COMPOSITIONS AND METHODS FOR IMPROVING PLANT NITROGEN UTILIZATION EFFICIENCY (NUE) AND INCREASING PLANT BIOMASS

20230078124 · 2023-03-16

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided are machine learning methods for identifying genes that affect plant properties. Also provided are plant cell sand plants comprising genetic modifications that improve plant nitrogen utilization and increased biomass. Methods of making the modified plant cells and plants are also provided.

    Claims

    1. A modified plant cell, said modified plant cell comprising a modification that inhibits expression of hb75.

    2. The modified plant cell of claim 1, further comprising a modification such that expression of a gene selected from Table 4 is altered.

    3. The modified plant cell of claim 2, wherein the gene is nf-ya3, and wherein expression of nf-ya3 is inhibited.

    4. A plant comprising plant cells of claim 1.

    5. The plant of claim 4, wherein the plant exhibits at least one of: an increase in Nitrogen (N) uptake, increased biomass, an increased harvest index, an increased Total nitrogen utilization (NUtE), or an increased total Grain NUtE, relative to a plant that does not comprise a modification that inhibits expression of hb75.

    6. The plant of claim 5, wherein the plant exhibits the increased biomass.

    7. The plant of claim 5, wherein the plant is a maize plant.

    8. The plant of claim 7, wherein the increased biomass comprises increased grain mass.

    9. A method comprising modifying a plant comprising disrupting expression hb75 such that the plant exhibits at least one of an increase in Nitrogen (N) uptake, increased biomass, an increased harvest index, an increased Total nitrogen utilization (NUtE), or an increased total Grain NUtE, relative to a plant that does not comprise a modification that inhibits expression of hb75.

    10. The method of claim 9, wherein the plant further comprises a such that expression of a gene selected from Table 4 is altered.

    11. The method of claim 10, wherein the gene is nf-ya3, and wherein expression of nf-ya3 is inhibited.

    12. The method of claim 9, wherein the plant is a maize plant.

    13. The method of claim 10, wherein the plant is a maize plant.

    14. The method of claim 11, wherein the plant is a maize plant.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0007] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

    [0008] FIG. 1. Evolutionarily informed machine learning approach enhances the predictive power of gene-to-phenotype relationships. Step 1 Feature selection: Phenotypic and transcriptomic data of N-responses were generated from Arabidopsis (lab-grown) and maize (field-grown) under low- vs. high-N conditions. The expression levels of N-response differentially expressed genes (N-DEGs) conserved in both species were identified via ‘leave-out-one’ approach (FIG. 4) and used as gene features in the machine learning methods in Step 2. This biologically principled approach to reduce the feature dimensions ultimately improved the model performance (Table 1). Step 2 Feature importance: We ranked the genes based on i) the XGBoost-derived feature importance score (left) and ii) the TF connectivity in a GENIE3 regulatory network (right) constructed from the N-response TFs (Step 1) as regulators and the XGBoost important features as targets. Step 3 Feature validation: We validated the role of NUE for eight TFs in planta using Arabidopsis and maize loss-of-function mutants.

    [0009] FIGS. 2a-2c. Nitrogen is the leading factor explaining the NUE variation across Arabidopsis natural accessions. (2a) Boxplot of NUE among the Arabidopsis genotypes measured in three independent batches. The coefficients of variation demonstrate the broad range of phenotype of this panel of genotypes, which has been widely used in NUE studies. The X-axis is ordered in the increasing value of average NUE. In the box plots, the box represents the 25th to 75th percentile and the line within the box marks the median. Whiskers above and below the box indicate the 10th and 90th percentiles. Points above and below the whiskers indicate outliers outside 10th and 90th percentiles. (2b) The correlation of traits measured in this study. NUE at the pre-bolting stage is highly correlated with NUpE. Biomass, g/plant; N uptake, mg N/plant; N %, N uptake/Biomass; E %, 15N uptake/N uptake; NUE, Biomass/applied N; NUpE, 15N uptake/applied 15N; NUtE, Biomass/N uptake. (2c) The NUE variation is primarily explained by nitrogen levels, followed by accession and nitrogen by accession interaction. Two-way ANOVA P-value: G, <2E-16; N, <2E-16; Gx N, 9.93E-07. For each genotype n>10 biologically independent plants examined over three independent experiments.

    [0010] FIGS. 3a-3c. Genotype is the leading factor explaining the NUE variation in maize breeding lines. (3a) Boxplot of Total nitrogen utilization (NUtE) values among the maize genotype panel measured in three consecutive years. The X-axis is ordered by increasing value of average Total NUtE. The coefficients of variation demonstrate the broad range of phenotype of this smaller panel of maize genotypes, which spans the distribution of NutE values measured in a larger representative germplasm collection (FIG. 8). In the box plots, the box represents the 25th to 75th percentile and the line within the box marks the median. Whiskers above and below the box indicate the 10th and 90th percentiles. Points above and below the whiskers indicate outliers outside 10th and 90th percentiles. (3b) The correlation of traits measured in this study. (3c) The total NUtE variance of 2014, the year when the RNA samples were harvested, is primarily explained by Genotype (G), followed by N, and Gx N effect. Two-way ANOVA P-value: G, 8.6E-11; N, 2.9E-13; G×N, 2.28E-07. For each genotype n>5 biologically independent plants examined over three independent experiments.

    [0011] FIG. 4. Evolutionarily conserved N-response genes across Arabidopsis-maize used as a biologically principled feature reduction method for the XGboost machine learning pipeline. The RNA-seq reads from leaves of Arabidopsis and maize N-treated samples were aligned to reference genome assemblies using BBMap and the read counts were generated using featureCounts. The N-response DEGs (N-DEGs) were identified using generalized linear models in edgeR and leave-out-one method: one genotype (out of 18) was left out during each round of analysis and the intersection of 18 DEG lists was used for feature reduction (For details, see FIG. 10). The overlap of N-DEGs from Arabidopsis (n=2,123) with maize (n=6,914) resulted in a set of evolutionarily conserved N-response Arabidopsis genes (n=610) which were used as features in the machine learning model. The corresponding conserved N-response genes in maize were further intersected with genes responding to nitrogen by genotype effects (n=3,664), resulting in 248 maize genes that were used as features in the machine learning model to predict NUE.

    [0012] FIG. 5. Evolutionarily informed machine learning models uncover genes-of-importance and predictive of NUE. Step 1. The evolutionarily conserved N-DEGs between Arabidopsis and maize (see FIG. 4) and NUE data from n genotypes are split into training (n-1 genotypes) and test (left-out genotype) set (for details see FIG. 10). Step 2. The training set was used to optimize the XGBoost model, which then predicts the NUE using the gene expression in the test set. Step 3. The model performance was evaluated by calculating the Pearson's correlation coefficient r between the predicted and actual NUE values. In Arabidopsis, the dots indicate the Pearson's r of 100 individual iterations and the pointranges indicate mean+/−SD. In maize, there are only two data points for each genotype thus the Pearson's r was calculated from the pooled predicted and actual NUE from 100 iteration. Step 4. The TF features were ranked based on their contribution to the NUE. Certain of the genes are functionally validated in this disclosure.

