcaatgaccctgtttccggcaac 1201ttgtctgtggtgacagagccttgggacacagttgcctctcctcttgggtggcacacgttc 1261cctacctccgctaacccctgggacgtcactattcctggtcagactacgaatcacaactac 1321accgttttcaatactaccgttggtaacaacgcttatgctcacgaaaactgggaaggccgc 1381aataacttcttgctcaactcccgacctatcaatgactctcacatttttgtgtacgactat 1441ggggagccggaaggcctcgctccgaaggagtatgtcgacatggttgtcactcagctcttc 1501tacacagcgaatatgtaccacgatcttctctaccgtctcggtttcgatgagatctccggt 1561aacttccaggcttacaacttcaggctcggtggcaagggtggcgaccctgtcgtctgtaat 1621gctcaggacggaagcggttacaacaatgccaactttttgactcctccggatggtcaggct 1681cctaggatgaggatgtacatttgggacactgctactccttatcgagatggtgacctcgag 1741gctggtattgtcattcacgagtacagccacggtctctcaactcgtttgactggtggccca 1801gccaactctggatgtctcggctacggtgaagccggcggaatgggcgagggatggggtgat 1861gctattgctacccttgtcagacaggttgaggagcataagaacttcgagaacggcaccgac 1921gttttctctatgggcgcctgggctgccaacactgaccgaggtattagaaactacaagtac 1981tctaccaattttacgattaatccctctacgtacaagaccttagacaagcctggttactgg 2041ggtgttcacgccattggtgaggtatgggccgagttcctcttcgtcttgtctcagcgtctc 2101gttgaaaagtacggttttggcaccactcttttccctcctaccgatacttcgaagcccaac 2161gactactacaccaggacttccgaagagtcgattgatgcgggtggtcgatcccttcctctt 2221gtcccgaaacacggtaatacccttgccattcagctcatcgttgacgccatgaagcttcag 2281ccctgtaggccatcgttcttcgatgcccgtaatgcaatcatacaggccgaccaaatcttg 2341actggcggtgagaatgcctgtttgatctgggaggcctttgccgaacgtggtttgggtgag 2401gatgcggctgttgttggccagactccctggggtggtggtgttaggagcgacggtttcagg 2461gtccccaagaaggtctgcgggtccaaaaaggcttga SEQIDNO:3-aminoacidsequenceforMPR1from Strain:Cryptococcusneoformansvar.neoformansJEC21 SerotypeD CNJ01650(locustag) Chromosome10 Protein:831aa Signalpeptide:residues1-20(MRSSALIALLPLLATLVTAR) FTPdomain:residues95-141 (DSYTDARTGVTHIFARQLLNGLEVSDGDINLNIDRDGRIISWGNSFH) PeptidaseM36domain:residues446-722 (TVGNNAYAHENWEGRNNFLLNSRPINDSHIFVYDYGEPEGLAPKEYVDMVVTQLFYTANM YHDLLYRLGFDEISGNFQAYNFRLGGKGGDPVVCNAQDGSGYNNANFLTPPDGQAPRMRMY IWDTATPYRDGDLEAGIVIHEYSHGLSTRLIGGPANSGCLGYGEAGGMGEGWGDAIATLVR QVEEHKNFENGTDVFSMGAWAANTDRGIRNYKYSTNFTINPSTYKTLDKPGYWGVHAIGEV WAEFLFVLSQRLVEKYGFGTTLFPPTDTSKPND) ZincBindingDomain:residues586-590(HEYSH) 1MRSSALIALLPLLATLVTARPHHHEHKHSASRTRKSLSFGPAHSHASFEVLDDAVHAIEP 61RGLIGEPIDVNRVAQTFLGSQLGAQEGEGFYIREDSYTDARTGVTHIFARQLLNGLEVSD 121GDINLNIDRDGRIISWGNSFHPGSAPSLSDIHSSSSGETEKVCATLHQQLDEHKAHLAEL 181KGETGVWGLVKSAAQVVLGSSLPQGEVDHHEIKKVHKSMRHIENHLHAVCRQSAASTQSM 241LSPVEALVSLLPRLSPIDDLEDISPLDLTCTPHHTLKPKPAFAEPPTEVISGAALSKAGV 301VSDVSARLMYTQVSEGAPRLVWKYEVEMKDSWYEAYVDVLSGELIRVVDWASDFDIDELR 