LIGANDS THAT POTENTIATE THE BIOACTIVITY OF GONADOTROPINS

20170190774 · 2017-07-06

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention relates to antibodies directed against follicle-stimulating hormone (FSH) and capable of potentiating the bioactivity of gonadotropins.

Claims

1-16. (canceled)

17. A follicle-stimulating hormone (FSH) ligand which potentiates the bioactivity of FSH, of luteinizing hormone (LH), and of chorionic gonadotropin (CG), wherein said ligand is an antibody or a fragment thereof, and wherein: the heavy chain variable domain of the antibody or the fragment thereof contains the following CDRs: VH-CDR1, defined by the sequence GFTFSDFY (SEQ ID NO : 9); VH-CDR2, defined by the sequence SRNKAKDYTT (SEQ ID NO : 10); VH-CDR3, defined by the sequence ARDARFAY (SEQ ID NO : 11); and the light chain variable domain of the antibody or the fragment thereof contains the following CDRs: VL-CDR1, defined by the sequence QSLLYSSNQKNY (SEQ ID NO : 12); VL-CDR2, defined by the sequence WAS; VL-CDR3, defined by the sequence QQYYSYPRT (SEQ ID NO : 13).

18. A follicle-stimulating hormone (FSH) ligand which potentiates the bioactivity of FSH, of luteinizing hormone (LH), and of chorionic gonadotropin (CG), wherein said ligand is an antibody or a fragment thereof, and wherein: the heavy chain variable domain of the antibody or the fragment thereof contains the sequence SEQ ID NO: 2 or 47; and/or the light chain variable domain of the antibody or the fragment thereof contains the sequence SEQ ID NO: 4 or 45.

19. A follicle-stimulating hormone (FSH) ligand which potentiates the bioactivity of FSH, of luteinizing hormone (LH), and of chorionic gonadotropin (CG), wherein said ligand is an antibody or a fragment thereof, and wherein: the heavy chain variable domain of the antibody or the fragment thereof contains the following CDRs: VH-CDR1, defined by the sequence GFTFNTYA (SEQ ID NO: 14); VH-CDR2, defined by the sequence IRSKSNNYAT (SEQ ID NO: 15); VH-CDR3, defined by the sequence VRQDYYGSSYFDY (SEQ ID NO: 16); and the light chain variable domain of the antibody or the fragment thereof contains the following CDRs: VL-CDR1, defined by the sequence QSISDY (SEQ ID NO: 17); VL-CDR2, defined by the sequence YAS; VL-CDR3, defined by the sequence QNGHSFPYT (SEQ ID NO: 18).

20. A follicle-stimulating hormone (FSH) ligand which potentiates the bioactivity of FSH, of luteinizing hormone (LH), and of chorionic gonadotropin (CG), wherein said ligand is an antibody or a fragment thereof, and wherein: the heavy chain variable domain of the antibody or the fragment thereof contains the sequence SEQ ID NO: 6; and/or the light chain variable domain of the antibody or the fragment thereof contains the sequence SEQ ID NO: 8.

21. The ligand as claimed in claim 17, characterized in that the ligand is chosen from the group consisting of Fab, Fab, F(ab)2, Fv, dsFv, scFv, diabodies, triabodies, tetrabodies and nanobodies, light chain variable domain, and heavy chain variable domain.

22. The ligand as claimed in claim 17, characterized in that the ligand is the CA5 monoclonal antibody produced by the CNCM I-4801 hybridome.

23. The ligand as claimed in claim 19, characterized in that the ligand is the CH10 monoclonal antibody produced by the CNCM I-4802 hybridome.

24. The ligand as claimed in claim 21, characterized in that the peptide sequence of the scFv is the sequence SEQ ID NO: 20 or SEQ ID N : 22.

25. The ligand as claimed in claim 17, for use as a medicament.

26. A ligand-gonadotropin complex chosen from: a complex of a ligand as claimed in claim 17 with FSH or an active peptide thereof; a complex of a ligand as claimed in claim 17 with LH or the chorionic gonadotropin (CG) hormone, or an active peptide of said hormones.

27. The complex as claimed in claim 26, for use as a medicament.

28. The ligand for use as claimed in claim 25, wherein said medicament is intended to induce ovulation or polyovulation in a female mammal.

29. The ligand for use as claimed in claim 25, wherein said medicament is intended to increase the circulating endogenous progesterone level in a female mammal.

30. A pharmaceutical composition intended to be used for inducing ovulation or polyovulation in a female mammal, characterized in that it comprises a ligand as claimed in claim 17 and a pharmaceutically acceptable carrier.

31. The pharmaceutical composition as claimed in claim 30, characterized in that it also comprises an FSH, an LH and/or a CG.

32. The ligand as claimed in claim 17, for use in the treatment and/or prevention of infertility or of hypofertility in a mammal.

33. The ligand as claimed in claim 17, for use in stimulating procreation in a healthy female mammal.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0061] FIG. 1 illustrates the in vitro potentiating effect of the CA5 (A) and CH10 (B) monoclonal antibodies on the bioactivity of ovine FSH (oFSH), on bovine granulosa cells.

[0062] FIG. 2 represents the in vitro potentiating effect of the CA5 (A) and CH10 (B) monoclonal antibodies on the bioactivity of ovine FSH (oFSH) on an HEK 293 cell line stably transfected with the human FSH receptor.

[0063] FIG. 3 represents the in vitro potentiating effect of the CA5 monoclonal antibody on the bioactivity of ovine FSH (oFSH) on an HEK 293 cell line stably transfected with the human FSH receptor and the Glosensor vector.

[0064] FIG. 4 represents the potentiating effect of the CA5 monoclonal antibody on the bioactivity of porcine FSH (pFSH) on an HEK 293 cell line stably transfected with the human FSH receptor and the Glosensor vector.

[0065] FIG. 5 represents the in vitro potentiating effect of the CA5 monoclonal antibody (A to E) and of the CA5 scFv (F) on the bioactivity of human FSH (hFSH) on an HEK 293 cell line stably transfected with the human FSH receptor and the Glosensor vector.

[0066] FIG. 6 represents the in vitro potentiating effect of the CH10 monoclonal antibody on the bioactivity of ovine FSH (oFSH) on an HEK 293 cell line stably transfected with the human FSH receptor and the Glosensor vector.

[0067] FIG. 7 represents the potentiating effect of the CH10 monoclonal antibody on the bioactivity of human FSH (hFSH) in vitro on an HEK 293 cell line stably transfected with the human FSH receptor and the Glosensor vector.

[0068] FIG. 8 represents the in vivo potentiating effect of the CA5 monoclonal antibody on the bioactivity of ovine FSH (oFSH) (A) and on the bioactivity of the human FSHs (hFSH) Gonal-F, Puregon and Fostimon (B) in the female rat.

[0069] FIG. 9 represents the in vivo potentiating effect of the CA5 monoclonal antibody on the bioactivity of the human FSH (hFSH) Gonal-F (A) and the potentiating effect of CA5 scFv on the bioactivity of the human FSHs (hFSH) Gonal-F (A), Puregon and Fostimon (B) in the female rat.

[0070] FIG. 10 represents the in vivo potentiating effect of the CH10 monoclonal antibody on the bioactivity of ovine FSH (oFSH) (A) and on the bioactivity of the human FSH (hFSH) Gonal-F (B) in the female rat.

[0071] FIG. 11 represents the in vivo potentiating effect of the CH10 monoclonal antibody on the bioactivity of the human FSHs (hFSH) Puregon and Fostimon (A) and the potentiating effect of CH10 scFv on the bioactivity of the human FSH (hFSH) Gonal-F (B) in the female rat.

[0072] FIG. 12 represents the in vivo potentiating effect of the CA5 monoclonal antibody on the bioactivity of the human chorionic gonadotropins (hCG) Chorulon and Endo 5000 in the male rat.

[0073] FIG. 13 represents the in vivo potentiating effect of the CH10 monoclonal antibody on the bioactivity of the human chorionic gonadotropins (hCG) Chorulon and Endo 5000 in the male rat.

[0074] FIG. 14 represents the in vivo potentiating effect of the CA5 monoclonal antibody on the bioactivity of the endogenous gonadotropins in ewes at the end of the sexual season.

[0075] FIG. 15 represents the in vivo potentiating effect of the CA5 monoclonal antibody on the bioactivity of the endogenous gonadotropins in ewes during the period of the sexual season.

[0076] FIG. 16 represents the in vivo potentiating effect of the CA5 monoclonal antibody injected alone, on the endogenous gonadotropins in heifers: effect on estradiol secretion.

[0077] FIG. 17 represents the in vivo potentiating effect of the CA5 monoclonal antibody injected alone, on the endogenous gonadotropins in heifers: effect on the characteristics of the preovulatory LH peak.

[0078] FIG. 18 represents the in vivo potentiating effect of the CA5 monoclonal antibody injected alone, on the endogenous gonadotropins in heifers: effect on the progesterone secretion.

[0079] FIG. 19 represents the in vivo potentiating effect of the CA5 monoclonal antibody injected alone after 25 IU of hFSH, on follicular growth in female monkeys.

[0080] FIG. 20 represents the conformational epitope of the CA5 ligand on the hFSH, hCG, hLH, oLH, pLH, oFSH and pFSH hormones and on the human FSH receptor.

[0081] FIG. 21 represents the conformational epitope of the CH10 ligand, on the hFSH, hCG, hLH, oLH, pLH, oFSH and pFSH hormones and on the human FSH receptor.

[0082] FIG. 22 represents the in vitro potentiating effect of various fragments of the CA5 monoclonal antibody on the bioactivity of ovine FSH and of human FSH.

[0083] FIG. 23 represents the in vivo potentiating effect, in the female rat, of various fragments of the CA5 monoclonal antibody on the bioactivity of human FSH.

DETAILED DESCRIPTION AND EXAMPLES

Example 1

Obtaining the Ligands of the Invention, and Characterization Thereof

1/Mouse Immunization Strategy

[0084] The injections were all carried out intraperitoneally on mice (Balb/C). Five mice were used for each immunization strategy.

Mouse Immunization Strategy for the CA5 Antibody and the CH10 Antibody

[0085] A first injection (D0) was carried out with 100 g of purified ovine FSH with complete Freund's adjuvant. Several booster injections were then carried out according to the following sequence: [0086] D21 and D44: 100 g of purified ovine FSH with incomplete Freund's adjuvant; [0087] D134 and D204: 50 g of ovine FSH beta-subunit with incomplete Freund's adjuvant; [0088] D217, D218 and D219: 30 g of ovine FSH beta-subunit without adjuvant; [0089] D220: fusion.

2/Isotyping

[0090] The isotyping of the CA5 and CH10 antibodies was carried out with the FastElysa iostyping kit sold by RD Biotech (reference RDB 3255) according to the manufacturers recommendations.

[0091] The CA5 antibody is an immunoglobin of IgG2a class and of Kappa isotype. The optical density (OD) values obtained were 0.335 and 0.371 respectively.

[0092] The CH10 antibody is an immunoglobin of IgM class and of Kappa isotype. The optical density (OD) values obtained were 0.2 and 0.124 respectively.

3/Sequencing

[0093] The nucleotide sequences of the variable part of the heavy (VH) and light (VL) chains of the CA5 and CH10 antibodies secreted by the CNCM I-4801 and CNCM I-4802 hybridomas respectively, were determined from their messenger RNA (mRNA) according to the protocol below.

[0094] The RNAs were extracted from the cells using the Nucleospin RNA kit (Macherey Nagel, Germany) according to the manufacturer's recommendations. The purified RNA concentrations were estimated by measuring the absorbance (A) at 260 nm and their quality was estimated by the A260 nm/280 nm ratio and visually after electrophoretic migration on an agarose gel.

[0095] The complementary DNAs of the mRNAs were then synthesized using an oligo-dT.sub.18 as primer by reverse transcription reaction with the M-MLV enzyme (Ref. M1701, Promega, USA) according to the manufacturer's recommendations.

[0096] The synthesis of the second DNA strand was carried out by a polymerase chain reaction (PCR) according to the following protocol: the following are added to 4 l of the reverse transcription reaction in a final volume of 50 l: the reaction buffer (1 final concentration), 200 M of each dNTP, 300 nM of forward and reverse primers, 1.25 U of GoTaq polymerase (Ref M3175, Promega, USA).

[0097] For the amplification of the variable part of the light chains, nine different primer pairs were used (MKRev2 to 8+MKC5For) and three different pairs for those of the heavy chains (CA5: VHRev1+VHFor, CH10: VHRev1+MpCFor).