    [0013] FIGS. 6a-6c. Experimental validation of candidate TFs in NUE using loss-of-function mutants for Arabidopsis (lab) and maize (field). (6a) The Arabidopsis T-DNA mutants (Methods) in group I genes displayed higher NUE compared to wild-type under N-replete (yellow, 10 mM KNO.sub.3) and N-deplete (grey, 2 mM KNO.sub.3) conditions. This suggests their non-redundant role(s) in regulating NUE regardless of the environmental N levels. (6b) The Arabidopsis mutants in group II genes displayed higher NUE specifically under N-deplete conditions. This indicates that the group II genes are either only required under N-deplete conditions or are functionally redundant under N-replete conditions. The experiments were carried out three times with 10 or more plants per genotype per condition. (6c) Changes in NUE and component traits for the maize nfya3-1::Mu mutant compared to wild-type W22. Plants were grown in the field supplied additional N (150 kg N fertilizer/ha). Trait values are the average of five plants sampled from each of three replicate field plots, 15 plants per genotype (Methods). The higher total NUtE observed in the mutant was a combinatorial effect of lower stalk N (g/plant) (P=0.002), total N uptake (P=0.05) and higher grain biomass (P=0.1). The increased NUE phenotype was also observed in the Arabidopsis T-DNA mutant defective the homolog gene NF-YA6 (AT3G14020) (b). The pointrange indicates mean+/−SD. The P-value was calculated between WT and indicated mutant allele using one-sided t-test with unequal variance.

    [0014] FIG. 7. Distribution of nitrogen utilization values among U.S. Corn Belt inbred diversity and the genotypes chosen for transcriptome-based prediction of this trait.

    [0015] FIGS. 8a-8d. Schematic overviews of plant growth conditions and N-treatments.

    [0016] FIG. 9. In maize, total NUtE is an optimal measure of NUE, compared to grain NUtE, the latter of which is confounded by maturity.

    [0017] FIGS. 10a-10c. Comparison of XGBoost models created using a unified list of gene features (10a), or independent lists of gene features (10b). FIG. 10C provides a comparison of Arabidopsis and Mainze genotupes and correlation coeefieicents.

    [0018] FIGS. 11a-11b. XGBoost-based feature importance ranking is marginally correlated with the edgeR-based P-value ranking.

    [0019] FIGS. 12a-12b. The conserved N-DEGs can be used to predict multiple traits.

    [0020] FIGS. 13a-13c. The Arabidopsis gene feature importance ranking is trait specific.

    [0021] FIG. 14a-14c. The Arabidopsis gene feature importance ranking is trait specific.

    [0022] FIG. 15. Use case: the pipeline proposed in this study can be applied on a different data set.

    [0023] FIG. 16. Validation of candidate TFs in NUE using loss-of-function mutants in Arabidopsis.

    [0024] FIG. 17. Expression of target genes in plant loss-of-function mutants used in this study.

    DETAILED DESCRIPTION

    [0025] Every numerical range given throughout this specification includes its upper and lower values, as well as every narrower numerical range that falls within it, as if such narrower numerical ranges were all expressly written herein.

    [0026] As used in the specification and the appended claims, the singular forms “a” “and” and “the” include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from “about” one particular value, and/or to “about” another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by the use of the antecedent “about” it will be understood that the particular value forms another embodiment. The term “about” in relation to a numerical value is optional and means for example+/−10%.

    [0027] This disclosure includes every amino acid sequence described herein and all nucleotide sequences encoding the amino acid sequence. Polynucleotide and amino acid sequences having from 80-99% similarity, inclusive, and including and all numbers and ranges of numbers there between, with the sequences provided here are included in the invention. All of the amino acid sequences described herein can include amino acid substitutions, such as conservative substitutions, that do not adversely affect the function of the protein that comprises the amino acid sequences. The disclosure includes all polynucleotide and amino acid sequences described herein, and every polynucleotide sequence referred to herein includes its complementary DNA sequence, and also includes the RNA equivalents thereof to the extent an RNA sequence is not given. Any sequence referred to by a database entry is incorporated herein by reference as the sequence exists in the database as of the effective filing date of this application or patent, including but not limited to database entries that are signified by an alphanumeric indicator that starts with “Zm.”

    [0028] The disclosure includes all described methods of analyzing transcriptome data to predict a phenotype described herein, all machine learning approaches described herein that are used for analysis of gene expression changes using Nitrogen (N)-treatment that influences expression of N responsive genes (N-DEGs), and extensions of those approaches to different genes, their protein products, and interspecies comparisons of transcriptome analysis and predictions of the influence of transcription factors on any phenotype. In a non-limiting embodiment, the disclosure includes the process as depicted in FIG. 4 and its accompanying description, and extensions thereof to other types of plants, as well as non-plant organisms.

    [0029] In embodiments, based at least in part on the described analysis, the present disclosure provides compositions and methods for modifying plants and/or plant cells. The compositions and methods relate to altering expression of one or a combination of the TFs. Altering the expression can result in any change in the plant described herein. In embodiments, practicing a method of the disclosure results in an increase in N uptake, increased biomass, such as increased grain biomass, an increased harvest index, an increased Total nitrogen utilization (NUtE), an increased total Grain NUtE, or a combination thereof. Non-limiting demonstrations of these effects are summarized in FIG. 6, panel c, and its accompanying text. For instance, mutating Maize nyfa3-1 results in the described effects shown in FIG. 6. In this regard, Table 4 provides an analysis of select TFs, and includes analysis of nf-ya3 (also referred to herein as nyfa3-1) Ranksum scores. The ranksum, as described further below, is the sum of three rankings for each TF based on i) the number of TF-gene targets involved in the N-assimilation pathways, ii) the number of TF-gene targets comprising gene features predictive of N utilization (NUE), and iii) the number of TF-gene targets that are also transcription factors. Without intending to be bound by any particular theory, it is considered the ranksum value provides an indication of the importance of the described TFs in terms of N-assimilation pathways and NUE. As can be seen from Table 4, the ranksum of nf-ya3 (46) is similar to hb75 (41). Thus, based on the data presented in FIG. 6, the ranksum value for nf-ya3, and the positive changes in plant properties that are related to mutation of nf-ya3, it is expected that mutation of hb75 will have similar effects on plant N uptake, increased grain biomass, increased harvest index, increased NUt, and total Grain NUtE as observed for mutating nf-ya3. Thus, the disclosure, in one embodiment, provides for disrupting or inhibiting the expression of hb75, nf-ya3, or a combination thereof, in plant cells. In embodiments, the disclosure provides modified plant cells and plants, wherein the only genomic modification comprises modification of one or two of the described genes. In embodiments, modification of only one, or only two, of the describes genes is sufficient to produce the described improved properties, relative to the same properties in plants that do not comprise the same modifications.

    [0030] Notwithstanding the foregoing description, the TFs of the present disclosure include any TF that is referenced in the description (including tables) or in the figures. Overexpression and underexpression of any one or combination of the described genes is included in the disclosure. Overexpression of a particular gene can be accomplished by any method known in the art. For example, a plant cell may be transformed with a nucleic acid vector comprising the coding sequences of the desired gene operably linked to a promoter active in a plant cell such that the desired gene is expressed at levels higher than normal (i.e., levels found in a control/nontransgenic plant). The promoters can be constitutively active in all or some plant tissues or can be inducible. The under-expression of a desired gene can be accomplished by any method known in the art. For example, a gene may be knocked out, or mutated such that lower than normal levels of the gene product is produced in the transgenic cells or plant. For example, such mutations include frame-shift mutations or mutations resulting in a stop codon in the wild-type coding sequence, thus preventing expression of the gene product. Another exemplary mutation is the removal of the transcribed sequences from the plant genome, for example, by homologous recombination. Another method for under-expressing a gene is transgenically introducing an insertion or deletion into the transcribed sequence or an insertion or deletion upstream or downstream of the transcribed sequence such that expression of the gene product is decreased as compared to wild-type or appropriate control. Additionally, microRNA (native or artificial) can be used to target a particular encoding mRNA for degradation, thus reducing the level of the expressed gene product in the transgenic plant cell. Another method for underexpression of a gene of interest is using clustered regularly interspaced short palindromic repeats (CRISPR) gene inactivation. A variety of suitable CRISPR systems for use in plants can be used, and include but are not necessarily limited to Cas3, Cas9, and Cas13 based systems, all of which are known in the art and can be adapted for the described purposes, such as by using a suitable CRISPR enzyme and guide RNA to target the described gene(s) and/or their regulatory elements, such as promoters.