361EKIEMMKGGKQKPLPSPPKTIKPYSYQVFPWGINDPVSGNLSVVTEPWDTVASPLGWHTF 421PTSANPWDVTIPGQTTNHNYTVFNTTVGNNAYAHENWEGRNNFLLNSRPINDSHIFVYDY 481GEPEGLAPKEYVDMVVTQLFYTANMYHDLLYRLGFDEISGNFQAYNFRLGGKGGDPVVCN 541AQDGSGYNNANFLTPPDGQAPRMRMYIWDTATPYRDGDLEAGIVIHEYSH GLSTRLTGGP 601ANSGCLGYGEAGGMGEGWGDAIATLVRQVEEHKNFENGTDVFSMGAWAANTDRGIRNYKY 661STNFTINPSTYKTLDKPGYWGVHAIGEVWAEFLFVLSQRLVEKYGFGTTLFPPTDTSKPN 721DYYTRTSEESIDAGGRSLPLVPKHGNTLAIQLIVDAMKLQPCRPSFFDARNAIIQADQIL 781TGGENACLIWEAFAERGLGEDAAVVGQTPWGGGVRSDGFRVPKKVCGSKKA SEQIDNO:4-nucleicacidsequenceforMPR1from Strain:Cryptococcusneoformansvar.neoformansJEC21 SerotypeD CNJ01650(locustag) Chromosome10 Gene:2496nt 1atgcgctcctccgcgctcatcgcgcttcttcctctccttgccactctggttactgctcgt 61ccccatcatcatgagcacaagcacagtgcatctagaactcgcaagtcattatcctttgga 121cctgctcattctcatgcctccttcgaggttcttgatgatgctgttcatgccatcgagcca 181cgtggcctcataggcgagcctatcgatgtcaaccgagtggctcaaaccttcctcggatct 241cagctgggtgcccaggagggcgaaggattctacatccgagaagacagctataccgatgcc 301cgaaccggcgtgacccatatcttcgctcgtcaactcctcaatggtcttgaagtgtctgat 361ggcgatatcaacctcaacattgaccgtgatggtcgaatcatatcttggggtaattctttc 421cacccaggatcagcccctagcctttccgacatccattcttcctcttcaggagaaactgaa 481aaggtctgcgcgacccttcaccaacagcttgacgagcacaaggcccatttggctgagctg 541aagggtgagaccggcgtctggggacttgttaagtcagccgcacaagttgtccttggttct 601tccttgcctcagggtgaggttgaccaccacgagatcaagaaggttcacaagtccatgaga 661cacattgaaaaccacttgcatgccgtgtgtcgccagtccgctgccagcacccagtctatg 721ctctcaccggtggaagcccttgtttctcttcttccccgtctctctcccattgatgatctc 781gaggacatttcacctttagacctaacctgtacaccccaccacactctcaagcccaagccc 841gcctttgctgaacctcctacagaggtcatttctggcgccgctctttccaaggctggcgtt 901gtatctgatgtctctgctcgtctcatgtacacacaggtctctgagggtgctcctcgcctt 961gtctggaaatatgaggttgagatgaaggacagttggtacgaggcttatgtggatgtcctc 1021tctggcgagctcattcgagtggtagactgggcgagtgactttgacattgatgaactcagg 1081gagaaaattgagatgatgaagggcggcaagcagaagcctttgccctctcctccgaagacg 1141attaagccctattcttaccaagtcttcccttggggtatcaatgaccctgtttccggcaac 1201ttgtctgtggtgacagagccttgggacacagttgcctctcctcttgggtggcacacgttc 1261cctacctccgctaacccctgggacgtcactattcctggtcagactacgaatcacaactac 1321accgttttcaatactaccgttggtaacaacgcttatgctcacgaaaactgggaaggccgc 1381aataacttcttgctcaactcccgacctatcaatgactctcacatttttgtgtacgactat 1441ggggagccggaaggcctcgctccgaaggagtatgtcgacatggttgtcactcagctcttc 1501tacacagcgaatatgtaccacgatcttctctaccgtctcggtttcgatgagatctccggt 1561aacttccaggcttacaacttcaggctcggtggcaagggtggcgaccctgtcgtctgtaat 1621gctcaggacggaagcggttacaacaatgccaactttttgactcctccggatggtcaggct 