TABLE-US-00007 TABLE7 Nucleotidesequencesoftheprimersusedfor sequencingtheheavy(VH)andlight(VL)chains oftheCA5antibody CA5antibody Name 5-3 sequence SEQIDNO HeavyChain(VH) VHRev1 CGGGATCCTCTAGAGGTCCAACTGCAGGAG SEQID TCAGG NO:23 VHFor CAGGGGCCAGTGGATAGAC SEQID NO:24 Lightchain(VL) MKRev5 GACATTGTGATGACCCAGTCT SEQID NO:25 MKC5For GGATACAGTTGGTGCAGCATC SEQID NO:26

TABLE-US-00008 TABLE8 Nucleotidesequencesoftheprimersusedfor sequencingthe5 partoftheheavy(VH) andlight(VL)chainsoftheCA5antibody CA5antibody Name 5-3 sequence SEQIDNO Heavychain(VH) CA5VH_Fw CACTTTTACATGGTATCCAGTG SEQIDNO:27 CA5VH_Rev GTTTCTACTTGCAGCAATCCACT SEQIDNO:28 Lightchain(VL) CA5VL_Fw GAVVTCACAGROCCAGGTYC SEQIDNO:29 CA5VL_Rev CCCAGTAAATCAGCAGTTTAGGA SEQIDNO:30

TABLE-US-00009 TABLE9 Nucleotidesequencesoftheprimersusedfor sequencingtheheavy(VH)andlight(VL)chains oftheCH10antibody CH10antibody Name 5-3 sequence SEQIDNO Heavychain(VH) VHRev1 CGGGATCCTCTAGAGGTCCAACTGC SEQIDNO:23 AGGAGTCAGG MpCFor GGGGAAGACATTTGGGAAGG SEQIDNO:31 Lightchain(VL) MKRev2 GATATTGTGATGACGCAGGCT SEQIDNO:32 MKRev3 GATATTGTGATAACCCAG SEQIDNO:33 MKRev4 GACATTGTGCTGACCCAATCT SEQIDNO:34 MKRev6 GATATTGTGCTAACTCAGTCT SEQIDNO:35 MKRev8 GACATCCAGCTGACTCAGTCT SEQIDNO:36 MKC5For GGATACAGTTGGTGCAGCATC SEQIDNO:37

TABLE-US-00010 TABLE10 Nucleotidesequencesoftheprimersusedfor sequencingthe5 partoftheheavy(VH)and light(VL)chainsoftheCH10antibody CH10antibody Name 5-3 sequence SEQIDNO Heavychain(VH) CH10VH_Fw ATGGTGTTGGGGCTGAAGTG SEQIDNO:38 CH10VH_Rev CAGTTCATGGCGTAGGTATTGA SEQIDNO:39 Lightchain(VL) CH10VL_Fw TTCTGGAYTTCAGCCTCCAG SEQIDNO:40 CH10VL_Rev GATTGGGAAGCATATTTGATGAG SEQIDNO:41

[0098] The PCR program used is composed of an initial denaturation for 2 min at 95 C. followed by 30 cycles of denaturation for 30 sec at 95 C., hybridization for 30 sec at 47 C. and amplification for 1 min at 72 C. and, finally, a final amplification for 5 min at 72 C. The PCR products obtained were desalted with the QIAquickGel extraction kit (Ref 28704, Qiagen GmbH, Germany), then ligated with the pGEMT easy vector plasmid (Ref A1360, Promega, USA) so as to be used to transform bacteria. The plasmid DNA extracted from various bacterial clones was sent for sequencing analysis (Macrogen Europe, the Netherlands).

[0099] The 5-terminal nucleotide sequences of the VH and VL of the two antibodies were subsequently determined through the design of specific primers anchored in the leader sequences of the cDNAs (Fw primer). These primers were designed following the identification of homology by alignment between the VL and VH sequences previously obtained and the database of the IMGT/V-QUEST software (Brochet et al., Nucl. Acids Res., 36 : W503-508, 2008; Giudicelli et al., Cold Spring Harb Protoc., 2011(6) : 695-715, 2011) [3, 4] and extraction of the leader sequences of interest from IMGT/GENE-DB (Giudicelli et al., Nucl. Acids Res., 33 : D256-261, 2005) [5]. The reverse (Rev) primers were designed in the previously determined respective VH and VL sequences of each of the antibodies. The protocol used to obtain the 5 part is the same as that described in the previous paragraph.

[0100] The consensus nucleotide sequences were deduced from the alignment of the sequences using the MultAlin software (Corpet, Nucl. Acids Res., 16(22): 10881-10890, 1988) [6]. The transcription into polypeptide sequences and the annotation of the CDRs were carried out using the IMGT/V-QUEST software. The results are presented in tables 11 to 14.

TABLE-US-00011 TABLE11 Nucleotideandpeptidesequencesoftheheavy(VH)andlight (VL)variablepartsoftheCA5antibody Antibody(CA5) Heavychain(VH) Nucleotide GAGGTGAAGCTGGTGGAATCTGGAGGAGGCTTGGTACAGCCTGG sequence GGGTTCTCTGAGACTCTCCTGTGCAACTTCTGGGTTCACCTTCAG SEQIDNO:1 TGATTTCTACATGGAGTGGGTCCGCCAGCCTCCAGGGAAGAGAC TGGAGTGGATTGCTGCAAGTAGAAACAAAGCTAAGGATTATACAA CAGAGTACAGTGCATCTGTGAAGGGTCGGTTCATCGTCTCCAGAG ACACTTCCCAAAGCATCCTCTACCTTCAGATGAATGCCCTGAGAG CTGAGGACACTGCCATTTATTTCTGTGCAAGAGATGCAAGGTTTG CTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA Peptide EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRL sequence EWIAASRNKAKDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDT SEQIDNO:2 AIYFCARDARFAYWGQGTLVTVSA Lightchain(VL) Nucleotide GACATTGTGATGTCACAGTCTCCATCCTCCCTAGCTGTGTCAGTT sequence GGAGAGAAGATTACTATGAGCTGCAAGTCCAGTCAGAGCCTTTTA SEQIDNO:3 TATAGTAGCAATCAAAAGAACTACTTGGCCTGGTACCAGCAGAAA CCAGGGCAGTCTCCTAAACTGCTGATTTACTGGGCATCCACTAGG GAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGGAC AGATTTCACTCTCACCATCAGCAGTGTGAAGGCTGAAGACCTGGC AGTTTATTACTGTCAGCAATATTATAGCTATCCTCGGACGTTCGGT GGAGGCACCAAGCTGGAAATCAAA Peptide DIVMSQSPSSLAVSVGEKITMSCKSSQSLLYSSNQKNYLAWYQQKP sequence GQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYY SEQIDNO:4 CQQYYSYPRTFGGGTKLEIK

TABLE-US-00012 TABLE12 Nucleotideandpeptidesequencesoftheheavy(VH)andlight (VL)variablepartsoftheCH10antibody CH10antibody Heavychain(VH) Nucleotide GAGGTGCAGCTTGTTGAGTCTGGTGGAGGATTGGTGCAGCCTAA sequence AGGGTCATTGAAACTCTCATGTGCAGCCTCTGGATTCACCTTCAA SEQIDNO:5 TACCTACGCCATGAACTGGGTCCGCCAGGCTCCAGGAAAGGGTT TGGAATGGGTTGCTCGCATAAGAAGTAAAAGTAATAATTATGCAAC ATATTATGCCGATTCAGTGAAAGACAGGTTCACCATCTCCAGAGA TGATTCACAAAGCATGCTCTATCTGCAAATGAACAACTTGAAAACT GAGGACACAGCCATGTATTACTGTGTGAGACAGGATTACTACGGT AGTAGCTACTTTGACTACTGGGGCCAAGGCACCACTCTCACAGTC TCCTCA Peptide EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGL sequence EWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTE SEQIDNO:6 DTAMYYCVRQDYYGSSYFDYWGQGTTLTVSS Lightchain(VL) Nucleotide GACATTGTGATGACTCAGTCTCCAGCCACCCTGTCTGTGACTCCA sequence GGAGATAGAGTCTCTCTTTCCTGCAGGGCCAGCCAGAGTATTAGC SEQIDNO:7 GACTACTTACACTGGTATCAACAAAAATCACATGAGTCTCCAAGG CTTCTCATCAAATATGCTTCCCAATCCATCTCTGGGATCCCCTCCA GGTTCAGTGGCAGTGGATCAGGGTCAGATTTCACTCTCAGTATCA ACAGTGTGGAACCTGAAGATGTTGGAGTGTATTACTGTCAAAATG GTCACAGCTTTCCGTACACGTTCGGAGGGGGGACCAAGCTGGAA ATAAAA Peptide DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLL sequence IKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFP SEQIDNO:8 YTFGGGTKLEIK

TABLE-US-00013 TABLE13 CDRsoftheheavy(VH)andlight(VL)variable partsoftheCA5antibody VH-CDR1(SEQIDNO:9) GFTFSDFY VH-CDR2(SEQIDNO:10) SRNKAKDYTT VH-CDR3(SEQIDNO:11) ARDARFAY VL-CDR1(SEQIDNO:12) QSLLYSSNQKNY VL-CDR2 WAS VL-CDR3(SEQIDNO:13) QQYYSYPRT

TABLE-US-00014 TABLE14 CDRsoftheheavy(VH)andlight(VL)variable partsoftheCH10antibody VH-CDR1(SEQIDNO:14) GFTFNTYA VH-CDR2(SEQIDNO:15) IRSKSNNYAT VH-CDR3(SEQIDNO:16) VRQDYYGSSYFDY VL-CDR1(SEQIDNO:17) QSISDY VL-CDR2 YAS VL-CDR3(SEQIDNO:18) QNGHSFPYT
4/Construction, Production and Characterization of scFvs
a/Construction of the scFv Antibody Fragments

[0101] The synthetic genes of the single-chain variable fragments (scFvs) derived from the CA5 and CH10 antibodies were synthesized by ATG:Biosynthetics GmbH (Germany).

[0102] Each sequence was designed from the fusion of the heavy and light variable parts (SEQ ID NO : 1/ SEQ ID NO: 3 for CA5; SEQ ID NO: 5/ SEQ ID NO : 7 for CH10) lined by a sequence encoding the peptide (Gly.sub.4Ser).sub.3 ensuring the functionality of the protein, and ending with a sequence encoding the His.sub.6 peptide (HIS-tag peptide) that will allow purification of the scFvs. In order to enable their insertion into the expression plasmid, the sequences were flanked by the Pstl and Sall restriction enzyme sites. An additional sequence was added between the 3 end of the VL and the Sall site allowing elimination of the His.sub.6 peptide if desired. The codons were optimized for expression in E. coli. A diagrammatic representation of the construction of the scFvs synthetic genes is given in detail below:

##STR00001##

[0103] The antibody fragments were inserted between the Pstl and Xhol enzymatic sites of the pSW1 expression plasmid (ATG:Biosynthetics GmbH, Germany) according to E. S. Ward et al. (VVard et al., Nature, 341: 544-546, 1989) [7] which contains, under the control of a LacZ inducible promoter, a PelB signal sequence which, fused in reading frame with the gene of the recombinant antibody fragment, allows trafficking of the synthesized protein to the bacterial periplasm. In the periplasm, this signal sequence is eliminated by a peptidase.

[0104] After verification, by sequencing, of the quality of the constructs, the pSW1-CA5 and pSW1-CH10 plasmids were used to transform, by heat shock, HB2151 bacteria (T53040, Interchim, France) made competent (Li et al., Afr. J. Biotechnol., 9(50) : 8549-8554, 2010) [8].

TABLE-US-00015 TABLE15 NucleotideandpeptidesequencesoftheCA5scFv CA5scFv Nucleotide CAGGTGCAGCTGCAGCAGTCAGGCGGCGGCCTGGTACAACCT sequence GGTGGCTCACTGCGCCTGAGCTGCGCAACCAGCGGTTTTACCT SEQIDNO:19 TTAGCGATTTCTACATGGAATGGGTTCGCCAACCGCCGGGTAAG CGTCTGGAATGGATCGCGGCGAGCCGTAACAAGGCGAAAGATT ATACCACTGAATATAGCGCGTCGGTGAAAGGTCGCTTCATTGTC TCGCGCGATACCAGCCAGTCGATTCTGTATCTGCAAATGAATGC CCTGCGTGCCGAAGACACGGCCATCTACTTCTGTGCGCGTGAT GCACGCTTTGCCTATTGGGGCCAAGGCACCCTGGTGACCGTTA GCGCCGGTGGTGGCGGTTCAGGTGGTGGCGGTAGCGGTGGCG GTGGCTCAGATATTCAGATGACCCAGACCCCGTCAAGCCTGGC GGTGTCAGTCGGCGAAGAGATTACTATGAGCTGTAAAAGCTCGC AGAGCCTGCTGTACTCATCGAACCAGAAAAATTACCTGGCATGG TATCAACAGAAGCCGGGTCAGTCGCCGAAACTGCTGATCTACTG GGCCTCAACCCGTGAGAGCGGCGTACCGGATCGCTTTACTGGC AGCGGCAGCGGCACGGACTTTACGCTGACGATTAGCTCGGTGA AGGCCGAAGACCTGGCGGTTTATTATTGCCAACAGTACTATAGC TACCCTCGTACCTTCGGCGGCGGCACGAAACTCGAGATTAAACA TCACCATCACCATCACTAACTCGAGATCAAGTAA Peptide QVQLQQSGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKR sequence LEWIAASRNKAKDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAE SEQIDNO:20 DTAIYFCARDARFAYWGQGTLVTVSAGGGGSGGGGSGGGGSDIQ MTQTPSSLAVSVGEEITMSCKSSQSLLYSSNQKNYLAVVYQQKPGQ SPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYC QQYYSYPRTFGGGTKLEIKHHHHHH

TABLE-US-00016 TABLE16 NucleotideandpeptidesequencesoftheCH10scFv CH10scFv Nucleotide CAGGTGCAGCTGCAGCAATCAGGCGGCGGCCTGGTCCAACCG sequence AAAGGTAGCCTGAAACTGTCGTGCGCCGCCAGCGGCTTTACGT SEQIDNO:21 TCAACACTTACGCGATGAATTGGGTGCGTCAGGCGCCTGGTAAA GGCCTGGAATGGGTGGCACGCATCCGTTCAAAAAGCAACAATTA CGCGACGTATTATGCAGACAGCGTAAAAGATCGCTTTACCATCA GCCGTGATGATTCACAGTCAATGCTGTACCTGCAAATGAATAAC CTGAAAACTGAAGACACTGCGATGTATTATTGTGTTCGCCAGGA CTATTACGGTAGCTCGTATTTCGATTACTGGGGCCAAGGCACCA CCCTGACGGTGAGCTCGGGTGGCGGTGGCTCAGGTGGTGGTG GTAGCGGCGGTGGCGGTAGCGATATCCAGATGACCCAGACCCC GGCAACCCTGAGCGTTACCCCTGGTGACCGCGTTTCGCTGAGC TGCCGTGCCTCGCAGAGCATTTCGGACTATCTGCACTGGTATCA GCAAAAATCACACGAATCACCGCGTCTGCTGATTAAGTACGCCA GCCAATCGATTAGCGGTATTCCGAGCCGCTTTTCGGGCTCGGG TTCGGGCTCGGATTTTACCCTGTCAATTAATAGCGTAGAGCCGG AAGATGTAGGCGTCTACTATTGTCAGAACGGCCATTCATTCCCG TACACGTTTGGCGGCGGCACCAAGCTCGAGATTAAGCATCACC ATCATCACCATTAACTCGAGATCAAGTAA Peptide QVQLQQSGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKG sequence LEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKT SEQIDNO:22 EDTAMYYCVRQDYYGSSYFDYWGQGTTLTVSSGGGGSGGGGSG GGGSDIQMTQTPATLSVTPGDRVSLSCRASQSISDYLHVVYQQKSH ESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYC QNGHSFPYTFGGGTKLEIKHHHHHH
b/Production of the Recombinant Antibody Fragments

Bacterial Culture

[0105] A preculture was prepared in 5 ml of 2YT medium containing 50 g/ml of ampicillin overnight at 37 C. The following day, 500 l of this preculture were inoculated into 500 ml of the same medium and grown at 37 C. at 150 RPM until an OD.sub.600nm of 1.4 was obtained. The synthesis of the scFv was induced by adding 0.1 mM of IPTG for 16 h at 16 C. at 150 RPM.