    [0031] The sequence of the protein encoded by maize nf-ya3 is:

    TABLE-US-00001 (SEQ ID NO: 1) MPVILREMEDHSVHPMSKSNHGSLSGNGYEMKHSGH KVCDRDSSSESDRSHQEASAASESSPNEHTSTQSDN DEDHGKDNQDTMKPVLSLGKEGSAFLAPKLHYSPSF ACIPYTSDAYYSAVGVLTGYPPHAIVHPQQNDTTNT PGMLPVEPAEEPIYVNAKQYHAILRRRQTRAKLEAQ NKMVKNRKPYLHESRHRHAMKRARGSGGRFLNTKQL QEQNQQYQASSGSLCSKIIANSIISQSGPTCTPSSG TAGASTAGQDRSCLPSVGFRPTTNFSDQGRGGLKLA VIGMQQRVSTIR

    [0032] The sequence of the protein encoded by maize hb75 is:

    TABLE-US-00002 (SEQ ID NO: 2) MMIPARHMPPTMIVRNGGAAYGSSSALSLGQPNLMD NQQLQFQQALQQQHLLLDQIPATTAESCDNTGRGGG GRGSDPLADEFESKSGSENVDGVSVDDQDDPNQRPS KKKRYHRHTLHQIQEMEA.

    [0033] Those skilled in the art will recognize how to identify and modify DNA sequences that encode the described proteins based on the genetic code.

    [0034] The described compositions and methods can be used for any type of plant, such as monocots, dicots, gymnosperms, or plant cells. The term “plant cell” as used herein refers to protoplasts, gamete producing cells, and includes cells which regenerate into whole plants. Plant cells include but are not necessarily limited to cells obtained from or found in: seeds, suspension cultures, embryos, meristematic regions, callus tissue, leaves, roots, shoots, gametophytes, sporophytes, pollen, and microspores. Plant cells can also be understood to include modified cells, such as protoplasts, obtained from the aforementioned tissues. In non-limiting embodiments, the method is used for any species of woody, ornamental, decorative, crop, cereal, fruit, or vegetable plant. The method can be used on intact plants, isolated plant parts, and plant cells. In embodiments, the method is used with a seed, a suspension culture, an embryo, a meristematic plant region, callus tissue, a leaf, a root, a shoot, a gametophyte, a sporophyte, pollen, a microspore, or a protoplast. In embodiments, the plant or plant cells that are modified according to the disclosure are any member of the following genera/group: Artemisia, Acorns, Aegilops, Allium, Amborella, Antirrhinum, Apium, Arabidopsis, Arachis, Beta, Betula, Brassica, Cannabis, Capsicum, Ceratopteris, Citrus, Coffea, Cryptomeria, Cycas, Descurainia, Eschscholzia, Eucalyptus, Glycine, Gossypium, Hedyotis, Helianthus, Hordeum, Ipomoea, Lactuca, Linum, Liriodendron, Lotus, Oryza, Lupinus, Lycopersicon, Medicago, Mesembryanthemum, Nicotiana, Nuphar, Pennisetum, Persea, Phaseolus, Physcomitrella, Picea, Pinus, Poncirus, Populus, Prunus, Robinia, Rosa, Saccharum, Schedonorus, Secale, Sesamum, Solanum, Sorghum, Stevia, Thellungiella, Theobroma, Triphysaria, Triticum, Vitis, Zea, or Zinnia. In non-limiting embodiments, the modified plant or plant cells are from one or more so-called “elite” varieties of maize. The disclosure includes seeds produced by any modified plant herein, and progeny of the plants and seeds. Articles of manufacture comprising the seeds and a container that contains the seeds are also provided. In embodiments, the articles of manufacture comprise kits.

    [0035] The following Examples are intended but not limit the disclosure.

    Example 1

    [0036] We analyzed whether the prediction power of machine learning models could be enhanced by exploiting the genetic diversity of gene responses and phenotypes both within and across species. In non-limiting embodiments, we tested whether using N-DEGs conserved both within and across species as a biologically-principled means of dimension reduction, could enhance identification of genes of importance to predicting NUE phenotypes from gene expression data across a model (Arabidopsis) and crop (maize) plant. This model-to-crop machine learning approach enables more rapidly validation of conserved features of importance to NUE in the crop using the model species.

    [0037] Within each species, we selected a set of genotypes that exhibit a broad spectrum of phenotypic variation in NUE. The data included 18 Arabidopsis accessions that were previously identified for their NUE diversity.sup.8 which originated from a nested collection of 265 accessions found in a wide range of habitats differing notably in soil nutrient richness.sup.9. The 23 maize genotypes analyzed in this disclosure correspond to 12 maize inbred lines and their 11 corresponding hybrids with B73. We selected these 12 maize inbred lines to represent the phenotypic diversity for NUE traits that we measured among a population of 318 field-grown maize inbreds (FIG. 7), which broadly represent the current germplasm base for U.S. Corn Belt hybrids. This maize population that we tested for NUE traits includes the parents of the Nested Association Mapping (NAM) population.sup.1, improved inbreds from different breeding programs described in recently expired plant variety patents.sup.10, and the Illinois Protein Strains that display the known phenotypic extremes for NUE traits in maize.sup.23. The B73 inbred maize line was chosen as the parent for the hybrids, because it is a major founder of the Stiff-Stalk heterotic group used in the production of nearly all commercial U.S. Corn Belt hybrids.sup.11. Furthermore, B73 displays high nitrogen utilization efficiency (NUE), and also serves as the reference genome sequence assembly for maize.sup.12.

    [0038] To test whether genome-wide responses to N-treatments evolutionarily conserved across the model and crop could be a biologically principled approach to enhance the model performance of predicting NUE, we constructed a three-step machine learning pipeline (FIG. 1). (Step I) Feature selection: First, we collected and analyzed matched phenotypic and transcriptomic data from the same replicate plants for each N-treatment conducted in a controlled laboratory setting (Arabidopsis) or field conditions (maize) and (FIG. 8). Using linear models, we identified N-response differentially expressed genes (N-DEGs) in parallel for maize and Arabidopsis, and retained the N-DEGs conserved both within and across species as gene features used in machine learning. (Step II) Feature importance: We selectively used the expression levels of these evolutionarily conserved N-DEGs as a biologically-principled approach to feature reduction in the gradient boosting-based method XGBoost.sup.13 predictive models. The outcome of the machine learning enabled ranking the N-DEGs whose expression levels best predicted the NUE traits measured in the same set of plants. Moreover, we identified the transcription factors (TF) regulating these genes of importance to NUE and measured their connectivity in the NUE network by constructing a NUE gene regulatory network (GRN) using a Random Forest-based method GENIE3.sup.14. Through integration of the results of these complementary means, we generated ranked lists of: i) gene features based on their contribution to the trait prediction (XGBoost-based importance score), and ii) TFs based on their level of connectivity in the GRN for each species (GENIE3-based connectivity). (Step III) Feature validation: we validated the function of eight candidate TFs in Arabidopsis or maize based on their importance score to the NUE trait and/or their degree of connectivity in the GRN. We experimentally confirmed the function of these eight TFs in regulation of NUE in planta using loss-of-function mutants in Arabidopsis, as well as in maize, where available.