1681cctaggatgaggatgtacatttgggacactgctactccttatcgagatggtgacctcgag 1741gctggtattgtcattcacgagtacagccacggtctctcaactcgtttgactggtggccca 1801gccaactctggatgtctcggctacggtgaagccggcggaatgggcgagggatggggtgat 1861gctattgctacccttgtcagacaggttgaggagcataagaacttcgagaacggcaccgac 1921gttttctctatgggcgcctgggctgccaacactgaccgaggtattagaaactacaagtac 1981tctaccaattttacgattaatccctctacgtacaagaccttagacaagcctggttactgg 2041ggtgttcacgccattggtgaggtatgggccgagttcctcttcgtcttgtctcagcgtctc 2101gttgaaaagtacggttttggcaccactcttttccctcctaccgatacttcgaagcccaac 2161gactactacaccaggacttccgaagagtcgattgatgcgggtggtcgatcccttcctctt 2221gtcccgaaacacggtaatacccttgccattcagctcatcgttgacgccatgaagcttcag 2281ccctgtaggccatcgttcttcgatgcccgtaatgcaatcatacaggccgaccaaatcttg 2341actggcggtgagaatgcctgtttgatctgggaggcctttgccgaacgtggtttgggtgag 2401gatgcggctgttgttggccagactccctggggtggtggtgttaggagcgacggtttcagg 2461gtccccaagaaggtctgcgggtccaaaaaggcttga SEQIDNO:5-aminoacidsequenceofMPR1from Strain:CryptococcusgattiiWM276 SerotypeB CGB_I230C(locustag) ChromosomeI Protein:831aa Signalpeptide:residues1-20(MRSSALIALLPLLATLTAAR) FTPdomain:residues95-141 (DGYTDSRTGVTHIFARQLLNGLEVSDGDINLNIDRDGRIMSFGNSFH) PeptidaseM36domain:residues446-722 (TAGNNAIAQENWEGRNNFLLNYRPMNDSHMFMHEYGEPEGLAPKEYVDMIITQLFYTANM YHDLLYRLGFNEVSGNFQAYNFGLGGKGGDPVVCNAQDGSGYNNANFLTPPDGQAPRMRMY IWDTATPYRDGDLEAGIVIHEYSHGLSTRLIGGPANSGCLGYGEAGGMGEGWGDAIATLVR QVEEHRNFENGTDVFPMGSWAANTPKGIRNYLYTTDPTVNPSTYKTLDKPGYWGVHAIGEV WAEFLFVLSERFVETYGFGPTLFPPTNTSEPND) ZincBindingDomain:residues586-590(HEYSH) 1MRSSALIALLPLLATLTAARPHHHEHKHSASRTRKSLSFGPVHSHASFEVLTEAAPVIES 61RQLKDEPMDVIRVAQTFLRSQLGTQEGEGFYIRDDGYTDSRTGVTHIFARQLLNGLEVSD 121GDINLNIDRDGRIMSFGNSFHPGSAPDLSAVHSSSSGETERVCATLRQQLDEYKAHLAEL 181KGETGVWGLVKSAAEVVLGSSMPQGEVDHHEIKKTIKSMSLIENHLQAVCHRPTASTQSM 241LSPVDAVVSLLPRLSPNDDLEDISPLELTSTPHHTLKPKPAFAEPPTEVISGAALSKAGV 301VSDVPARLMYTQVSEGAPRLVWKCEVEMKDSWYEAYVDVFSGELIRVVDWASDYDIDELI 361KKIEMTNGGKQKPLPGPPENAKPYSYLVFPWGVNDPLCGNLSVETEPWDTVASPLGWHMF 421PNSANPWDVTIPGQHTNHTHTVFNTTAGNNAIAQENWEGRNNFLLNYRPMNDSHMFMHEY 481GEPEGLAPKEYVDMIITQLFYTANMYHDLLYRLGFNEVSGNFQAYNFGLGGKGGDPVVCN 541AQDGSGYNNANFLTPPDGQAPRMRMYIWDTATPYRDGDLEAGIVIHEYSH GLSTRLTGGP 601ANSGCLGYGEAGGMGEGWGDAIATLVRQVEEHRNFENGTDVFPMGSWAANTPKGIRNYLY 661TTDPTVNPSTYKTLDKPGYWGVHAIGEVWAEFLFVLSERFVETYGFGPTLFPPTNTSEPN 721DYYTSTFEESVDAAGRPRPLVPKHGNTLALQLIVDGMKLQPCRPSFFDARDAIIQADQIL 781TGGENACLIWEAFAERGLGQDATVVGQTPWGGGVRTDGHKVPKNICGSKKA SEQIDNO:6-nucleicacidsequenceofMPR1from Strain:CryptococcusgattiiWM276 SerotypeB