Extraction

[0106] The culture medium was centrifuged for 30 min at 4500 g at 4 C. The remainder of the preparation was carried out at 4 C. To extract the bacterial periplasm, the pellet was resuspended and incubated in 10 ml of TES (0.2 M Tris, pH 8, 0.5 M EDTA, 0.5 M sucrose) for 30 min to which were then added 15 ml of TES diluted to , followed by further incubation for 30 min. The bacterial extract was centrifuged for 30 min at 10,000g. The supernatant was dialyzed against PBS overnight. The dialyzed supernatant was immediately treated in order to purify the scFv or stored at 20 C. until use.

[0107] The production of the scFv in the periplasm was analyzed by Western blotting using an anti-His-Tag HRP antibody (Ref R93125 Life Technologies, France) according to the manufacturers recommendations for use.

Purification

[0108] The periplasm was centrifuged for 20 min at 5,000 g at 4 C. The supernatant was incubated with HIS-Select Nickel Affinity Gel (Sigma-Aldrich, MO, USA) with stirring for 1 h at 4 C. The gel was washed with a 0.05 M sodium phosphate buffer containing 0.3 M NaCl, pH8, then the same buffer with 20 mM of imidazole added thereto, until an OD.sub.280nm close to 0 was obtained. The scFv was then eluted with a 0.05 M sodium phosphate buffer containing 0.3 M NaCl and 250 mM imidazole, pH8. The eluate was dialyzed against PBS overnight. It is stored at 20 C.

Quality Control

[0109] The purified scFv was analyzed by electrophoresis on a 15% polyacrylamide gel after staining with Coomassie blue and by exclusion chromatography on a Sephadex 75 10/300 GL column (Ref 17-5174-01 GE Healthcare, Germany).

5/Specificity

[0110] The specificity of the antibodies and of the scFv thereof was studied by the ELISA technique. Each hormone evaluated was prepared at the concentration of 10 g/ml in a 0.1M sodium carbonate buffer, pH 9.6, and distributed in a proportion of 100 l per well on an ELISA plate. The adsorption time was 18 hours at +4 C. After five washes, the wells were treated with 100 l of PBS supplemented with 0.1% Tween and 1% BSA for 45 minutes at 37 C., then each antibody or scFv was distributed in a proportion of 100 l/well and incubated for one hour at 37 C. On each hormone evaluated, the antibodies and the scFvs were distributed at various concentrations according to a range of 10 to 250 g/ml for the antibodies and of 10 to 150 or 200 g/ml for the scFvs.

[0111] After five washes, a secondary antibody coupled to peroxidase (HRP) was distributed in a proportion of 100 l/well and incubated for one hour at 37 C. Depending on the isotype of the monoclonal antibody studied, the secondary antibody was an anti-IgG1 HRP (Ref. 115-035-205, Jackson ImmunoResearch Laboratories Inc), an anti-IgG2a HRP (Ref. 115-035-206, Jackson Laboratories) or an anti-IgM HRP (Ref. 115-035-075, Jackson Laboratories). For the scFvs, an anti-His Tag HRP (Ref. R93125 Life Technologies, France) was used. After five washes, the enzymatic activity was revealed with TMB distributed in a proportion of 100 l/well. The revealing time was from 5 to 30 min at ambient temperature depending on the rate of the reaction. After the reaction had been stopped with 1M H.sub.2SO.sub.4 (50 l/well), the strength of the colored reaction (optical density) was measured using a spectrophotometer for ELISA plates.

[0112] For the CA5 and CH10 antibodies and the scFvs thereof, the percentage of cross reaction was calculated relative to the values obtained with ovine FSH (oFSH) considered to be the 100% reference value. The percentage of cross reaction was calculated conventionally by comparing the dose-response curves obtained with the concentration range of the antibody or of the scFv. On the basis of the curve obtained with the reference hormone: [0113] let A be the concentration giving 50% of the maximum optical density (ED 50).
On the basis of the curve obtained with another hormone, [0114] let B be the concentration corresponding to the same optical density value as that used to define A.
The percentage of cross reaction is equal to A divided by B and multiplied by 100: [(A/B)100].
Specificity of the CA5 Antibody and of the scFv Thereof

[0115] Table 17 illustrates the percentages of cross reaction of the CA5 antibody with the - and -subunits (s.u.) of ovine FSH and the -subunit of human FSH:

TABLE-US-00017 TABLE 17 CA5 oFSH -s.u. oFSH -s.u. oFSH -s.u. hFSH Cross reaction 100% 6% 80% 50%

[0116] The CA5 antibody recognizes the ovine -subunit very little, but strongly recognizes the -subunit of ovine FSH (80%); it also cross reacts with the -subunit of human FSH, less strongly (50%). Its specificity is anti-FSH -subunit.

[0117] Table 18 illustrates the percentages of cross reaction of CA5 and of the CA5 scFv with porcine FSH (pFSH) and various human FSHs:

TABLE-US-00018 TABLE 18 hFSH hFSH hFSH hMG oFSH pFSH (Gonal F) (Puregon) (Fostimon) (Menopur) CA5 100% 134% 128% 70% 76% 61% CA5 100% 61% ND ND 10% 10% scFv

[0118] The CA5 antibody exhibits strong recognition of porcine FSH and of the human FSH Gonal-F. It also cross reacts significantly with the other human FSHs between 61 and 76%. The CA5 antibody recognizes the FSHs tested better in their dimeric form, which tends to indicate specificity against a conformational epitope.

[0119] The CA5 scFv significantly recognizes pFSH (61%) and more weakly an hFSH (Fostimon) and hMG (Menopur). The cross reaction on the other two human FSHs could not be measured (ND) because of binding that was too weak. The binding of the CA5 scFv, just like that of the whole antibody, therefore appears to be dependent on the conformation of the hormone, which is probably modified during the adsorption onto the plastic of the ELISA plate.

[0120] The specificity of the CA5 scFv was evaluated with respect to porcine LH (pLH), ovine LH (oLH), bovine LH (bLH), eCG and the hCGs Chorulon and Endo 5000. The results are given in table 19:

TABLE-US-00019 TABLE 19 oLH pLH bLH eCG Chorulon Endo 5000 CA5 scFv 25% 29% 33% ND 10% ND

[0121] The binding of the CA5 scFv is significant with respect to the animal LHs with a cross reaction between 35% and 40%. Conversely, only the hCG Chorulon is weakly recognized (10%). The binding that was too weak on the other two hCG adsorbed did not make it possible to quantify cross reaction. These results reinforce the hypothesis of a specificity toward a conformational epitope, given the biological effects of CA5 and of the scFv thereof obtained in vitro and in vivo on the hCG activity (see results in examples 2 and 3).

[0122] This hypothesis is reinforced by the results obtained by Western blotting by incubating the CA5 antibody on oFSH migrated on a 5% polyacrylamide gel under denaturing or non-denaturing conditions. Only the -oFSH band was recognized under non-denaturing conditions and gave a significant signal. No signal was observed on the oFSH migrated under denaturing conditions.

[0123] An estimation of the dissociation constant Kd of the scFv, with respect to the various FSH, LH and CG studied, was calculated on GraphPad Prism (GraphPad Software Inc., San Diego, Calif., USA, version 5) using the One site-Specific binding function in a saturation binding model (saturation binding experiment model, GraphPad PRISM software). The various values obtained are indicated in tables 20 and 21.

TABLE-US-00020 TABLE 20 hFSH hFSH hFSH hMG CA5 scFv oFSH pFSH Gonal-F Puregon Fostimon Menopur Kd (10.sup.6 M) 0.54 1.24 1.43 2.67 2.03 2.41

TABLE-US-00021 TABLE 21 hCG hCG CA5 scFv oLH pLH bLH eCG Chorulon Endo 5000 Kd (10.sup.6 M) 1.95 2.47 2.43 4.07 3.80 3.14

[0124] Comparison of the dissociation constants Kd thus estimated indicates a greater affinity of the CA5 scFv for the ovine and porcine FSHs with a value of 0.54 and 1.24 M respectively. With the exception of the recombinant human FSH Gonal F (Kd 1.43 M), the CA5 scFv exhibits a lower affinity for the human FSHs (Kd of 2.03 to 2.67 M). In comparison with oFSH and pFSH, the CA5 scFv exhibits a medium affinity with respect to ovine LH and porcine LH (Kd of 1.95 and 2.47 M respectively). The Kds estimated with respect to the hCGs and the eCG (Kd of 3.14 to 4.07 M) indicate a lower affinity of the CA5 scFv for these hormones.

Specificity of the CH10 Antibody and of the scFv Thereof

[0125] Table 22 illustrates the percentages of cross reaction of the CH10 antibody with the - and -subunits (s.u.) of ovine FSH and the -subunit of human FSH:

TABLE-US-00022 TABLE 22 CH10 oFSH -s.u. oFSH -s.u. oFSH -s.u. hFSH Cross reaction 100% 43% 88% 40%

[0126] The CH10 antibody preferentially recognizes the -subunit of ovine FSH (88%) and two times less the -subunit of human FSH and the ovine -subunit (40% and 43%). According to these results, the specificity of CH10 is anti-FSH -subunit, preferentially anti-oFSH -subunit. It recognizes to a lesser extent, but not insignificantly, the ovine -subunit unlike the CA5 antibody. All of these results can lead to the hypothesis of an epitope involving mainly but also , on the region of linkage of the two subunits for example.

[0127] Table 23 illustrates the percentages of cross reaction of CH10 and of the CH10 scFv obtained with porcine FSH (pFSH) and various human FSHs:

TABLE-US-00023 TABLE 23 hFSH hFSH hFSH hMG oFSH pFSH (Gonal F) (Puregon) (Fostimon) (Menopur) CH10 100% 24% 50% 71% 100% 48% CH10 100% 175% 32% 67% 30% 61% scFv

[0128] The CH10 antibody and the scFv thereof exhibit a strong recognition of the animal FSHs and a cross reaction ranging from 30 to 100% for the human FSHs.

[0129] The specificity of the CH10 scFv was evaluated with respect to porcine LH (pLH), ovine LH (oLH), bovine LH (bLH), eCG and the hCGs Chorulon and Endo 5000. The results are given in table 24:

TABLE-US-00024 TABLE 24 oLH pLH bLH eCG Chorulon Endo 5000 CH10 scFv 68% 63% 52% ND ND ND

[0130] The binding of the CH10 scFv with respect to the animal LHs is significant with a cross reaction between 52% and 68%. Conversely, the binding that was too weak on the hCG and the eCG adsorbed did not make it possible to quantify a cross reaction. These results reinforce the hypothesis of a specificity toward a conformational epitope, given the biological effects of CH10 and of the scFv thereof obtained in vitro and in vivo on the activity of the hCGs Chorulon and Endo 5000 (see results in examples 2 and 3).

[0131] An estimation of the dissociation constant Kd of the CH10 scFv, with respect to the various FSH, LH and CG studied, was calculated on GraphPad Prism (GraphPad Software Inc., San Diego, Calif., USA, version 5) using the One site-Specific binding function in a saturation binding model (saturation binding experiment model, GraphPad PRISM software). The values obtained are indicated in tables 25 and 26.

TABLE-US-00025 TABLE 25 hFSH hFSH hFSH hMG CH10 scFv oFSH pFSH Gonal-F Puregon Fostimon Menopur Kd (10.sup.6M) 2.85 5.22 1.82 11.5 1.59 7.36

TABLE-US-00026 TABLE 26 hCG hCG CH10 scFv oLH pLH bLH eCG Chorulon Endo 5000 Kd (10.sup.6M) 1.55 2.47 1.94 1.97 1.47 2.09

[0132] The dissociation constants Kd thus estimated indicate an affinity of the CH10 scFv both for the ovine and porcine FSHs (Kd of 7.51 and 5.22 M) and for the human FSHs Gonal F and Fostimon and the hMG Menopur (Kd of 1.82, 1.59 and 7.36 M respectively). The Kds estimated with respect to the hCGs and the eCG (Kd of 1.47 to 2.09 M) indicate good affinity of the CH10 scFv for these hormones compared with the FSHs.