    Example 2

    Quantifying NUE Phenotypes Across Arabidopsis and Maize Varieties

    [0039] In the described phenotypic analysis, we quantified nitrogen use efficiency (NUE) as the efficiency of converting supplied N to biomass/grain yield. For Arabidopsis, NUE was calculated as the efficiency with which each plant converted supplied N into shoot biomass (NUE=Above ground dry weight/Applied N). This measure of NUE is achieved by providing each plant with a trackable/contained amount of N in pots in a lab setting, as a proxy for the field agricultural setting.sup.2. Indeed, we found the Arabidopsis accessions previously selected for NUE diversity.sup.8 present a broad range of NUE variation in our own experiments, as evidenced by the coefficient of variation (CV=0.58) (FIG. 2a). The correlation of traits shows that NUE at the pre-bolting stage is highly correlated with NUpE (r=0.88), and to a lesser extent with NUtE (r=0.39) (FIG. 2b). The NUE variation among the Arabidopsis accessions is primarily explained by nitrogen levels, followed by accession and nitrogen-by-accession interaction (Two-way ANOVA P-value: G, <2E-16; N, <2E-16; G×N, 9.93E-07). This indicates the N-level explains the phenotypic variation in NUE in this collection of Arabidopsis ecotypes.

    [0040] For field-grown maize, we used Total NUtE, (stover biomass+grain biomass)/(stover N content +grain N content), as the target trait (FIG. 3a). We chose this because Total NUtE is more robust to the effects of maturity and photoperiod in the field.sup.15 (FIG. 9), and remains highly correlated to grain NUtE (FIG. 3b). We measured total NUtE across 318 maize inbred lines in a field experiment where soil N supply was not limiting, and observed a nearly three-fold range in total NUtE (56-156 kg biomass/g plant N) (FIG. 7). To illustrate the influence of soil N-supply on total NUtE, 25 inbred maize lines chosen to represent both historical (NAM parents).sup.1 and elite genetic diversity.sup.10 were grown in adjacent plots that received either no N fertilizer or were N-fertilized as the larger population. When grown with sufficient N, the distribution of NUtE values for these 25 maize inbreds overlaps with that observed from the larger population of 318 maize genotypes (FIG. 8). In this disclosure, we selected 12 (from the 25 above) maize inbreds, which exhibited a similar coefficient of variation for NUtE phenotypic values (CV=0.19) as the larger population of 318 genotypes (CV=0.15) for matched transcriptome profiling and detailed phenotyping in N-responsive field plots, over three field seasons.

    [0041] ANOVA results revealed that 55% of the total NUtE variation in this maize experiment was attributed to genetic effects (FIG. 3c). Our two-way ANOVA analysis of the maize data shows that in addition to G (P-value=8.6E-11) and N (P-value=2.9E-13), G×N was also a significant factor (P-value=2.28E-07) explaining 19% of the variation in Total NUtE (FIG. 3c). This is distinct from our findings for Arabidopsis, where N is the main explanatory variable (FIG. 2c). This difference likely reflects not only the overall greater genetic diversity in the maize varieties, but also suggests that intensive breeding and selection for N-responsive grain yields in maize.sup.16 may have expanded the phenotypic variation for NUE beyond that observed among the Arabidopsis natural accessions. We therefore included these interactions of maize genotype with nitrogen supply on the NUE phenotype as a factor in our computational pipeline described below.

    Example 3

    [0042] Evolutionarily conserved transcriptome response to N-treatment used for feature reduction in machine learning

    [0043] Feature reduction is an essential pre-processing step in machine learning, as too many irrelevant features may interfere with prediction performance.sup.3. Given the fact that the N level is a significant factor explaining NUE variation in both Arabidopsis and maize (FIGS. 2c and 3c), we used negative binomial Generalized Linear Mixed models (GLMs) in edgeR R-package.sup.17 and identified N-DEGs (Gene expression˜Condition+Genotype) in the training data (n-1 genotype). Importantly, we note that the testing data sets (the held-out genotype) were never used to select the N-DEGs. This was repeated in a round-robin manner across genotypes for each species (FIG. 10). Next, we retained the evolutionarily conserved N-DEGs by mapping the Arabidopsis N-DEGs to their corresponding maize homologs using Phytozome 10.sup.18 (FIG. 4). This cross-species analysis enabled us to i) apply an evolutionarily guided filter to reduce the dimensionality of gene features used in machine learning, and ii) enhance our ability to perform rapid validation testing of candidate NUE genes with relevance to the crop in the model species.

    [0044] The resulting conserved N-DEGs from Arabidopsis (n=610) were used as gene features in the machine learning model (FIG. 5). We further subjected the conserved N-DEGs from maize to a second round of filtering to identify those also responding to N×G interaction (FIG. 4, Within-species Feature Reduction). This second filter aimed to account for the significant N×G effect that we observed in the maize NUE phenotypes (FIG. 3c), resulted in a list of maize N-DEGs responsive to N×G interaction (n=248). Next, these two sets of conserved N-DEGs from Arabidopsis and maize were used as features in the machine learning model (FIG. 5).

    [0045] We then analyzed whether the expression levels of N-DEGs conserved across model and crop species could enhance identification of NUE phenotypes—compared to non-selected genes—using machine learning algorithms. This data-driven hypothesis is supported by the fact that: i) the expression levels of N-DEGs have been used as biomarkers of N status across maize genotypes.sup.19, and ii) the described phenotypic data shows that N level is a significant factor explaining the NUE variation in both maize and Arabidopsis (FIGS. 2c and 3c). Indeed, this analysis enabled determining that the predictive performance of the described models is significantly better at predicting NUE outcomes when the evolutionarily conserved N-DEGs are used, compared to the same number of top-ranked N-DEGs with the lowest P-value, or randomly selected expressed genes (Table 1), as detailed below.

    Example 4

    [0046] Evolutionarily Conserved N-Responsive Genes have Enhanced Predictive Power in Machine Learning

    [0047] For each species, we used the gene expression values (N-DEGs) as features (also referred to as gene features) to predict NUE traits through XGBoost regression models. XGBoost.sup.13 is a implementation of the gradient boosting algorithm.sup.20, that uses a boosting algorithm to combine multiple weak learners, i.e. shallow trees, into a strong one (FIG. 5, Step 2). Lastly, we used the trained XGBoost models to predict NUE for the left-out genotype and evaluated the model performance using correlation between the observed- and the predicted-NUE in the left-out test set (FIG. 5, Step 3). In summary, we repeated the above steps and constructed 18 models for Arabidopsis, and 16 models for maize, corresponding to each genotype analyzed (See FIG. 10 for an illustration).