CGB_I230C(locustag) ChromosomeI Gene:2469nt 1atgcgctcctccgcgctcattgccctccttcctctcctcgccactctgactgctgctcgt 61ccccatcatcatgagcacaagcacagtgcatccaggactcgcaagtcattgtcttttgga 121cctgttcattctcatgcctcctttgaggttcttactgaagctgctcctgtcatcgagtca 181cgtcaactcaaagacgaacctatggatgtcatacgagtcgctcagaccttcctccgatct 241cagctgggtacccaggagggcgaaggattttacattcgagacgacggctataccgactct 301cgaaccggcgtgacccacatctttgctcgtcaactcctcaatggtcttgaagtgtccgat 361ggtgacatcaacctcaacattgaccgcgatggtcggatcatgtcctttggtaattctttc 421caccccggatcagcccctgacctttccgccgtccattcttcttcttcgggcgaaaccgaa 481agggtctgcgcgacccttcgtcaacagcttgacgagtacaaggcccacttggctgaacta 541aagggtgagaccggtgtctgggggcttgtcaagtctgccgcagaagttgtccttggttct 601tccatgccgcagggtgaggttgaccaccacgagatcaagaagactattaagtccatgagc 661cttattgaaaaccatttgcaagccgtgtgccatcgacccactgccagtacccaatctatg 721ctctcgccagtagatgccgttgtttctcttcttccccgtctctctcccaatgatgatctc 781gaggacatttcacctcttgaattaacctctactccccaccacactctcaagcccaagccc 841gcctttgccgaacctcctactgaggtcatttccggcgctgctctttccaaggctggcgtt 901gtatctgatgttcctgctcggctcatgtatacccaggtctccgagggtgctcctcgcctt 961gtctggaaatgtgaggttgagatgaaggacagttggtacgaggcttatgttgatgtcttc 1021tccggcgagctcatacgagtggttgactgggcgagtgactatgacattgacgaactcata 1081aagaaaattgagatgacgaacggtggcaagcagaaacctttgcccggtccaccggagaac 1141gctaagccctactcttacctggtcttcccctggggtgtcaatgaccctctttgcggcaac 1201ttgtctgtggagacagaaccctgggacacagttgcctctcctcttgggtggcacatgttc 1261cccaactcggctaacccctgggatgtcacgattcctggccagcatacgaatcacacccac 1321acagtcttcaatactaccgctggtaacaacgctattgctcaagaaaactgggaaggccgc 1381aataacttcttgctcaattaccgacctatgaatgattctcacatgtttatgcacgagtat 1441ggagagccggaaggcctcgctccgaaggagtacgtcgatatgattatcactcagctcttt 1501tacacagcgaatatgtaccacgatcttctctaccgcctcggttttaatgaggtctctggt 1561aacttccaggcttacaattttgggctcggtggcaagggtggagaccctgtcgtctgtaac 1621gctcaggacggaagcggttacaacaatgccaacttcttgactccccctgatggtcaagcc 1681cctaggatgaggatgtacatttgggacactgctactccttaccgcgatggtgacctcgag 1741gctggtattgtcattcacgagtacagccacggtctctcaactcgccttactggtggccca 1801gccaattctgggtgtctcggatacggtgaggctggtggtatgggagaaggatggggtgat 1861gctattgcaacccttgttaggcaggttgaggagcacaggaatttcgagaacggcaccgac 1921gtcttccctatgggttcttgggctgccaacaccccaaaaggtattcggaactacctgtac 1981accaccgaccctaccgtaaatccctccacttacaagaccttggataagcctggttactgg 2041ggtgtccacgccattggtgaggtctgggccgagttcctcttcgtcttgtctgagcgtttt 2101gttgaaacgtacggatttggccctactcttttccctcctaccaatacttccgagcccaac 2161gactactacaccagtactttcgaagagtcagtcgatgcggctggtcgaccccgtcctctt 