Example 2

In Vitro Measurement of the Potentiating Effect of the Ligands of the Invention on the Bioactivity of Fsh

[0133] The demonstration of the potentiating effect of the ligands of the invention on the bioactivity of FSH was carried out by comparing the biological response obtained with various cell types or lines stimulated either with FSH alone or with the FSH/monoclonal antibody (MAb) complex.

[0134] In each of the cases, comparison of the dose-response curves obtained made it possible to quantify the potentiating effect in vitro of the MAb on the biological activity of the complexed FSH. The statistical analysis of the results was carried out using the Prism software (GraphPad Software Inc., San Diego, Calif., USA, version 5).

1/On Primary Cultures of Bovine Granulosa Cells

[0135] The potentiating effect of the CA5 and CH10 MAbs on the bioactivity of ovine FSH (oFSH) was first of all characterized on bovine granulosa cells endogenously expressing the bovine FSH receptor.

[0136] Hybridoma supernatants at the final concentration of 0.1 g/ml of CA5 or CH10 antibody were incubated with a range of ovine or human FSH ranging from 3 ng/ml to 25 ng/ml, for 30 mn at 37 C.

[0137] The bovine granulosa cells were taken by ovarian puncture on cow ovaries from follicles having a diameter ranging from 2 to 6 mm, according to the protocol described by Chopineau et al. (Mol. Cell Endocrinol., 92(2) : 229-39, 1993) [8] and Wehbi et al. (Endocrinology, 151(6) : 2788-2799, 2010) [9]. The bovine granulosa cells in suspension in a McCoy's 5A medium (Lonza, Belgium, reference BE12-688F), prepared at 80,000 cells per 0.5 ml, were stimulated for 3 hours at 37 C., with stirring, in the presence of 48 g/ml of IBMX (Sigma Aldrich, France, reference I5879), with a range of FSH of from 3 ng/ml to 25 ng/ml, alone or pre-complexed with a monoclonal antibody according to the protocol above. The biological response measured was cAMP secretion.

[0138] After centrifugation, the cAMP produced was assayed in the culture supernatant using an ELISA kit (Biomedical Technologies Inc., MA, USA, BT-730).

[0139] The results are presented in FIG. 1.

[0140] The results show an amplification of cAMP secretion by a factor of 1.3 times for CA5 and by a factor of 5.5 times for CH10 on the activity of ovine FSH. The statistical analysis by two-way analysis of variance (two-way ANOVA, GraphPad PRISM software) shows a significant effect ranging from p<0.05 (*) for CA5 to p<0.01 (**) and p<0.001 (***) for CH10.

2/On HEK 293 Cell Line Stably Transfected with the Human FSH Receptor

[0141] The potentiating effect of the MAbs on the FSH of various species was measured on HEK 293 cells stably expressing the human FSH receptor. This system made it possible to measure the cAMP production following activation of the FSH receptor after a stimulation with FSH alone or with the FSH/MAb complex for one hour at 37 C.

[0142] For this, 60,000 cells were distributed into wells of 96-well plates (Becton Dickinson, NJ, USA, reference 353072) and cultured for 24 h at 37 C., 5% CO.sub.2 in a humid atmosphere, in 100 l of MEM medium (Ozyme, France, reference BE12-611F) containing 10% FCS (Lonza, Belgium, reference DE14-801F), 1% penicillin/streptomycin (Sigma Aldrich, France, reference P-4333) and 400 g/ml of G418 (Sigma Aldrich, France, reference A1720). After 2 h of weaning in MEM medium, the cells were stimulated for 1 h at 37 C. The culture supernatant was recovered and assayed using an ELISA kit (Biomedical Technologies Inc., MA, USA, BT-730). The results express the amount of cAMP secreted at the end point. They were analyzed using the Prism software (GraphPad Software Inc., San Diego, Calif., USA, version 5).

[0143] FIG. 2 represents the potentiating effect of the CA5 and CH10 monoclonal antibodies on the bioactivity of ovine FSH (oFSH) in vitro on HEK 293 cells stably transfected with the human FSH receptor. For this, the cells were stimulated either with a range of from 3 ng/ml to 32.5 ng/ml of ovine FSH, or with the same FSH range points previously incubated, for 30 minutes at 37 C., with the monoclonal antibody (final concentration 0.1 g/ml) before the stimulation of the cells. A two-way analysis of variance (two-way ANOVA, GraphPad PRISM software) made it possible to compare the dose-response curves obtained with the FSH alone or with the FSH/monoclonal antibody complex. The CA5 antibody showed a potentiating effect ranging from 160% to 200% on the activity of oFSH; this effect is significant for the 32.5 ng/ml concentration of oFSH (p<0.05). The CH10 antibody exerts a greater potentiating effect on oFSH for all of the concentrations tested ranging from 225% for the 3 ng/ml point (p<0.01) to 260% for the 10 ng/ml and 33 ng/ml points respectively (p<0.001).

3/On HEK 293 Cell Line Stably Transfected with the Human FSH Receptor and with the Glosensor System

[0144] The potentiating effect of the MAbs on the FSHs of various species was measured in real time on HEK 293 cells stably expressing the human FSH receptor and the GloSensor vector (Promega, France). This cell system made it possible to monitor the cAMP production following stimulation of the FSH receptor with the agonist (FSH alone or FSH/monoclonal antibody complex) in real time. Following the binding of the cAMP on the GloSensor protein, the GloSensor substrate (Promega, France, reference E1291) was hydrolyzed and resulted in an emission of luminescence measured by means of a PolarStar Optima reader (BMG Labtech, Germany) and expressed in RLU (Relative Luminescence Units). This stable line was developed by the Biology and BioInformatics of Signaling Systems team at the INRA [French National Institute for Agricultural Research] center, Val de Loire, 37380 Nouzilly, France) and was kindly made available for these assays.

[0145] For this, the HEK 293 cells were cultured in a proportion of 80,000 cells per well of a transparent-bottom, white 96-well microplate (Dominique Dutscher, France, reference 655903) and cultured in 100 l of MEM medium (Ozyme, France, reference BE12-611F) supplemented with 10% FCS (Lonza, Belgium, reference DE14-801F), 1% penicillin/streptomycin (Sigma Aldrich, France, reference P-4333), 200 g/ml of hygromycin B (Life Technologies, France, reference 10687010) and 400 g/ml of G418 (Sigma Aldrich, France, reference A1720) overnight. After 2 h of weaning in 100 l of MEM medium supplemented with 1% BSA (PAA, France, reference K45012) and containing 4% of GloSensor substrate for 2 h at ambient temperature in the dark, the plate of cells was placed in the PolarStar Optima reader and a first reading was carried out for 5 minutes in order to measure the basal level of luminescence. The plate was then removed from the reader and 11 l of ligand (FSH alone or FSH/monoclonal antibody complex) were added thereto so as to obtain the concentrations indicated. The luminescence emitted was then measured for approximately 1 h 30.

[0146] The results obtained were analyzed using the Prism software (GraphPad Prism Software Inc., San Diego, Calif., USA, version 5). The non-linear function log (agonist) versus response was used to plot the response as a function of the FSH concentration. This made it possible to characterize and compare the EC50 for the FSH alone and the FSH complexed with the monoclonal antibody. For each example, the significant effect of the FSH/potentiating antibody complex was measured by two-way analysis of variance (two-way ANOVA, GraphPad PRISM software) by comparing the two curves in their entirety.

CA5 Monoclonal Antibody

[0147] FIG. 3 illustrates the cAMP production kinetics curves expressed in relative luminescence units as a function of time (in minutes) obtained at the concentrations 0-0.1-0.3-1 and 3 nM of ovine FSH alone or complexed with the CA5 antibody. It is observed that the cells stimulated by the antibody alone, without FSH, show no response: the luminescent signal remains at its basal level (curve 3A). The CA5 antibody alone exerts no agonist or antagonist effect on the human FSH receptor expressed by the HEK 293 cells. Conversely, the CA5 monoclonal antibody (final concentration 6 nM), complexed with oFSH very significantly and notably amplifies the stimulating activity of the hormone. An increase in the maximum cell response of 350% and 330% at the concentrations of 0.1 and 0.3 nM of oFSH (curves B and C) and an increase of 230% and 140% respectively for the concentrations of 1 and 3 nM of oFSH (curves D and E) are thus observed. The amplitude of the potentiating effect becomes less with the higher concentrations of oFSH (1 and 3 nM) because of a saturation of the cell response and of the luminescent signal at 11000 RLU in this case. The EC50 value measured by GraphPad Prism is 2.3610.sup.9M for oFSH and 2.8310.sup.10M for the oFSH/CA5 complex, reflecting an increase of one unit of LogEC50 (from 10.sup.8.6 to 10.sup.9.54) when the FSH is complexed with the CA5 antibody. The difference between the two curves of oFSH compared with oFSH/CA5 is highly significant for all of the oFSH doses tested (p<0.001).

[0148] The potentiating effect of the CA5 antibody measured on porcine FSH is illustrated by FIG. 4. An increase of 190% of the maximum response at 0.03 nM of pFSH is observed when said pFSH is complexed with the CA5 antibody (final concentration 6 nM) (curve A), but this increase is not significant. The potentiating effect reaches 250% at the 0.1 nM concentration of pFSH (curve B) and is significant (p<0.01). The level of response obtained with 0.03 nM pFSH complexed with CA5 is equivalent to that obtained with 0.1 nM pFSH alone (500 RLU compared with 585 RLU respectively), which means that the 0.03 nM pFSH/CA5 complex induces the same amplitude of response as the pFSH alone at a concentration 3.3 times higher (0.1 nM; i.e. 0.5 Log).

[0149] Finally, the potentiating effect of CA5 was studied on the activity of recombinant human FSH (Gonal-F, Serono laboratory). FIG. 5 illustrates the cAMP production kinetics curves expressed in relative luminescence units as a function of time (minutes) obtained during a stimulation with the concentrations 0.03-0.1-0.2-0.3 nM of FSH alone or complexed with the CA5 antibody (6 nM). A potentiating effect of 235% was observed with the 0.03 nM hFSH concentration, of 200% was observed with 0.1 and 0.2 nM of hFSH, then of 170% was observed with the highest hFSH concentration of 0.3 nM because of a saturation of the cell system (maximum 10530 RLU). The EC50 calculation by GraphPad Prism indicated a value of 5.8610.sup.10M for hFSH and of 1.3610.sup.10M for the hFSH/CA5 complex, reflecting an increase of 0.63 in LogEC50 (from 10.sup.9.23 to 10.sup.9.86) when the FSH is complexed with the CA5 antibody. The potentiating effect of the CA5 scFv was also studied on the bioactivity of hFSH at 0.01 nM. A significant increase of 160% (p<0.01) was obtained at the scFv concentration of 36 nM (FIG. 5). This increase was similar to that of the divalent whole CA5 antibody. This result means that the monovalent fragment has the same FSH-activity-potentiating properties as the CA5 antibody.

[0150] Although significant (p<001), the potentiating effect of the CA5 antibody on the bioactivity of human FSH remains smaller than on the bioactivity of ovine FSH for which an increase of one Log unit was obtained between the EC50 of oFSH and that of the oFSH/CA5 complex.

CH10 Monoclonal Antibody

[0151] The modulatory effect of the CH10 antibody was studied on ovine FSH (oFSH) and on human FSH (hFSH) (Gonal F, Serono laboratory).

[0152] FIG. 6 illustrates the amplifying effect of the CH10 antibody (10 nM) on the bioactivity of oFSH prepared at the concentrations of 0.01-0.03 and 0.1 nM. On the low concentrations (0.01 and 0.03 nM) an increase of 185% of the cell response is obtained with the oFSH/CH10 complex (curves A and B). At the oFSH concentration of 0.1 nM, the increase is 312% with the oFSH/CH10 complex (curve C). These increases are very significant (p<0.001).

[0153] The potentiating effect of CH10 (1.3 nM) was measured on human FSH prepared at from 0.1 nM to 3 nM (FIGS. 7A and B). A moderate but significant (p<0.001) increase ranging from 140% to 150% was observed. The EC50 values measured by GraphPad Prism were 2.8510.sup.10M for hFSH and 3.1710.sup.10M for the hFSH/CH10 complex (FIG. 7C).

[0154] The potentiating effect of CH10 is exerted more specifically on ovine animal FSH. A weak effect of the CH10 antibody was observed on human FSH.

Example 3

In Vivo Measurement of the Potentiating Effect of the Ligands of the Invention on the Bioactivity of FSH and LH/CG in the Rat Model

[0155] After having been characterized in vitro, the potentiating effect of each monoclonal antibody was characterized in vivo, in the female rat for their effect on the bioactivity of FSH and in the male rat for their effect on the bioactivity of LH/CG, that they also recognize.

[0156] In order to measure the FSH bioactivity, the protocol used was that of the biological assay described by Steelman and Pohley (Steelman SL, Pohley FM. Endocrinology, 53 : 604-616. 1953) [12]. In order to measure the LH bioactivity, the protocol used was that of the assay described by Scobey et al. (Scobey et al., Reprod. Biol. Endocr. 3 : 61, 2005) [13].

[0157] The effect of the antibodies on the FSH activity was evaluated using ovine and human FSHs. The effect of the antibodies on the LH activity was evaluated on two preparations of hCG (human chorionic gonadotropin).