    [0048] For maize, using the N-DEGs (n=248) conserved with their Arabidopsis homologs, resulted in a mean Pearson's correlation coefficient r of 0.79 for the XGBoost models predicting NUE across 16 maize lines (FIG. 5, Step 3). The r was above 0.6 for all but two maize genotypes, Illinois High Protein (IHP1) and Illinois Low Protein (ILP1). These two maize inbred line are derived from more than 100 cycles of divergent selection for seed protein concentration and other component traits of nitrogen use efficiency.sup.21,22. The models showed lower accuracy in predicting the NUE phenotypes of IHP1 and ILP1, compared to other maize inbreds and the hybrids that each share the B73 parent.

    [0049] The described analysis showed that the overall predictive performance of learned models that used the evolutionarily conserved maize N-DEGs is significantly better than that obtained using the same number of top-ranked N-DEGs with the lowest P-value (0.68, Mann-Whitney U test P-value=1.06E-3), or ones randomly selected from total expressed genes (0.62, Mann-Whitney U test, P-value=1.5E-5) (Table 1). In addition, comparison of the feature importance score, an XGBoost.sup.13 output which reveals the influence of each feature (gene) in the predicted value (NUE).sup.13, with the P-value in DEG analysis, uncovered only a weak correlation (Spearman's rank correlation coefficient rho=0.19, FIG. 11b). These comparisons support the interpretation that XGBoost models capture non-linear gene-trait relationships and our hypothesis that evolutionarily conserved N-DEGs enhance the machine learning outcome.

    [0050] In parallel, we used the Arabidopsis N-DEGs (n=610) whose N-response is conserved with their maize homologs, as the features to predict NUE in the same XGBoost machine learning pipeline (FIG. 5). Our machine learning results show that the mean Pearson's correlation coefficient r across all 18 Arabidopsis genotypes was 0.65 (FIG. 5, Step 3). Moreover, we found that this overall model performance is significantly better than that obtained using the same number of top-ranked N-DEGs with the lowest P-value (r=0.59, Mann-Whitney U test P-value=1.64E-4), or ones randomly selected from total expressed genes (r=0.53, Mann-Whitney U test, P-value=3.82E-6) (Table 1). Similarly, we found that the feature importance ranking was weakly correlated with the edgeR-based P-value ranking of DEGs (Spearman's rank correlation coefficient rho=0.14, FIG. 11a).

    [0051] The described results from both maize and Arabidopsis data show that using the evolutionarily conserved N-responsive differentially expressed genes significantly improved performance of the machine learning models predicting NUE significantly, and that this improvement is not due to a simple numerical reduction in the gene features (Table 1). Furthermore, the weak correlation between the XGBoost-based feature importance ranking and the edgeR-based P-value ranking (FIG. 11), indicates that XGBoost can capture non-linear gene-trait relationship beyond single variable DEG analysis. We used one set of hyperparameters for each species to achieve a consistent performance across genotypes, suggesting that the model is generalized and likely applicable to additional genotypes. Taken together, the results demonstrate that NUE—a polygenic trait—could be predicted from gene expression levels of N-DEGs, and that using an evolutionarily principled approach to feature reduction significantly improved the model performance.

    Example 5

    Predicting Additional Traits Demonstrates the General Applicability of the Evolutionarily Informed Machine Learning Pipeline

    [0052] To further test whether our pipeline can be applied to predict additional traits from transcriptome data, we used the same conserved N-DEGs (FIG. 4), to predict two additional traits for each species. For Arabidopsis, we found that the mean Pearson's r for predicting biomass and N-uptake was 0.68 and 0.69, respectively (FIG. 12a), is comparable to that for predicting NUE (r=0.65). The feature importance ranking appeared to be trait-specific, as the gene ranking for NUE only weakly correlated with those for biomass (rho=0.09) and N-uptake (rho=0.08) (FIG. 13b, 12c). This result can be explained by the weak correlation between NUE and biomass (r=0.14), as well as that between NUE and N-uptake (r=0.01) (FIG. 2b). For highly correlated traits such as biomass and N-uptake (r=0.97), the feature importance rankings were also highly correlated (rho=0.94) (FIG. 13a). For maize, the mean Pearson's r for predicting biomass and grain yield was 0.72 and 0.52, respectively (FIG. 12b). As with Arabidopsis, the feature importance rankings for maize also appeared to be trait-specific, being greater (rho=0.59) for highly correlated traits such as biomass and grain yield (r=0.8), compared to Total NUtE—which is weakly correlated with either biomass (r=−0.14; rho=0.15) or grain yield (r=−0.19; rho=0.33) (FIG. 3b, FIG. 14). Taken together, these results indicate that the feature importance ranking can capture biological information represented by the degree of phenotypic correlation among different component traits.

    [0053] We also applied the described evolutionarily informed machine learning pipeline to two additional matched transcriptome and phenotype datasets related to drought in field grown rice and disease response in mouse models.

    [0054] The rice data comprises matched transcriptomic and phenotypic information collected from 220 rice genotypes subjected to drought treatment in field experiments.sup.23. The 220 rice genotypes consist of two major subspecies, Indica and Japonica, which diverged ˜440,000 years ago, with the genotypic and phenotypic diversity of domesticated rice. From this large dataset, we retained 57 rice genotypes that had no missing data in the trait measurement. We then used this set of 57 rice genotypes, and randomly selected 20 genotypes to define drought-responsive DEGs and used them as gene features for predicting the fecundity in the 37 “left-out” rice genotypes. We repeated this process 10-times and the mean Pearson's r was 0.62. The model performance was consistent across the evolutionarily distant Japonica and Indica rice sub-species (FIG. 15), and better than using the same number of random expressed genes (Mann-Whitney U test, P-value <2.2e-16).

    [0055] The mouse dataset comes from a highly genetically diverse Collaborative Cross (CC) population that comprises 90% of the genetic diversity across the entire laboratory Mus musculus genome.sup.24. The dataset we selected comprises matched transcriptome and disease outcome after influenza virus infection of 11 genotypes from the CC mouse population study.sup.24. We used DEGs (mock vs. infected) identified across the 11 mouse CC population genotypes to predict the disease outcome (asymptomatic vs. symptomatic) and found the mean Pearson's r to be 0.98. The models built using cross-genotype DEGs outperformed the model using the same number of random expressed genes (Mann-Whitney U test, P-value=3.3E-3).

    [0056] Overall, the results for the matched transcriptome and phenotype datasets for the rice and mice models provide two use-case studies of evolutionarily informed machine learning pipeline applied to external data sets for traits in both plants and animals. They also show that transcript-based prediction can be achieved using a smaller population (20 and 11 genotypes in the case of rice and mice respectively), compared with the requirement of hundreds of lines which are needed for GWAS and eQTL studies.sup.25.

    Example 6

    Validating the Function of Genes Whose Expression is Influential in Models Predicting NUE

    [0057] The Examples above established the robustness of the evolutionarily informed machine learning models in predicting trait outcomes based on conserved gene responses within and across species. Next, we experimentally validated gene features that are most influential in our predictive models. To this end, we used the feature importance score, an XGBoost.sup.13 output which reveals the influence of each feature (gene) in the predicted value (NUE). We reasoned that if models built for multiple genotypes selected a common set of gene features, this would indicate that those gene features are robust to genotype in predicting NUE. In maize, over 81% (202/248) of the XGBoost “important gene features” for predicting NUE were shared by models built for 16 genotypes, and 91% (245/248) were shared by 10 or more maize genotypes. Similarly, for Arabidopsis 42% (257/610) of the “important features” for predicting NUE were shared by models built for 18 Arabidopsis accessions, and 85% (519/610) were shared by 10 or more Arabidopsis accessions. These results are not only consistent with the polygenic nature of NUE trait, but also reveal that there is a core set of influential N-DEGs whose expression levels can accurately predict NUE phenotypes for both species.