2221gtcccgaagcacggtaatactctagcccttcagttgatcgttgacggcatgaagcttcag 2281ccctgcaggccatcgttcttcgatgcccgtgatgcgatcattcaggccgaccagatcttg 2341actggcggtgagaatgcttgtttgatctgggaggcctttgccgaacgcggtttgggtcag 2401gacgcgactgttgttggccaaactccttggggtggcggtgttaggaccgacggccacaag 2461gtcccgaagaatatctgcgggtccaagaaggcttag SEQIDNO:7-aminoacidsequenceofMPR1from Strain:Cryptococcusneoformansvar.grubiiH99 CNAG_0735.2(locus) Chromosome10(location) Protein:722aa Signalpeptide:residues1-20(MRSSALIALLPFLATLTAAR) FTPdomain:residues95-141 (DSYTDARTGVTHIFARQLLNGLEVSDGDINLNIDRDGRIMSWGNSFH) PeptidaseM36domain:residues446-706 (TAGNNVYAHENWEGRNNFLLNYRPTNDSHIFVYEYGEPEGLAPKEYVDMVVTQLFYTANM YHDLLYRLGFDELSGNFQAYNFRLGGKGGDPVVCNAQDGSGYNNANFLTPPDGQAPRMRMY IWDTATPYRDGDLEAGIVIHEYSHGLSTRLIGGPANSGCLGYGEAGGMGEGWGDAIATLIR QVEEHKNFENGTDVFSMGAWAANSNRGIRNYKYSTNFTINPSTYKTLDKPGYWGVHAIGEV WAEFLFVLSQRLVENPAG) ZincBindingDomain:residues586-590(HEYSH) MRSSALIALLPFLATLTAARPHHREDKHSASRTRKSLSFGPAHSHASFEVLDDAVHVFEPRGLIDEPIDVKRVA QTFLGSQLGAQEGEGFYIREDSYTDARTGVTHIFARQLLNGLEVSDGDINLNIDRDGRIMSWGNSFHPGSVPSL SDIHSSSSGETEKVCTTLHQHLDEHKAHLAELKGETGIWGLVKSAAQVVLGSSLPLGEVDHHEIKETHKSMRHI ENHLRAMCDQPAVSTQSMLSPVEALVSLLPRLSPIDDLEDISPFDLTSTPHHTLKPKPAFAEPPTEVISGAALS KAGVVSDVSARLMYTQVSEGAPRLVWKYEVEMKDSWYEAYVDVLSGELIRVVDWASDFDIDELRDKIEMMKGGK QKPLPIPPKKIQPYSYQVFPWGINDPVSGNLSVVTEPWDTVASPLGWHSFPTSANPWDVTIPGETTNHNYTVFN TTAGNNVYAHENWEGRNNFLLNYRPTNDSHIFVYEYGEPEGLAPKEYVDMVVTQLFYTANMYHDLLYRLGFDEL SGNFQAYNFRLGGKGGDPVVCNAQDGSGYNNANFLTPPDGQAPRMRMYIWDTATPYRDGDLEAGIVIHEYSHGL STRLTGGPANSGCLGYGEAGGMGEGWGDAIATLIRQVEEHKNFENGTDVFSMGAWAANSNRGIRNYKYSTNFTI NPSTYKTLDKPGYWGVHAIGEVWAEFLEVLSQRLVENPAGHHSSMPVMRSFRPTKS* SEQIDNO:8-nucleicacidsequenceofMPR1from Strain:Cryptococcusneoformansvar.grubiiH99 CNAG_0735.2(locus) Chromosome10(location) Gene:3074nt(thefollowingsequenceincludesintrons) tctgttccataaactactcatagctcggcttccttctatacactactgtagcattaccgtagtatcgccaccat gcgctcctccgcgctcatcgctcttcttcctttccttgccaccctgactgctgctcgtccccatcatcgtgagg ataagcatagtgcatctaggactcgcaagtcattatcctttggacctgctcattctcatgcctccttcgaggtt cttgatgatgctgttcacgtcttcgagccacgtggactcatagacgagcctatcgatgtcaaacgagtggctca gactttcctcggatctcagttgggtgcccaggagggcgagggattctacattcgagaagacgtaagtgttctgc tgtggttctctatttttgactgggactagcgtggtatcctttcgtaggatggcatggcggacgacgtaacgcta acgattcgcagagctataccgatgcccgaaccggcgtgacccatattttcgctcgtcaactcctcaatggcctt gaagtatccgatggcgacatcaacctcaacattgaccgtgatggtcgaatcatgtcatggggtaattctttcca ccccggatcagtccctagcctttccgacatccattcttcctcttcgggcgaaactgaaaaggtttgcacgaccc