[0158] The statistical analysis was carried out with the GraphPad Prism software (GraphPad Software Inc., San Diego, Calif., USA, version 5). Since the results related to experiments carried out on batches of five animals, a non-parametric, one-way analysis of variance (Kruskal Wallis test), followed by Dunn's correction, was applied or a non-parametric t-test (Mann-Whitney test). For the results relating to larger numbers (n>30) resulting from the compilation of several bioassays, a parametric test (unpaired Student's t test) followed by a Bonferroni correction was applied.

1/Potentiating Effect of the Antibodies on the Bioactivity of FSH in the Female Rat

[0159] The potentiating effect of the CA5 and CH10 antibodies and of the scFv thereof was studied on ovine FSH and on various preparations of human FSH used in human reproduction, Gonal-F and Puregon (recombinant FSHs from the Merck Serono and Merck Schering-Plough laboratories respectively), and Fostimon and Menopur (extracted FSHs sold by the laboratories Genevrier and Merck Schering-Plough respectively).

[0160] As described in the protocol of Steelman and Pohley, 21-day-old immature female rats received, for three consecutive days, two injections, in the morning and the evening, of 100 l of a mixture of hCG and FSH comprising a constant amount of hCG (3.5 IU) supplemented with a variable amount of FSH ranging from 0.5 to 1.5 IU for the human FSH (Gonal F, Puregon, Fostimon, Menopur) or from 0.5 to 2 g for the ovine FSH (extracted hormone). Injections were carried out subcutaneously into the nape of the neck. Each experiment comprised a minimum of four batches: one batch treated with physiological saline (serum ), one batch treated with the antibody or the scFv alone, one batch treated with the hCG+FSH mixture, and one batch treated with the hCG/FSH mixture supplemented with 2 g of purified scFv antibody.

[0161] In the case of a treatment with the hormone/antibody or scFv complex, before the injection, the FSH+antibody mixture was preincubated for 20 minutes at 37 C. or at ambient temperature, without distinction, and then added to the hCG. The hCG can without distinction be mixed with the FSH during the incubation of the complex.

[0162] On the fourth day, the female rats were weighed, and their ovaries were taken, dissected and then weighed. The results are expressed in milligram of ovary/100 grams of body weight. The increase in the weight of the ovaries is proportional to the amount of bioactive FSH injected. This makes it possible to quantify and compare the bioactivity of the same amount of hormone injected alone or as a complex with an antibody.

[0163] Comparison of the bioactivity of the FSH injected alone or complexed with the antibody or with the scFv makes it possible to measure the differential of the response and to thus quantify the potentiating effect of the antibody or of the scFv thereof.

Effect of the CA5 Antibody and of the scFv Thereof

[0164] FIG. 8A illustrates a representative example of the effect of the CA5 antibody on the ovine FSH bioactivity. Each batch comprised five females. The batch treated with the CA5 antibody injected alone exhibited the same mean weight of the ovaries as the females of the control batch having received physiological saline (25.6 mg and 29.15 mg respectively). The batch having received the conventional hormonal treatment (3.5 IU hCG+0.5 g oFSH) gave a mean weight of the ovaries of 85.7 mg significantly higher than the control batch (p<0.05). The batch treated with the ovine FSH precomplexed with the CA5 antibody exhibited a mean weight of 198 mg, i.e. a very significant increase in the FSH bioactivity of 231% compared with the batch having received the conventional hormonal treatment (p<0.0001). The potentiating effect of CA5 on the activity of ovine FSH, in vivo, was analyzed on several experiments, all of the results of which are presented in table 27. The increase in the mean weight of the ovaries, recorded on three experiments, following a stimulation with the hormone/CA5 complex, is highly significant (p<0.0001).

TABLE-US-00027 TABLE 27 batch Mean sem numbers statistics Serum 25.6 2.4 13 NS CA5 29.15 4.6 15 hCG + oFSH 98.12 6.37 13 *** hCG + oFSH + CA5 165.8 11.54 12 p < 0.0001

[0165] The effect of CA5 on the human FSHs was also analyzed on large numbers over the course of several experiments. The results are presented in table 28 below.

TABLE-US-00028 TABLE 28 batch Mean sem numbers statistics hCG + hFSH 73.93 1.525 77 *** hCG + hFSH + CA5 128.3 4.323 80 p < 0.0001

[0166] The increase in the mean ovary weight recorded in the females treated with the hFSH Gonal F/CA5 complex is 173%: the mean weight of the ovaries goes from 73.93 mg in the females having received a conventional treatment to 128.3 mg in the females having been treated with the hormone/CA5 complex. This difference is highly significant (p<0.0001, unpaired t-test).

[0167] Finally, the potentiating effect was studied on two other preparations of human FSH (Puregon and Fostimon). The results shown in FIG. 8B are a representative example. A significant increase of 153% was recorded on the activity of the human FSH Puregon (p<0.05) and of 142% on the activity of the human FSH Fostimon (NS). In comparison, the increase recorded on the activity of the human FSH Gonal F was 179% in this experiment (p<0.05).

[0168] In conclusion, the CA5 antibody exerts a major potentiating effect on ovine FSH and a potentiating effect that is also considerable on the activity of human FSH, originating from various pharmaceutical preparations.

[0169] The effect of the CA5 scFv was studied in the same protocol as the whole antibody. FIG. 9A shows the results obtained. The same potentiating effect on the activity of the human FSH Gonal F was obtained with the whole antibody or with the scFv thereof, said effect being significant (p<0.05).

[0170] Various methods of injection of the hormone/scFv mixtures were evaluated and compared with the conventional protocol (subcutaneous injection). Thus, a bioassay for the purpose of comparing an intraperitoneal injection of the hormonal mixture with an intraperitoneal injection of the hormonal mixture followed by a second, delayed, injection of the CA5 scFv 15 minutes later (FIG. 9A was carried out. In this case, an increase of 146% was obtained in the females treated with the hormone/scFv complex with a mean weight of the ovaries going from 61 mg (batch hCG+hFSH Gonal F) to 89 mg (batch scFv then hCG+hFSH Gonal F). These results are significant since they demonstrate that the potentiating effect of the CA5 scFv can be set up in vivo even if the scFv is injected alone, independently of the hormone and at a later time. The hormone/scFv complex can become formed in vivo in the animal treated.

[0171] The potentiating effect of the CA5 scFv was also studied on the activity of the human FSHs Fostimon and Puregon (FIG. 9B). A significant increase of 140% was obtained on the activity of the FSH Puregon (p<0.05) and a non-significant increase of 126% was obtained on the activity of the FSH Fostimon (NS).

Effect of the CH10 Antibody and of the scFv Thereof

[0172] The potentiating effect of CH10 on the activity of ovine FSH, in vivo, was analyzed during several experiments, all of the results of which are presented in FIG. 10A. Comparison on three experiments of the response between the female rats treated with the hCG+oFSH mixture and those treated with the hormone/CH10 complex demonstrates a significant increase of 145% (p<0.01). The mean weight of the ovaries recorded was 87.553.724 mg in the females treated with the hCG+oFSH mixture (n=12) to 126.69.6 mg/100 g of body weight in the female rats treated with the hormone/CH10 complex (n=13). No effect of the CH10 antibody alone was observed on the ovarian response.

[0173] The potentiating effect of CH10 on the human FSH Gonal-F was also analyzed on large numbers over the course of several experiments. The results are presented in table 29 below and in FIG. 10B.

TABLE-US-00029 TABLE 29 batch Mean sem numbers statistics hCG + hFSH GONAL F 73.93 1.525 77 *** hCG + hFSH Gonal F + CA5 128.3 4.323 80 p < 0.0001

[0174] An increase of 170% in the mean weight of the ovaries was recorded in the females treated with the Gonal F/CH10 complex. This difference is highly significant (p<0.0001, unpaired t-test).

[0175] The potentiating effect of CH10 was also investigated on the human FSHs Puregon and Fostimon (FIG. 11A). A significant increase of 145% and 174% was obtained respectively (p<0.05). FIG. 11B shows the effect of the hFSH Gonal F/CH10 scFv complex by conventional subcutaneous injection and by time-delayed intraperitoneal injection. A significant increase of 160% (p<0.05) was obtained by conventional injection and an increase of 150%, although not significant, was obtained by independent intraperitoneal injections of the CH10 scFv and of the hFSH. The potentiating effect of the CH10 scFv can thus become set up in vivo, whether it is injected separately or preincubated with the hormone.

Potentiating Effect of the Antibodies on the Bioactivity of LH/CG in the Rat

[0176] Because of the very high cost of ovine LH, these biological assays were carried out with hCG, which is readily available, in a very pure and inexpensive form. The effect of the antibodies was studied on two preparations of extracted human hCG (human chorionic gonadotropin), one used in human reproduction in the context of assisted reproductive technology treatments: ENDO 5000 (Schering-Plough laboratory) and the other used in veterinary medicine: Chorulon (MSD laboratory).

[0177] According to the protocol of Scobey et al. [13], the bioactivity of LH or of hCG was quantified with respect to the increase in weight of the seminal vesicles, the development of which is androgen-dependent. The weight varies proportionally to the activity of the hCG and thus makes it possible to quantify and compare the biological activity of the hormone injected alone or complexed with the antibody studied. The protocol was carried out with 25-day-old young rats that were injected subcutaneously, once a day for four days, with 100 l of 1.5 IU of hCG or of a mixture of 1.5 IU hCG+2 g of antibody, preincubated for 20 min at 37 C. On the fifth day, the rats were weighed and then sacrificed. Their seminal vesicles (SVs) were removed, dissected and weighed. The weight of the seminal vesicles is expressed in mg/100 g of body weight in order to be able to compare and combine the results obtained with various batches. In each experiment, each of the conditions was tested on a batch of five rats. The same experiment was repeated several times.

[0178] The effect of CA5 on the two preparations of hCG: Chorulon and Endo 5000 is shown in FIG. 12. Histogram A is a representative example of a bioassay carried out on six batches of five rats. A very significant potentiating effect (p<0.0001, Krustal and Wallis test) was obtained with the hCG Chorulon/CA5 complex with an increase of 196% in the weight of the seminal vesicles compared with the batch treated with hCG alone. A significant effect was also obtained with the hCG ENDO 5000/CA5 complex with an increase in the weight of 193% (p<0.01). It is observed that the batch treated with the CA5 antibody alone shows no change in the weight of the seminal vesicles compared with the control animals treated with physiological saline: the antibody alone exerts no effect on the target organ contrary to the complex.

[0179] The sum of the results obtained during the repetitions of this bioassay with the two hCGs confirms a highly significant potentiating effect (p<0.0001, unpaired t-test) of the hormone/CA5 complex: [0180] on numbers of 53 and 56 animals respectively, the mean weight of the SVs was 28.8 mg/100 g in the rats treated with the hCG Chorulon and 46.7 mg/100 g in the rats treated with the complex (increase of 162%) (FIG. 12B); [0181] on numbers of 26 and 30 animals respectively, the mean weight of the SVs was 24.64 mg/100 g in the rats treated with hCG ENDO 5000 and 48.13 mg/100 g in the rats treated with the complex (increase of 195%) (FIG. 12C).

[0182] The CH10 antibody also exhibited a significant potentiating effect on the hCG Chorulon and the hCG ENDO 5000, in vivo, in the rat.

[0183] FIG. 13A illustrates a representative case of a bioassay carried out on six batches of five rats. A very significant potentiating effect (p<0.0001, Krustal and Wallis test) was obtained with the hCG Chorulon/CH10 complex with an increase of 193% in the weight of the seminal vesicles compared with the batch treated with hCG alone. A significant effect was also obtained on the batch treated with the hCG ENDO 5000/CH10 complex with an increase in the weight of 199% (p<0.0001). It is observed that the batch treated with the CH10 antibody alone shows no change in the weight of the seminal vesicles compared with the control animals treated with physiological saline. CH10 not complexed to the hormone thus has no specific effect on the target organ.

[0184] The compilation of the results obtained during the repetitions of this bioassay with the two hCGs confirms a highly significant potentiating effect (p<0.0001, unpaired t-test) of the hormone/CH10 complex: [0185] on numbers of 34 and 35 animals respectively, the mean weight of the SVs was 29.6 mg/100 g in the rats treated with the hCG Chorulon compared with 50.04 mg/100 g in the rats treated with the complex (increase of 169%) (FIG. 13B); [0186] on numbers of 13 and 15 animals respectively, the mean weight of the SVs was 24.64 mg/100 g in the rats treated with the hCG ENDO 5000 and 51.39 mg/100 g in the rats treated with the complex (increase of 208%) (FIG. 13C).

Example 4

In Vivo Measurement of the Potentiating Effect of the Ligands of the Invention on the Bioactivity of Endogenous Gonadotropins in Ewes

[0187] After having demonstrated and characterized the potentiating effect in vivo, of the CA5 and CH10 monoclonal antibodies, in a rodent (small animal), the objective was to study the effect of each antibody on the activity of FSH in productive livestock, which are larger: ewes.

[0188] For this, a study was carried out on pubescent, Ile de France, ewes, all of the same age, with the aim of evaluating the potentiating effect of the antibodies on the treated ewes' own hormones (endogenous hormones). The study of the specificity showed strong binding of the CA5 and CH10 antibodies for ovine FSH and more variable binding for ovine LH. For this purpose, a treatment comprising only injection of an antibody alone was developed in order to evaluate the efficacy thereof.