    [0058] In maize, the top-ranked “important gene features” in predicting NUE outcomes include the transcription factors (NLP, MYB, WRKY), members of N-uptake/assimilation pathway (ammonium transporter, asparagine synthetase), and genes involved in photosynthesis and amino acid metabolism (FIG. 5, Step 4,). In Arabidopsis, the top-ranked “important gene features” in predicting NUE include transcription factors (NF-Y, NLP, MYB), members of the N-uptake/assimilation pathway (nitrate transporter, asparagine synthetase, glutamine synthetase), tubulins, and chlorophyll a-b binding proteins (FIG. 5, Step 4). Several of the important features including the transcription factors (NLPs, LBD37/LBD38) and genes involved in N-metabolism (glutamine and asparagine synthetase) have been implied or directly linked to affect NUE in planta.sup.19,26-29. This consistency of our machine learning predictions of genes of “importance” to NUE with published results in planta not only validates the findings from the described machine learning pipeline, but also indicates the novel genes uncovered in this pipeline can shed light on additional previously unknown molecular components and mechanisms underlying NUE.

    [0059] Further, we reasoned TFs controlling the levels of expression of multiple XGBoost important features for predicting NUE would be candidates for functional validation for their role in NUE in planta. To this end, we identified TFs predicted to regulate these XGBoost gene features of importance to NUE by constructing gene regulatory networks (GRNs) using GENIE3, which adopts the random forest machine learning algorithm and was the best performer in the DREAM4 and −5 Network Inference Challenge.sup.14.

    [0060] To construct GRNs controlling NUE for each species, we first identified the N-responsive TFs in maize (545 TFs) and Arabidopsis (184 TFs) by intersecting the N-DEGs in this disclosure with the TFs for each species using published databases.sup.30-32. Next, we used our N-response TFs in GENIE3 as the “regulatory genes” (GENIE3 term) whose influence on the evolutionarily conserved “target genes” in maize (248 gene features) or Arabidopsis (610 gene features) were weighed on a 0 to 1 scale, where 0=non-influential and 1=strongly influential. We kept the top 1% of the TF-target edges to construct the NUE regulatory network and calculated the number of TF-target edges (connectivity) for each TF as a measure to evaluate their influence within the GRN.

    [0061] Next, we integrated our GRN analysis with the XGBoost results to select candidate TFs that regulate genes of importance to NUE phenotype for functional validation of their role in NUE (Table 2). The selection and prioritization of TFs was based on one or more of the following criteria: i) XGBoost-based importance score, ii) GENIE3-based TF connectivity in the NUE GRN, iii) curated knowledge from the literature, and iv) the availability of multiple mutant alleles. In Arabidopsis, the top TFs in the XGBoost-based importance ranking listed in Table 2 include NF-YA6 (AT3G14020), D1V1 (AT5G58900), UNE12 (AT4G02590), NLP5 (AT1G76350), and TCP2 (AT4G18390). The other two Arabidopsis TFs prioritized for in planta validation studies WRKY38 (AT5G22570) and WRKY50 (AT5G26170) (Table 2), were selected based on their high connectivity in the GENIE3-based GRN. For maize, we selected two candidate TFs (Zm00001d006293 nlp17, Zm00001d012544 myb74) for in planta validation studies that are hubs in the GENIE3-based GRN. Since no maize mutants were available for these genes, we took advantage of our cross-species approach by validating the function of their Arabidopsis homologs (AT1G76350 NLP5, AT5G06100 MY833) in NUE. With the goal of cross-species validation, we also selected the maize homolog (Zm00001d006835, nfya3) of the top-ranked Arabidopsis NF-YA6 (AT3G14020) for validation in NUE (Table 2). This choice took into consideration the fact that NF-Y transcription factors are enriched in Arabidopsis XGBoost gene features and in the maize GRN. Moreover, this selection was supported by previous studies which showed that overexpressing a member of the NF-YA family in wheat significantly increased N uptake and grain yield under different levels of N supply.sup.33. To discern the function of maize NF-Y homologs in NUE, we characterized the nfya3-1::UfMu mutation with a Uniform Mu transposon insertion (mu1003041).sup.34 that does not produce a detectable full-length transcript.

    [0062] Our results on the eight Arabidopsis TFs selected for in planta validation studies were classified into two groups based on our NUE phenotypic results (FIG. 6). The Group I “important gene features” in predicting NUE in Arabidopsis include MY833 (AT5G06100) and TCP2 (AT4G18390), which when mutated showed increased NUE phenotypes under both high- and low-N inputs (FIG. 6a). These validation results reveal that each TF plays a non-redundant role as negative regulators of NUE, as the loss-of-function T-DNA mutants displayed higher NUE under both N-deplete and N-replete conditions. The Group II “important gene features” in Arabidopsis include 6 TFs which when mutated show increased NUE phenotypes specifically under low-N input: UNE12 (AT4G02590), NLP5 (AT1G76350), NF-YA6 (AT3G14020), WRKY38 (AT5G22570), WRKY50 (AT5G26170), and D1V1 (AT5G58900) (FIG. 6b). These validation results reveal that each of these Class II TFs plays a non-redundant role as negative regulators of NUE, as the loss-of-function T-DNA mutants displayed higher NUE, specifically under N-deplete conditions (FIG. 6b, FIG. 16), suggesting that the function of these TFs in regulating NUE is only required when N is limiting. Alternatively, their function may be redundant with other TFs under N-replete conditions. For maize, the NNUE tests of the nfya3-1::UfMu mutant in the field showed that they accumulated less stalk and total N compared to wild-type, yet grain biomass and all other traits dependent on grain biomass (grain yield, harvest index, NUtE) increased when grown with sufficient N (FIG. 6c). These results show that loss of maize NFYA3 influences how developing seeds sense and respond to plant N status, with the mutation reducing the N requirement to promote grain, thereby enhancing the NUtE. Observing phenotypes in the grain is also consistent with the expression pattern of NFYA3, which is strongest in developing seeds.sup.35. No significant differences were observed for NUE traits compared to wild-type maize (W22) when grown under N-limiting conditions, except for slightly lower grain yield and higher grain N concentration.

    [0063] Taken together, the described evolutionarily informed machine learning predictions of genes of importance to NUE and validation results for TF mutants for both Arabidopsis and maize demonstrate that: i) Using evolutionarily conserved gene response significantly enhances the ability of the XGBoost machine learning models to predict NUE outcome across genotypes and species (plants and animals), and ii) The XGBoost-based important scores and GENIE3-based connectivity are informative in selecting functionally important features—including TFs—to control of a complex physiological trait in crops— NUE—which has important implications for sustainable agriculture.

    [0064] It will be recognized from the foregoing Examples that the disclosure described a new genome-to-phenome analysis—namely, predicting phenotypic outcomes from genome-wide expression data. We show that exploiting evolutionary conserved gene expression datasets—within and across species—enhanced the machine learning model performance in predicting NUE phenotypes in a model (Arabidopsis) and a crop (maize), and also as applied to published matched transcriptome/phenotype datasets from another crop (rice) and model animal (mouse).