ttcaccaacatcttgacgagcacaaggcccacttggctgagctgaaaggtgagaccggtatctggggacttgtc aagtctgcagcacaagttgttctcggttcttccttgcctctgggtgaggttgaccaccacgagatcaaggagac tcacaagtccatgaggcatattgaaaaccacctgcgtgccatgtgcgaccagccggctgtcagcacccaatcta tgctctcgccggtggaggcccttgtttctcttcttccccgtctctctcccattgatgatctcgaggacatttca ccgtttgacttaacctctacaccccaccacactctcaagcccaagcccgcctttgctgaacctcctactgaggt catttctggcgctgcactttccaaggctggcgttgtatctgatgtctctgcgcgactcatgtacacacaggtct ctgagggtgctcctcgccttgtctggaaatatgaggttgagatgaaggacagttggtacgaggcttacgtggat gtcctctcaggcgagctcattcgggtggtagactgggcgagtgactttgacattgatgaactcagggataaaat tgagatgatgaagggcggcaagcagaaacctttgcccattcccccgaagaagattcagccctactcttaccaag tcttcccttggggtgagttgctttatctcgcattacccctattgtgctaatgtattgtgcgccaggtatcaatg accctgtttccggcaacttgtctgtggtgacagagccttgggacacagttgcctctcctcttgggtggcactcg ttccctacttccgctaacccctgggatgtcaccattcctggtgagactacgaatcacaactacaccgttttcaa tactactgctggtaataacgtttatgcgcacgaaaactgggaaggccgcaataacttcttgctcaactaccgac ctaccaatgattctcacatctttgtgtacgaatatggagagccggaaggcctcgctccgaaggagtatgtcgac atggttgtcactcagctcttctacacggcgaatatgtaccacgatcttctctaccgtctcggcttcgatgagtt atccggtaacttccaggcttacaatttcaggcttggtggcaagggtggcgaccctgtcgtttgtaatgctcagg atggaagtggttacaataatgccaactttttgactcctccggatggccaggctcctaggatgaggatgtacatt tgggacacagctactccttatcgggatggtgacctcgaggctggtattgtcattcacgagtacaggtatgtctg cttgacacttttttacttcactgtattaacgcgccacaagccacggtctctcaactcgtctgactggtggtcca gccaactctgggtgtctcggatacggtgaagccggcggtatgggtgagggatggggcgatgctattgccaccct tatcaggcaggttgaggagcataagaacttcgagtaggttagataatcacgcatgttcctgcagaaaaactaat ttgtgaacatgtagaaacggcaccgacgttttctctatgggcgcctgggctgccaacagtaaccgaggtattag gaattacaagtactctaccaatttcacgattaatccctctacttacaagaccttagacaagcctggtaagtacg attttgaaccatgtcatcaagcagacagcttagacagcttatatccattaaaggttactggggggtccacgcca ttggtgaggtatgggccgagttcctcttcgtcttgtctcagcgcctcgttgaaaagtacggttttgggcccact cttttccctcctaccgatacttcgaagcacaacgactactacaccaggacttccgaagagtcggttgatgccgc tggtcgaccccttcctcttgtcccgaaatacggtaatgctcttgccattcagctcatcgttgacgccatgaagc ttcagccctgcaggccatcattcttcgatgcccgtaatgcgatcattcaggccgaccaaatcttgactggcggt gagaatgcttgtttgatctggcaggcctttgccgaacgtggtttgggtgaggatgcggccgttgttggccagac gccctggggtggtggtgttaggagcgacggtttcaaggtccccaagaaggtctgcgagtccaaaaaggcttgaa agatgaaagcgctgtattctgatctagaatcttaccccgttccaagctagagttctgtactttgaattttgtac gatagcatgtgtatggtctttttatgttctgccattgatcatcttgaagattgatgttgtagtcgaatagatct ttgttgaagtgaatccttaactatatgcaacgatcgcaaa