[0189] In the protocols set up in ewes, each antibody was thus injected alone and not preincubated with the exogenous FSH, as was done in the studies in the female rat. Furthermore, each antibody was injected into ewes free of any prior stimulation of the ovary: the animals received no hormonal treatment for stimulating ovulation with a gonadotropin prior to the injection of the antibody.

[0190] The potentiating effect of the anti-FSH antibodies CA5 and CH10 was evaluated during protocols carried out right in the middle of the sexual season (January) or at the end of the sexual season (end of March). The protocols were all carried out on ewes in which the ovulatory cycle was presynchronized by implanting a vaginal sponge impregnated with a progestogen (45 mg of fluorogestone acetate (FGA)MSD) for 14 days. The potentiating effect was analyzed by comparing the ovulatory response (number of ovulations) and the establishing of one or more functional corpora lutea of good quality (size of the progesterone secretion) in control ewes (physiological saline batch), ewes stimulated with a porcine FSH treatment (FSH batch) and ewes stimulated with an antibody alone (antibody batch).

[0191] In each protocol, a plasma LH assay was carried out by the ELISA method in order to detect and date the pre-ovulatory peak of LH. To evaluate the ovulatory response, an endoscopic observation of the ovaries was carried out by laparoscopy, under anesthesia, eight days after withdrawal of the vaginal sponge, in order to count the number of corpora lutea and to observe their appearance.

[0192] To evaluate the functionality and the quality of the corpus luteum or corpora lutea, a quantitative progesterone ELISA assay was carried out using daily blood samples from the 1st to the 21st day after withdrawal of the sponge.

[0193] All the statistical analyses were carried out with the GraphPad Prism Version 5.0 software (GraphPad, San Diego, Calif., USA).

CA5 Antibody

[0194] The potentiating effect of the CA5 antibody (IgG) was evaluated in two protocols (1 and 2) in the sexual season period and at the end of sexual season.

[0195] In protocol 1, carried out at the end of sexual season: [0196] the CA5 antibody batch (n=6) received three injections of purified CA5, intramuscularly: 2 mg 4 days before the withdrawal of the sponge, 1 mg before the withdrawal and 1 mg at the time of the withdrawal of the sponge; [0197] the control batch (n=5) received an injection of physiological saline, intramuscularly, 24 h before the withdrawal of the sponge; [0198] the FSH batch (n=5) received an intramuscular injection of 100 g of porcine FSH (pFSH) 24 h before the withdrawal of the sponge and of 90 g 12 h before the withdrawal of the sponge.

[0199] The analysis of the ovulatory response gave the results presented in table 30 below.

TABLE-US-00030 TABLE 30 Serum FSH CA5 alone batch batch batch Statistics Number of ewes per 5 5 6 batch Number of ewes having 2/5 (40%) 2/5 (40%) 2/6 (35%) NS ovulated per batch Number of corpora lutea 1.5 0.7 3 2.8 1.5 0.7 NS per ewe having ovulated Moment of the LH peak 72 17 60 0 78 25 NS (hours after withdrawal)

[0200] The statistical analysis was carried out by means of a Fisher's exact test.

[0201] Compared with the control and FSH batches, the results obtained in the CA5 batch do not show any significant effect on the ovulatory response. None of the parameters measured shows a trend.

[0202] The progesterone secretion profile during the luteal phase obtained in the three batches is illustrated in FIG. 14. For each individual, the progesterone concentration values (ng/ml) were standardized with respect to the number of corpora lutea. Each curve represents the mean of the progesterone values obtained in the females of each batch at a time t.

[0203] A significant effect of the CA5 antibody was observed on the strength of progesterone secretion per corpus luteum and on the start of the establishing thereof (FIG. 14A). An effect is observed on the CA5 curve, compared with the curves of the FSH and serum batches, a beginning of progesterone secretion as early as D4 followed by a significant increase in the secretion which is maintained throughout the luteal phase until the end of cycle. The mean progesterone values at D10 are 1.38 ng/ml0.92 and 0.52 ng/ml respectively for the CA5, FSH and serum D batches and 2.581.7 and 1.18 ng/ml at D15. The comparison of the three curves was carried out using a paired non-parametric t test (Wilcoxon test). Thus, the curve of the CA5 batch is higher than the curve of the FSH batch and significantly different (p<0.01), likewise with the curve of the control batch (p<0.001). The curve of the FSH batch is higher and significantly different than that of the control batch (p<0.001).

[0204] To quantify this significant and constant increase in the level of progesterone secretion until the end of cycle in the ewes under CA5 stimulation, the area under the curve (AUC) was calculated with the GraphPad Prism version 5.0 software. The results are shown in FIG. 14B and show that the AUC of the CA5 curve (23.61 arbitrary units) tends to be higher than the AUC of the serum curve (8 units), but this difference is not significant. Likewise, the AUC of the FSH curve (12 units) is not significantly different than the control curve.

[0205] In conclusion, the injection of CA5 in ewes gives the same results as a conventional treatment with FSH in terms of ovulation induction, but enables faster establishment of progesterone secretion and the maintaining of a more effective functional corpus luteum with a higher circulating progesterone level, guaranteeing a better success of the early embryonic development and the maintaining of gestation (decreased risk of abortion).

[0206] In protocol 2, carried out in the sexual season: [0207] the CA5 antibody batch (n=7) received a single intramuscular injection of 2 mg of CA5 antibody 24 h before withdrawal of the sponge; [0208] the control batch (n=9) received an injection of physiological saline, intramuscularly, 24 h before the withdrawal of the sponge; [0209] the FSH batch (n=11) received an intramuscular injection of 100 g of porcine FSH (pFSH) 24 h before the withdrawal of the sponge and of 90 g 12 h before the withdrawal of the sponge.

[0210] The analysis of the ovulatory response gave the results presented in table 31 below. The statistical analysis was carried out by means of a Fisher's exact test.

TABLE-US-00031 TABLE 31 CA5 Serum alone batch FSH batch batch Statistics Number of 9 11 7 ewes per batch Number of 4/9 (44%) 4/11 (36%) 7/7 (100%) ***, ewes having p < 0.0001 ovulated per batch Number of 0.67 0.3 0.9 0.5 1.5 0.4 NS, p = 0.06 corpora lutea per ewe of the batch Number of 1.5 0.3 3 1.4 1.5 0.4 NS corpora lutea per ewe having ovulated Moment of the 64 13 56 7 57 4.4 NS LH peak (hours after withdrawal)

[0211] Compared with the control and FSH batches, the results obtained in the CA5 batch show a very significant effect of the antibody injected alone on the ovulatory response. Indeed, 100% of the females (7/7) having received an injection of 2 mg of antibody ovulated, compared with 44% and 36% respectively for the serum batch and the FSH batch (p<0.0001, Fisher's exact test). The number of corpora lutea obtained per female on the total numbers of the batch is likewise greater in the CA5 batch, almost significantly (p=0.06, Mann-Whitney t test): 1.5 corpora lutea compared with 0.9 (FSH) and 0.67 (serum ) respectively. The mean number of corpora lutea per female having ovulated is not significantly different between the three batches.

[0212] The mean moment of appearance of the LH peak is not significantly different between the three batches. Despite everything, a tendency toward less variability in the arrival of the LH peak (and thus in the moment of ovulation) is observed in the CA5 batch compared with the FSH batch and especially serum batch.

[0213] The progesterone secretion profile during the luteal phase following the ovulation is shown in FIG. 15A. For each individual, the progesterone concentration values (ng/ml) were standardized with respect to the number of corpora lutea. Each curve of the figure represents the mean of the progesterone values obtained in the females of each batch. A notable effect of the CA5 antibody was observed on the strength of the progesterone secretion: a considerable and very significant increase in progesterone secretion per corpus luteum was observed throughout the luteal phase compared with the curves of the FSH batch and of the serum batch. The mean values at D10 are 2.44 ng/ml, 1.3 and 0.62 ng/ml respectively for the CA5, FSH and serum batches, and 2.881.42 and 1.18 ng/ml at D15. The comparison of the three curves was carried out by means of a paired non-parametric t test (Wilcoxon test). The curve of the CA5 batch is significantly higher and different than the curve of the FSH batch (p<0.01), likewise with the curve of the control batch (p<0.001). The curve of the FSH batch is significantly different than that of the control batch (p<0.001).

[0214] To quantify this notable and constant increase in the progesterone secretion level per corpus luteum throughout the luteal phase of the cycle in the ewes under CA5 stimulation, the area under the curve (AUC) was calculated with the GraphPad Prism version 5.0 software. The results are shown in FIG. 15B and show that the AUC of the CA5 curve (24.20 units) is significantly higher by a factor of 3 than the AUC of the serum curve (8.1) (p<0.05, non-parametric Mann-Whitney t-test). Conversely, the AUC of the FSH curve is not significantly different than the control curve.

[0215] In conclusion, the use of the CA5 antibody in the form of a single intramuscular injection of 2 mg gave, very significantly, better results than a conventional treatment with FSH, allowing: [0216] 1the induction of ovulation in 100% of the females stimulated, [0217] 2the development of corpora lutea of better quality with progesterone secretion much higher than that observed following an FSH treatment and a very fast establishment as early as D4. It should be emphasized that the impact on this additional property of CA5 compared with an FSH treatment is very important. [0218] This is because the plasma progesterone concentration is a key factor in embryonic development, particularly in its early phases.

[0219] The faster establishing of progesterone secretion and the maintaining of a more effective functional corpus luteum with a higher circulating progesterone level is the guarantee of a better success of the early embryonic development and of the maintaining of gestation with a decreased risk of abortion.

[0220] All of the results indicate that the potentiating antibodies, particularly CA5, injected in vivo in ewes is capable of complexing the animal's endogenous gonadotropic hormones and of potentiating the biological activity of the animal's own hormones.

[0221] The potentiating effect of the CA5 antibody in ewes is capable of inducing a stimulation of the ovary stronger than the conventional FSH hormonal treatment: ovulation induction is 100% in the sexual season and in all cases a considerable increase in circulating progesterone concentration, of 200% to 300%, is maintained throughout the luteal phase. This additional effect is major for reducing progestogen-dependent embryonic development failure rates and the risks of abortion.

Example 5

In Vivo Measurement of the Potentiating Effect of the Ca5 Ligand of the Invention on the Bioactivity of Endogenous Gonadotropins in Heifers

[0222] After having demonstrated and characterized the potentiating effect of the CA5 monoclonal antibody in rats and ewes, the objective was to study its effect on the activity of endogenous gonadotropins in a larger animal: the heifer. For this, a treatment comprising only the injection of the antibody alone was developed in Prim'Holstein heifers so as to evaluate the efficacy thereof. These heifers were free of any prior stimulation of the ovary, the animals having received no ovulation-stimulating hormonal treatment with a gonadotropin prior to the injection of the antibody.

[0223] The protocol aiming to evaluate the potentiating effect of the CA5 antibody was carried out on Prim'Holstein heifers 20 to 22 months old, the ovulatory cycle of which was synchronized beforehand by implanting a progestogen implant (3.3 mg Norgestomet, CrestarMSD) for 7 days. An injection of GnRH (0.004 mg of buserelin acetate, Crestar PackMSD) was carried out on the day the implant was implanted, followed by an injection of prostaglandins 24 hours before the withdrawal of the implant (ProsolvinVirbac).

[0224] The animals were separated into two batches: [0225] the CA5 batch (n=4) received two injections of 11 mg of purified CA5 antibody intramuscularly: the first given 24 hours after the implantation of the implant and the second given 24 hours before the withdrawal of the progestogen implant; [0226] the control batch (n=3) received two injections of physiological saline, intramuscularly, the first given 24 hours after the implantation of the implant and the second given 24 hours before the withdrawal of the progestogen implant.

[0227] The potentiating effect was analyzed by comparing the ovulatory response (ovulation or no ovulation) and the establishment of a functional corpus luteum of good quality (size of the corpus luteum and size of the progesterone secretion) in the control heifers (physiological saline batch), and in the heifers treated with the antibody alone (CA5 batch).

[0228] A plasma LH and estradiol assay was carried out by the ELISA method in order to detect and date the pre-ovulatory LH peak, and to monitor the estradiol secretion. To evaluate the ovulatory response and the size of the corpora lutea, ovarian ultrasounds were carried out daily. Finally, to evaluate the functionality and the quality of the corpus luteum, a quantitative progesterone ELISA assay was carried out on daily blood samples from the day of the implantation of the implant to the 21st day after withdrawal of the implant.

[0229] The heifers were inseminated and a gestation diagnosis was performed by ultrasound 35 days after insemination.

[0230] All the statistical analyses were performed with the GraphPad Prism Version 5.0 software (GraphPad, San Diego, Calif., USA).

[0231] The ovulatory response was first of all compared in the two batches of heifers by measuring the circulating estradiol levels. The results presented in FIG. 16A show the estradiol secretion profile in two heifers representative of each batch. The estradiol peak observed at D0 is greater in amplitude in the treated animal, with a concentration of 9.2 pg/ml compared with 6.6 pg/ml in the control at D0 and of 10.5 pg/ml compared with 8.8 pg/ml in the control at D1.5 (not significant). The mean of the results of the heifers of each batch is represented as a percentage of the basal estradiol concentration measured when the implant is implanted (FIG. 16B). The same tendencies are found, with an estradiol peak of which the amplitude tends to be greater in the batch treated with the CA5 antibody compared with the heifers of the control batch: at withdrawal of the implant (D0), with 14916% compared with 1337% and, at D1.5 after withdrawal of the implant, 1616% compared with 1448% (not significant). The estradiol level between D3 and D8 indicates, in both batches, a second, smaller, secretion peak, reflecting a second follicular wave. In the CA5 batch, the increase in the estradiol concentration tends to be earlier than in the control batch: at D6, it is 1133% in the heifers treated with CA5 compared with 1040.5 in the controls.