    [0065] Our evolutionarily informed three-step machine learning pipeline (FIG. 1) which integrates phenotypic traits, transcriptome profiles, genetic variation, and environmental responses allowed us to; 1) preselect a subset of transcripts based on an evolutionarily conserved transcriptome responses within and across species, 2) employ this conservation as a biologically-principled way to reduce the feature dimensionality to improve the machine learning mmodel performance, and 3) rapidly validate the function of ‘important gene features’ identified from XGBoost models and GENIE3 gene regulatory network via the inclusion of a model and crop species.

    [0066] The implementation of machine learning in predicting phenotypes has advanced in the past few years. However, the available datasets do not always; 1) exploit the genetic diversity of the organism(s) and 2) measure the phenotypes using same samples from which the transcriptome response was captured. The present disclosure advances the field in both points, as we utilized a panel of genotypes with diverse genetic backgrounds and measured phenotypes from the same batch of plants that the transcriptome was captured. We integrated genetic diversity, machine learning, and cross-species approaches to identify genes of importance to an agronomically important trait, NUE. The trait we selected for study on NUE has the challenge of its underlying polygenic nature and the difficulty in collecting high quality phenotypic data.sup.36. To this end, we designed a sufficiently large experimental space of N-treatments across a set to ˜20 genotypes spanning NUE phenotypes in a model and crop species. The described results represent the largest matched phenotypic and transcriptomic datasets from both a model and a crop species. This dataset includes a large NUE phenotypic dataset resource of 318 maize genotypes for the plant community, and for 18 Arabidopsis accessions. We analyzed the genetic diversity in 18 Arabidopsis accessions and 23 maize genotypes selected for broad phenotypic variation in NUE and scored them for both transcriptomic and physiological responses in the same samples. Importantly, the selected maize genotypes represent the range of NUE diversity observed among a comprehensive collection of germplasm adapted to the U.S. Corn Belt, as confirmed empirically (FIG. 8).

    [0067] To extend this analysis beyond NUE, we applied our evolutionarily informed machine learning approach to other agricultural traits (e.g. drought resistance) in another major crop, using published transcriptome and phenotype datasets of genetically diverse rice subspecies (Indica and Japonica).sup.23. In our application to animals, we exploited the growing awareness that host genetic variation has a major impact on pathogen susceptibility. To this end, we used matched transcriptome and phenotype data from a highly genetically diverse Collaborative Cross (CC) population that comprises 90% of the genetic diversity across the entire laboratory Mus musculus genome.sup.24. Models that we built using cross-genotype DEGs from both these studies of these genetically diverse lines in plants (rice) and animals (mice) lines, significantly outperformed the model using the same number of random expressed genes. Importantly, in these two additional case studies, and in our proof-of-principle example, our evolutionary informed analysis of matched transcriptome and phenome data allowed us to use a considerably smaller sample size compared to those needed for GWAS or eQTL studies.sup.25.

    [0068] By providing accurate prediction, the predictive models reveal novel gene features for further investigation of causality.sup.37. We demonstrate this principle using a reverse genetics approach to validate the function of eight transcription factors important to predicting NUE outcomes (Table 2). Notably, our two-way cross-species validation strategy enabled us to verify the function of genes involved in NUE for i) two maize candidate genes using mutants in their Arabidopsis homologs and ii) one Arabidopsis candidate TF via analysis of a mutant in its maize homolog grown in the field (Table 2, FIG. 6).

    [0069] The learned model performance is more robust to maize genotype, compared with the models learned in Arabidopsis (FIG. 5). This outcome was obtained even though the maize genotypes used in the Examples possess greater genetic diversity of NUE (FIG. 3c). Many factors may contribute to this difference. For instance, the maize gene features were applied to forecast NUE traits measured at later development stages (FIG. 7). By contrast, the Arabidopsis gene features were applied to predict the NUE traits measured at the same time as RNA samples (FIG. 7).

    [0070] The disclosure reveals that genes affecting NUE are involved in an array of processes (Table 2), including nutrient response and uptake (DIV1.sup.40 and NLP5.sup.19,41), anther and pollen development (NF-YA6.sup.42 and MYB33.sup.43), juvenile-to-adult transition (MYB33.sup.44), microRNA-mediated growth and responses (NF-YA.sup.45, MYB33.sup.44, TCP2.sup.46), immune response (NF-YA6.sup.42, UNE12.sup.47, WRKY38.sup.48, and WRKY50.sup.49), and photomorphogenesis (TCP2.sup.50 and Zm00001d006835.sup.51). These results not only provide additional evidence supporting the notion that NUE is a polygenic trait and intertwined with diverse signaling pathways, but further reveal a novel role of these genes in regulating NUE. Notably, there are three transcription factor families, NF-Y, NLP, and WRKY, whose members are enriched as the gene features of XGBoost models and/or the regulators of GENIE3-based GRN.

    [0071] Our results identified nine Arabidopsis and one maize NF-Y genes as the features in XGBoost models, as well as 12 Arabidopsis and 14 maize NF-Y genes, as potential regulators in the GENIE3 NUE GRN. Moreover, we validated the function of NF-YA6 in NUE—a top gene in Arabidopsis XGBoost model —using mutants in Arabidopsis NF-YA6 (AT3G14020), as well as its maize homolog nfya3 (FIG. 6) and expect similar results by inhibiting expression of hb7. The NF-Y family, found in nearly all eukaryotes.sup.52, encodes components of an evolutionarily conserved trimeric transcription factor complex. In humans, NF-Y binds to the CCAAT box in promoters of large sets of genes overexpressed in breast, colon, thyroid, and prostate cancer.sup.53. In plants, the regulatory roles of NF-Y have been revealed in flowering-time, early seed development, nodulation, hormone signaling, and stress responses.sup.52. NF-Ys function as a multimeric protein complex (NF-YA/B/C(-CO/bZIP/bHLH) to bind its canonical motif CCAAT and/or the motif(s) of its partner TFs.sup.54. It is possible that the flexible cis-binding capacity makes NF-Ys versatile and context-dependent TFs that can quickly adapt to nutrient fluctuations. It is noteworthy that several NF-Y genes are targeted and down-regulated by miR169.sup.55 and miR169 members respond transcriptionally to N-starvation.sup.56. Thus, the disclosure supports a new link between N-signaling, miRNA changes in N-responsive of NF-Ys, to the phenotypic output of NUE: Nitrogen.fwdarw.miR169.fwdarw.NF-Y.fwdarw.NUE.

    [0072] We identified six Arabidopsis and two maize NLP genes as the features in XGBoost models to predict NUE, as well as five Arabidopsis and 14 NLP genes as potential regulators in the GENIE3 NUE GRN. Further, using mutants, we validated the role of NLP5—a top gene feature in maize XGBoost model and maize NUE GRN—as a negative regulator of NUE specifically under low-N conditions (FIG. 6b, FIG. 15). The NLPs—which are plant-specific TFs—are related to a core symbiotic gene Nin.sup.57 and later identified as master regulators of nitrate signaling in Arabidopsis.sup.26. Emerging evidence suggests their contribution to N-regulated gene expression and developmental processes is common across plant species.sup.58. The results from our functional validation experiment indicated that NLP5 is a negative regulator of NUE under N-depleted conditions (FIG. 6B), which can be explained by the fact that NLP5 is a target of NIGT1/HRS1, a master regulator of N-starvation response genes.sup.59,60. Thus, the loss of NLP5 in the Arabidopsis mutants could de-repress the N-starvation response, leading to higher NUE.