[0232] The analysis of the area under the curve of the estradiol peak in the two batches of heifers (FIG. 16C) also illustrates a tendency, although this is not significant, toward obtaining a higher estradiol peak in the batch treated with CA5 (area of 129.520 units) than in the control batch (area of 97.518 units).

[0233] Overall, the results show a tendency, although not significant, to have better estradiol secretion in the heifers treated with the CA5 antibody, which may reflect a better quality of the follicular phase.

[0234] The results regarding the preovulatory LH peak are shown in FIG. 17. They show no difference in relation to the moment at which the LH peak appears (FIG. 17A): in the control batch, the LH peak occurs 44 h8 h after withdrawal of the implant, compared with 40.5 h5.1 h in the batch treated with the CA5 antibody. The maximum concentration of the LH peak is 4.81.8 ng/ml of LH in the control batch compared with 9.81.2 ng/ml in the heifers treated with the CA5 antibody (FIG. 17B). The maximum LH concentration during the preovulatory peak tends to be greater in the batch treated with the antibody, but this tendency is not significant. The same tendency is observed with respect to the area under the curve of the preovulatory LH peak: it is 64.55.8 arbitrary units in the control heifers compared with 984.8 in the heifers treated with the CA5 antibody (FIG. 17C). This tendency toward a greater LH peak in the heifers treated with CA5 is not however significant.

[0235] The ultrasound analysis after the ovulation indicated that all the heifers of the two batches had had a single ovulation.

[0236] The quality of the luteal phase was subsequently analyzed by regularly measuring the size of the corpus luteum by ultrasound in order to monitor its development. The results shown in FIG. 18A indicate that the batch of heifers treated with CA5 tends to have a larger corpus luteum (262 mm in diameter) than the batch of control heifers (221 mm in diameter). Nevertheless, this difference is not significant.

[0237] The measurement of the plasma progesterone concentration throughout the luteal phase is represented in FIG. 18B. It reveals a very significant difference between the two batches (p<0.001). The circulating progesterone level is expressed as a percentage of the basal concentration measured at withdrawal of the implant. At D9 after withdrawal it is 66885% in the control batch compared with 1266254% in the batch treated with the antibody, that is to say a 1.9-fold increase compared with the control batch. At D20 after withdrawal it is 64674% in the control batch compared with 1598327% in the batch treated with the antibody, that is to say a 2.47 fold increase compared with the control batch. These results reflect a better quality of the corpus luteum with a tendency to have a greater diameter and especially higher progesterone secretion in the heifers treated with the CA5 antibody. It should be emphasized that a better functional quality of the corpus luteum during the luteal phase is predominant in the success of the implantation of the embryo and of its early development. It reduces the risks of early abortions.

[0238] The gestation diagnoses carried out 35 days after artificial insemination indicated that all the heifers in each of the batches were gestating.

[0239] In conclusion, these results show that the heifers treated with the CA5 antibody tend to have a better estrogenic response, although this is not significant, during the follicular phase and have a significantly higher progesterone secretion during the luteal phase.

Example 6

In Vivo Measurement of the Potentiating Effect of the Ca5 Ligand of the Invention on the Bioactivity of Endogenous Gonadotropins in Female Monkeys

[0240] After having demonstrated and characterized the potentiating effect of the CA5 monoclonal antibody in vivo in rats, ewes and heifers, its potentiating effect was studied in a species close to humans: the Cynomolgus monkey (Macaca fascicularis). For this, a study was carried out on pubescent macaques at least 36 months old, with the aim of evaluating the potentiating effect of the antibody on human FSH and on the endogenous hormone of the macaque treated.

[0241] For this, a study was carried out on four pubescent macaques at least 36 months old. The CA5 antibody was injected either 20 minutes after an injection of exogenous FSH, or alone. On the first day of menstruation, the macaques received an injection of 1.5 mg of sustained-release GnRH preparation (Decapeptyl L.P. 3 mgIPSEN Pharma) intramuscularly. Fifteen days later, the four female monkeys received a different treatment: [0242] animal treated with 25 IU for 8 days (25 IU8 batch): a daily injection of 25 IU of human FSH (Gonal-f prefilled penMerck Serono) was carried out subcutaneously, for 8 days; [0243] animal treated with 25 IU on one day (25 IU1 batch): a single injection of 25 IU of human FSH (Gonal-f prefilled penMerck Serono) subcutaneously was carried out on the first day of treatment; [0244] animal treated with CA5+hFSH (CA5+hFSH batch): a single injection of CA5 antibody (80 g) was carried out subcutaneously 20 minutes after the injection of 25 IU of human FSH (Gonal-f prefilled penMerck Serono), on the first day of treatment only; [0245] animal treated with CA5 alone (CA5 batch): a single injection of CA5 antibody alone (88.5 g), was carried out subcutaneously without injection of exogenous hormone, on the first day of treatment only.

[0246] The potentiating effect was analyzed by comparing the follicular growth induced by the treatment. For this, transabdominal ovarian ultrasounds were performed every 48 hours in order to count the follicles and to measure their surface area (expressed in mm.sup.2).

[0247] The effect obtained with an injection of the CA5 antibody carried out 20 minutes after injection of 25 IU of hFSH (CA5+hFSH batch) was compared to that of an injection of 25 IU of hFSH (25 IU1 batch) and to that of eight daily injections of 25 IU of hFSH (25 IU8 batch). The results shown in FIG. 19A show that, on the 9th day after the beginning of the FSH treatment, the female monkey treated with a single injection of 25 IU of hFSH exhibits no stimulated follicle (area under the curve, zero). Conversely, the female monkey treated a single time with the CA5+hFSH mixture on the first day of treatment exhibited eight growing follicles with a total area of the follicles of 37 mm.sup.2 equal to that measured in the female monkey having received eight injections of hFSH (25 IU8), which was 35 mm.sup.2 with 11 stimulated follicles. A single injection of the CA5+25 IU hFSH complex thus stimulated the ovaries as effectively as eight injections of 25 IU of hFSH. This result demonstrates a potentiating effect of CA5, in vivo in female monkeys, resulting in follicular stimulation. Indeed, since the half-life of FSH is less than one hour, the effects observed with CA5 cannot be attributed solely to an effect on the injected hFSH, but also reflect an effect on the endogenous FSH of the female monkey.

[0248] The effect of an injection of the CA5 antibody injected alone (CA5) was then studied and compared to that of an injection of 25 IU of hFSH (25 IU1) and to that of three daily injections of 25 IU of hFSH (25 IU3 batch). A stimulatory effect of the antibody injected alone was optimally observed three days after its injection. The results shown in FIG. 19B show that, on the 3rd day of the treatment, the female monkey having received a single injection of antibody alone (CA5) exhibits ovarian stimulation with five growing follicles representing an area of 32.6 mm.sup.2. In comparison, the female monkey having received three injections of 25 IU of hFSH (25 IU3) exhibited only a very weak stimulation with just one growing follicle, the area of which was 1.6 mm.sup.2. Beyond the 3rd day of treatment, the ovarian stimulation induced by CA5 alone was not maintained and the stimulated follicles disappeared. A further injection of antibody or the adjustment of the dose injected on D1 would probably have been necessary in order to maintain the stimulatory effect on the ovaries. This result nevertheless indicates that the CA5 antibody injected alone was capable of complexing the endogenous FSH of the female monkey and of potentiating its biological activity sufficiently to induce the beginning of ovarian stimulation.

Example 7

Prediction of the Epitope Recognized by the CA5 and CH10 Ligands of the Invention, and Prediction of their Paratope

[0249] The respective epitope of the CA5 and CH10 antibodies was determined on the gonadotropic hormones of various species using a protein-docking algorithm based on protein structure modeling using a VoronoI diagram and optimization by various score function evolutionary learning methods making it possible to differentiate native and non-native conformations (Bernauer et al., Bioinformatics 2007, 5:555) [14], (Bernauer et al., Bioinformatics 2008, 24:652) [15], (Bourquard et al., PLoS One 2011, 6:e18541) [16] and (Bourquard et al., Sci. Reports 2015, 5 :10760) [17].

[0250] Each antibody was docked with human FSH (hFSH), human LH (hLH), the human CG (hCG), ovine FSH (oFSH) and ovine LH (oLH), porcine FSH (pFSH) and porcine LH (pLH). The crystallographic structures of hFSH and of hCG are available in the Protein Data Bank (PDB): 4MQW and 1QFW respectively. The structure of human FSH complexed with the extracellular domain of the human FSH receptor was used (Fan and Hendrickson, Nature 2005, 433:269) [18]. For the other hormones (hLH, oFSH, oLH, pFSH and pLH), homology models were produced and then used for the docking.

1/Epitope and Paratope of the CA5 Ligand

[0251] Since the 3D structure of the CA5 antibody is not available, the study was carried out using the sequences of the monovalent VH and VL fragments of CA5. For this, variable part homology models were produced. The VH and VL models were produced separately, from different structures, and their relative orientation was determined from the structure having served as support for the VH modeling. The structures used for the homology models are available in the Protein Data Bank (PDB): 3OKK for the CA5 VH and 3MBX for the CA5 VL.

[0252] The docking results are shown in FIG. 20. It appears that the CA5 ligand docks similarly on the seven target hormones. The epitope is defined by several regions located discontinuously on the beta-subunit essentially and, for two residues, on the alpha-subunit of the gonadotropins studied. The epitope also involves ten residues of the ectodomain of the human FSH receptor. The epitope of the CA5 ligand is thus highly conformational: it is made up of several sequential regions of the hormone and of a sequence of the receptor, which are spatially close in the native conformation of the hormone and of the activated receptor.

[0253] The various residues of the hormone and of the receptor that are involved in the interface with the CA5 ligand are surrounded by rectangles in FIG. 20. The five residues denoted by a shaded area on the beta-subunit of hFSH are involved in the main interaction and have a major role in the antibody/antigen recognition: these are the serine in position 22 (Ser22), the glycine in position 65 (Gly65), the cysteine in position 66 (Cys66), the arginine 97 (Arg97) and the glycine 98 (Gly98) on the beta-subunit of hFSH. The Gly65 and Cys66 residues are present in the sequence of all the other target hormones.

[0254] The CA5 ligand also recognizes residues 97 to 100 and 102 to 109 in the C-terminal end of the FSH beta-subunit. This region, which constitutes a seat belt, plays a major role in stabilizing the association of the alpha/beta dimer of the hormone. It thus appears that the binding of the CA5 ligand to the hormone makes safe the closure of the seat belt and thus contributes to the stability of the dimer, which is essential for the bioactivity of the hormone (only the dimer is active).

[0255] The CA5 antibody is essentially directed against the beta-subunit of hFSH.

[0256] Only two residues of the alpha-subunit are involved in the interface: these are the arginine residue in position 35 (Arg35) and the glutamic acid residue in position 56 (G1u56) which are spatially close in the native hormone. Their role is to fix the C-terminal end of the beta-subunit in order to maintain the seat belt around the alpha-subunit. These two residues are constantly present and recognized in all the target hormones. They play a very important role in the bioactivity of the hormone.

[0257] Another characteristic of the epitope of the CA5 antibody is the involvement of the His2-His3-Arg4-Ile5, His7, Leu14, Gln16-Glu17, Lys19 and Arg35 residues of the N-terminal region of the human FSH receptor, in the interface recognized by the CA5 antibody.

[0258] Table 32 shows the various regions constituting the epitope of the CA5 ligand and those constituting its paratope.

[0259] The two VH and VL chains are involved in the recognition of the hormone, via their three CDRs and some residues of their frameworks.

[0260] The five residues involved in the main interaction are recognized by Asn53 of the VH CDR2, residues Asp31, Phe27 and Thr28 of the VH CDR1 and residues Ser33 and Asn34 of the VL CDR1.

[0261] Only the VL chain is involved in the recognition of the ectodomain of the FSH receptor, particularly residues Gln35 and Lys36 of its CDR1, residue Ser58 of its CDR2 and several residues of framework 3.

[0262] In conclusion, the CA5 ligand recognizes a conformational epitope involving the alpha-subunit and the beta-subunit of hFSH and its C-terminal end forming the seat belt, and also the ectodomain of the FSH receptor. The VL chain is the only one involved in the interaction with the ectodomain of the receptor. The two VH and VL chains are involved in the interaction with the subunits of the hormone. The conformational epitope of the CA5 ligand enables it, on the one hand, to stabilize the hormone dimer association and, on the other hand, to stabilize the binding of the hormone to its receptor. These two mechanisms are complementary and fundamental for resulting in better interaction of the hormone on its receptor and thus obtaining better efficacy. They thus appear to constitute the mechanistic bases of the potentiating effect of the CA5 ligand on gonadotropins.

2/Epitope and Paratope of the CH10 Ligand

[0263] Since the 3D structure of the CH10 antibody is not available, the study was carried out using the sequences of the monovalent VH and VL fragments of CH10. For this, variable part homology models were produced. The VH and VL models were produced separately, from different structures, and their relative orientation was determined from the structure having served as a support for the VH modeling. The structures used for the homology models are available in the Protein Data Bank (PDB): 4QNP for the CH10 VH and 3D85 for the CH10 VL.

[0264] The docking results are shown in FIG. 21. It appears that the CH10 ligand docks similarly on the seven target hormones. The epitope is defined by several regions located discontinuously on the alpha- and beta-subunits of FSH and also involves eight residues of the N-terminal end of the human FSH receptor. The epitope of the CH10 ligand is thus conformational: it consists of several sequential regions of the hormone and of a sequence in the N-terminal end of the FSH receptor. All of these regions are spatially close in the native conformation of the hormone and of the activated receptor.

[0265] The various residues of the hormone and of the receptor that are involved in the interface with the CH10 ligand are surrounded by rectangles in FIG. 21. The four residues denoted by a shaded area on the alpha-subunit (Asp6-Cys7-Pro8 and Glu56 on hFSH) and the two residues denoted by a shaded area on the beta-subunit (Ser2-Cys3 on hFSH) are involved in the main interaction and have a major role in the antibody/antigen recognition. Among the other residues involved in the interface, those located on the C-terminal part of the beta-subunit are involved in the region known as the seat belt, the role of which is to stabilize the association of the alpha/beta dimer of the hormone. It thus appears that the binding of the CH10 ligand to the hormone makes safe the closure of the seat belt and thus contributes to the stability of the dimer, which is essential for the bioactivity of the hormone. Furthermore, the CH10 ligand exhibits major recognition of residue Glu56 on the alpha-subunit, which is involved in the fixing of the seat belt on the alpha-subunit.

[0266] Another characteristic of the epitope of the CH10 antibody is the involvement of the Cys1-His2, His7-Cys8-Ser9, Lys14, Gln16 and Arg35 residues of the N-terminal region of the human FSH receptor in the interface recognized by the antibody.

[0267] Table 33 shows the various regions constituting the epitope of the CH10 ligand and those constituting its paratope.

[0268] The CDR2 and CDR3 of the VH chain and the CDR1, CDR2 and CDR3 of the VL chain are involved in the recognition of the hormone, as are some residues of framework 3 of the VH chain and of frameworks 1 and 2 of the VL chain.

[0269] The residues involved in the main interaction are recognized by the residues Thr60 of the CDR2, Tyr61-Tyr62-Asp64-Lys67 of framework 3 of the VH chain and residues His92 and Ser93 of the CDR3 of the VL chain.

[0270] Only the VL chain is involved in the interaction on the ectodomain of the receptor via its CDR1 and its frameworks 1 and 2.

Example 8

Construction, Production and Characterization of Various Fragments of the CA5 Ligand of the Invention

[0271] Various fragments of the CA5 antibody were constructed in order to evaluate their capacity to potentiate the biological activity of ovine FSH and human FSH (Gonal-f Merck Serono). A fragment comprising the light variable chain alone, called CA5 VL, a fragment comprising the heavy variable chain alone, called CA5 VH and a reverse CA5 scFv constructed in a reverse VL-VH order compared with the VH-VL sequence (SEQ ID NO : 19 and SEQ ID NO : 20) of the CA5 scFv described in example 1, paragraph 4 of the present invention, were produced.

1/Antibody Fragment Construction and Production

[0272] The synthetic genes encoding the CA5 VL and reverse CA5 scFv fragments derived from the CA5 antibody were synthesized by ATG:Biosynthetics GmbH (Germany). The reverse CA5 scFv consists of the CA5 VL of the CA5 scFv-linker-CA5 VH of the CA5 scFv fusion (SEQ ID No 19). Each synthetic gene is designed by the fusion of the sequence of the pSW1 plasmid [7], included between the HindIII site and the end of the sequence encoding the PelB protein, and the sequence of the protein of interest to be synthesized (SEQ ID No 44 and SEQ ID No 48), flanked by the Xhol restriction site. The sequences are inserted between the HindIII and Xhol sites of the pSW1 plasmid. The codons were optimized for expression in E. coli.

[0273] The pSW1-CA5 VH expression plasmid was obtained by insertion, into the pSW1 plasmid [7] at the Pstl-Xhol sites, of the fragment resulting from the digestion by these same enzymes of the pSW1 reverse CA5 scFv plasmid.

[0274] After verification by sequencing of the quality of the constructs, the pSW1-CA5 VL, pSW1-CA5 VH and pSW1 reverse CA5 scFv plasmids were used to transform, by heat shock, HB2151 bacteria (T53040, Interchim, France) made competent [8].

TABLE-US-00032 TABLE34 NucleotideandpeptidesequencesofCA5VL CA5VL Nucleotide GATATTCAGATGACCCAGACCCCGTCAAGCCTGGCGGTGTCAG sequence TCGGCGAAGAGATTACTATGAGCTGTAAAAGCTCGCAGAGCCTG SEQIDNO:44 CTGTACTCATCGAACCAGAAAAATTACCTGGCATGGTATCAACA GAAGCCGGGTCAGTCGCCGAAACTGCTGATCTACTGGGCCTCA ACCCGTGAGAGCGGCGTACCGGATCGCTTTACTGGCAGCGGCA GCGGCACGGACTTTACGCTGACGATTAGCTCGGTGAAGGCCGA AGACCTGGCGGTTTATTATTGCCAACAGTACTATAGCTACCCTC GTACCTTCGGCGGCGGCACGAAACTTGAGATTAAACATCACCAT CACCATCACTAA Peptide DIQMTQTPSSLAVSVGEEITMSCKSSQSLLYSSNQKNYLAWYQQK sequence PGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAV SEQIDNO:45 YYCQQYYSYPRTFGGGTKLEIKHHHHHH*

TABLE-US-00033 TABLE35 NucleotideandpeptidesequencesofCA5VH CA5VH Nucleotide CAGGTGCAGCTGCAGCAGTCAGGCGGCGGCCTGGTACAACCT sequence GGTGGCTCACTGCGCCTGAGCTGCGCAACCAGCGGTTTTACCT SEQIDNO:46 TTAGCGATTTCTACATGGAATGGGTTCGCCAACCGCCGGGTAAG CGTCTGGAATGGATCGCGGCGAGCCGTAACAAGGCGAAAGATT ATACCACTGAATATAGCGCGTCGGTGAAAGGTCGCTTCATTGTC TCGCGCGATACCAGCCAGTCGATTCTGTATCTGCAAATGAATGC CCTGCGTGCCGAAGACACGGCCATCTACTTCTGTGCGCGTGAT GCACGCTTTGCCTATTGGGGCCAAGGCACCCTGGTGACCGTTA GCGCCCATCACCATCACCATCACTAA Peptide QVQLQQSGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKR sequence LEWIAASRNKAKDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAE SEQIDNO:47 DTAIYFCARDARFAYWGQGTLVTVSAHHHHHH*

TABLE-US-00034 TABLE36 NucleotideandpeptidesequencesofreverseCA5scFv ReverseCA5scFv Nucleotide GATATTCAGATGACCCAGACCCCGTCAAGCCTGGCGGTGTCAG sequence TCGGCGAAGAGATTACTATGAGCTGTAAAAGCTCGCAGAGCCTG SEQIDNO:48 CTGTACTCATCGAACCAGAAAAATTACCTGGCATGGTATCAACA GAAGCCGGGTCAGTCGCCGAAACTGCTGATCTACTGGGCCTCA ACCCGTGAGAGCGGCGTACCGGATCGCTTTACTGGCAGCGGCA GCGGCACGGACTTTACGCTGACGATTAGCTCGGTGAAGGCCGA AGACCTGGCGGTTTATTATTGCCAACAGTACTATAGCTACCCTC GTACCTTCGGCGGCGGCACGAAACTTGAGATTAAAGGTGGTGG CGGTTCAGGTGGTGGCGGTAGCGGTGGCGGTGGCTCACAGGT GCAGCTGCAGCAGTCAGGCGGCGGCCTGGTACAACCTGGTGG CTCACTGCGCCTGAGCTGCGCAACCAGCGGTTTTACCTTTAGCG ATTTCTACATGGAATGGGTTCGCCAACCGCCGGGTAAGCGTCTG GAATGGATCGCGGCGAGCCGTAACAAGGCGAAAGATTATACCA CTGAATATAGCGCGTCGGTGAAAGGTCGCTTCATTGTCTCGCGC GATACCAGCCAGTCGATTCTGTATCTGCAAATGAATGCCCTGCG TGCCGAAGACACGGCCATCTACTTCTGTGCGCGTGATGCACGC TTTGCCTATTGGGGCCAAGGCACCCTGGTGACCGTTAGCGCCC ATCACCATCACCATCACTAA Peptide DIQMTQTPSSLAVSVGEEITMSCKSSQSLLYSSNQKNYLAWYQQK sequence PGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAV SEQIDNO:49 YYCQQYYSYPRTFGGGTKLEIKGGGGSGGGGSGGGGSQVQLQQ SGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAA SRNKAKDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYF CARDARFAYWGQGTLVTVSAHHHHHH*

[0275] The fragment production was carried out according to the method previously described in example 1 of the present invention.

2/In Vitro Measurement of the Effect of the CA5 VL, CA5 VH and Reverse CA5 scFv Fragments on the Bioactivity of FSH

[0276] The in vitro effect of the CA5 VL, CA5 VH and reverse CA5 scFv fragments on the bioactivity of ovine and human FSH was studied with the HEK 293 cell line stably transfected with the human FSH receptor and the Glosensor system according to the protocol previously described in example 2 of the present invention. The CA5 VL and CA5 VH fragments alone or as a mixture were tested at 40 nM each. The reverse CA5 scFv was tested at the concentration of 80 nM, just like the reference CA5 scFv. The ovine FSH and the human FSH (Gonal f) were tested at 0.1 nM.

[0277] FIG. 22 shows the cAMP production kinetics curves expressed in relative luminescence units as a function of time (in minutes) obtained in the presence of 0.1 nM of ovine FSH (oFSH) alone or complexed with the various CA5 fragments. Four conditions were compared with oFSH alone: the oFSH+CA5 VL complex (FIG. 22A), the oFSH+CA5 VH complex (FIG. 22B), the oFSH+reverse CA5 scFv complex (FIG. 22C) and finally the complex of oFSH with an equimolar mixture of 40 nM of CA5 VL and of 40 nM of CA5 VH (FIG. 22D). It is observed that, in all cases, a very significant potentiating effect is obtained (p<0.001), increasing the cell response to 30 mn of stimulation by a factor of 2.1 to 2.4 times compared with the response induced by FSH alone. These results indicate that the VH and VL fragments alone are capable of exerting a potentiating effect on the bioactivity of oFSH in the same way as the whole scFv. They validate the involvement of the two variable chains in the potentiating effect, described in the model of example 7 of the present invention. The CA5 VH+CA5 VL mixture like the reverse CA5 scFv (VLVH) exerts the same potentiating effect as the CA5 scFv of origin (VHVL).

[0278] The same study was carried out with human FSH (Gonal f) at the concentration of 0.1 nM, alone or complexed with the various CA5 fragments. Four conditions were compared with hFSH alone: the hFSH+CA5 VL complex (FIG. 22E), the hFSH+CA5 VH complex (FIG. 22F), the hFSH+reverse CA5 scFv complex (FIG. 22G) and finally the complex of hFSH with an equimolar mixture of 40 nM of CA5 VL and of 40 nM of CA5 VH (FIG. 22H). It is observed that the CA5 VL fragment at the concentration of 40 nM complexed with hFSH does not exert a significant potentiating effect, contrary to the CA5 VH fragment which very significantly (p<0.001) amplifies the maximum cell response of 225% in a manner comparable to CA5 scFv (275% increase) compared with a stimulation with hFSH alone (FIGS. 22E and 22F). Likewise, the reverse CA5 scFv CA5 VLVH (FIG. 22G) and the mixture of the two VH+VL chains (FIG. 22H), complexed with hFSH, induce a significant increase (p<0.001) in the cell response of 225% and 230% respectively, close to that obtained with the CA5 scFv complexed with hFSH (increase between 250% and 260%). These results indicate that the CA5 VL+CA5 VH mixture just like the reverse CA5 scFv, complexed with hFSH, induces a significant potentiating effect close to that induced by the reference CA5 scFv. Only the VH fragment exerts a significant potentiating effect on hFSH in this test, unlike CA5 VL.

3/In Vivo Measurement of the Potentiating Effect of the CA5 VL, CA5 VH and Reverse CA5 scFv Fragments on the Bioactivity of FSH in the Female Rat

[0279] After having been characterized in vitro, the potentiating effect of the various CA5 fragments was characterized in vivo, in the female rat, in order to characterize their effect on the bioactivity of FSH.

[0280] In order to measure the FSH bioactivity, the protocol used was that of the biological assay of Steelman and Pohley (Steelman SL, Pohley FM. Endocrinology, 53 : 604-616. 1953) [12] as described in example 3 of the present invention.

[0281] FIG. 23 illustrates the effect of the various fragments of the bioactivity of hFSH. Each batch comprised five female rats. The batch treated with hFSH complexed with the reverse CA5 scFv gave a mean weight of the ovaries of 210 mg, identical to that of the batch treated with the CA5 scFv complexed with hFSH (200 mg), that is to say an increase of 190% compared with the batch having received the hormonal treatment alone (p<0.05). The batches treated with the CA5 VL or CA5 VH fragments complexed with hFSH had a mean weight of the ovaries of 240 mg and 230 mg respectively, that is to say an increase of 218% and 209% respectively compared with the batch having received the hormonal treatment alone (p<0.001 and p<0.01 respectively).

[0282] These results demonstrate significantly that the order of construction of the scFv (VLVH versus VHVL) complexed with hFSH does not affect the potentiating properties of the scFv on the bioactivity of FSH. These results also demonstrate very significantly that the CA5 VH or CA5 VL chains complexed with the hormone are themselves also capable of potentiating the bioactivity of the hormone. This reflects the respective involvement of the two chains in this effect, as predicted by the interaction model described in example 7 of the present invention.