    [0073] We identified six Arabidopsis and six maize WRKY genes as the features in XGBoost models, as well as 24 Arabidopsis and 11 WRKYgenes as the regulators in GENIE3 NUE GRN. Among them, WRKY38 and WRKY50 are the top-ranked TF hubs in the Arabidopsis NUE GRN. Our functional analysis using Arabidopsis mutants validated a role of WRKY38 and WRKY50 in mediating NUE (FIG. 6B). WRKY5, occurring primarily in plants.sup.61, are among the largest families of transcription factors. Cumulative evidence has demonstrated the important biological functions of WRKY5 in plant developmental processes (embryogenesis, germination, senescence etc.) as well as response to biotic and abiotic stresses including defense, salt, drought, nutrient starvation and more.sup.62. In addition to their known functions in defense responses.sup.48,49, our results add a novel aspect to WRKY38 and WRK50 in regulating NUE and make them candidate TF hubs in coordinating plant responses to N levels as well as biotic stress.

    [0074] The disclosure demonstrates that the integration of genetic diversity, cross-species transcriptome analysis and machine learning method enhances predictive modeling of genes affecting NUE. The results from reverse genetic analysis further show that those genes predictive of NUE are not only biomarkers but are functionally important in determining plant performance in response to environmental nutrition. The pipeline described herein could complement current approaches in identifying important genes in a multigenic trait. Our validation of the evolutionarily informed strategy for feature reduction across both genetically diverse crop and animal datasets, supports its potential to inform any system that seeks to uncover important genes controlling a complex phenotype in biology, agriculture, or medicine.

    Example 7

    [0075] This Example describes the materials and methods used to produce the described results.

    Plant Materials, Growth Conditions, and Phenotypic Assays

    Arabidopsis

    [0076] All Arabidopsis seeds used in this disclosure were obtained from ABRC. The 18 Arabidopsis accessions are Akita, B1-1, Bur-0, Col-0, Ct-1, Edi-0, Ge-0, Kn-0, Mh-1, Mr-0, Mt-0, N13, Oy-0, Sakata, Shandara, St-0, Stw-0, and Tsu-0, as previously studied for NUE.sup.8. The T-DNA mutants are all in the Col-0 background. The mutant lines.sup.63 are myb33-1 (SALK_056201), myb33-2 (SALK_065473), tcp2-2 (SALK_060818), une12-1 (SAILseq_711_E09.1), n1p5-1 (SALK_055211), n1p5-2 (SALK_063304), nfya6-1 (SALK_005942), nfya6-2 (SAIL_159_E03), wrky38-1 (WiscDsLox489-492C21), wrky38-3 (SAIL_749_B02), wrky50-1 (SAIL_115_C10), div1-1 (SALK_056735), and div1-2 (SALK_084867C). The mutants were genotyped to confirm the homozygosity. The expression level of the inserted gene in the homozygous mutants were below detection limit of real-time PCR (FIG. 17).

    [0077] For growth experiments, the Arabidopsis seeds were germinated on ½ MS with MES Buffer and Vitamins (RPI cat M70800) plates for 7-10 days in on a 16h-light/8h-dark photoperiod. The seedlings were then transferred to pre-washed nutrient-poor matrix vermiculite under an 8 h light (120/μmol2/s)/16 h dark diurnal cycle, at temperatures 22 and 20° C. respectively and 40% humidity. We kept one plant per pot and carried out the entire experiment using Arasystem (https://www.arasystem.com/). To track the N supply for each plant, we treated each plant with the same amount of low N (LN, 2 mM KNO.sub.3) (Sigma cat P6083) or high N (HN, 10 mM KNO.sub.3) medium (Caisson Labs cat. no. MSP10) using a syringe and recorded the volume. The potassium concentration was maintained by supplementing KCl (Sigma cat P9333) to the LN medium. On 40 and 42 DAS, the treatment was enriched with 10% atom excess .sup.15N for .sup.15N influx analysis. To minimize the variation due to pot location in the growth chambers, the HN row was located adjacent to the LN row, and the flats were shuffled three times weekly. We repeated these experiments three times consecutively to obtain biological replicates for phenotypic and transcriptomic samples. For each of the 18 Arabidopsis accessions, mature leaves were harvested for transcriptome and the above ground tissues for physiological traits at 43 DAS. The dried tissues were ground and analyzed for total nitrogen using a PDZ Europa ANCA-GSL elemental analyzer interfaced to a PDZ Europa 20-20 isotope ratio mass spectrometer at UC Davis Stable Isotope Facility.

    Maize

    [0078] Seeds for all maize inbreds used in this disclosure were originally obtained from the USDA-ARS North Central Plant Introduction Station in Ames, Iowa, except for the inbreds derived from the Illinois Selection Experiment and FR1064 as described in Uribelarrea et al.sup.22. Inbred lines were subsequently increased by controlled self-pollination, and hybrid seed produced by controlled crosses. We grew the maize plants in N-managed field plots in Urbana, Ill. between May and September in 2014-2016. The soil type is a Drummer silty clay loam, pH 6.2, that received either 200 kg/Ha fertilizer N or no exogenous applied N when the plants reached the V3 growth stage. Subsequent soil testing and measures of plant N recovery estimate approximately 60 kg N/ha were made available from the soil alone. The N fertilizer was applied as granular ammonium sulfate banded adjacent to plants at the soil surface. Plants were grown in a split-plot design where individuals in each main plot (2 rows 5.3 m long, 76 cm row spacing) were paired in adjacent rows of N-replete or N depleted condition to a final density of 49,000 plants per hectare for inbreds and 77,000 plants per hectare for hybrids. Genotypes within main plots were arranged by relative maturity to minimize its impact on NUE traits. Plots were maintained weed free by a pre-plant application of herbicide (atrazine+metalochlor) followed by hand weeding as needed.

    [0079] Maize phenotyping was performed at the R6 growth stage, when plants have reached physiological maturity, but may not yet have fully senesced. Five plants from each plot were cut at ground level, ears removed, and a fresh weight obtained on the entire remaining plant material (stover, comprising mostly stalk by weight, followed by leaves, tassels, and husks). The stover was then shredded in a Vermeer wood chipper, a subsample was collected into a tared cloth bag, and the subsample fresh weight was recorded. Stover samples were oven-dried to dryness at least three days at 65° C. and the subsample dry weight used to estimate stover biomass. The dried stover was further ground in a Wiley mill to pass through a 2 mm screen, and approximately 100 mg used to estimate total nitrogen concentration by combustion analysis with a Fisons EA-1108 N elemental analyzer. Grain samples were dried for approximately one week at 37° C., after which grain was shelled from the cobs, and the cob weight recorded. The moisture content and N concentration within each 5-plant grain sample was estimated using near-infrared reflectance spectroscopy on a Perten DA7200 analyzer, using a custom calibration built with samples possessing a broad range of variation in composition and color. The nitrogen concentration calibration was established using data from total combustion analysis of grain samples as described above for stover.

    [0080] The nfya3-1::Mu loss-of-function allele was generated by the UniformMu insertion mu1003041::Mu in the 5′ untranslated region the annotated gene model Zm00001d006835. The UFMu-00332 seed stock was obtained from the Maize Genetics Cooperation Stock Center and genotyped.sup.64 to identify homozygous for the nfya3-1::Mu mutant allele, which were then self-pollinated. The expression level of the nfya3 gene in the homozygous mutants was below detection limit of real-time PCR (CT>45) (FIG. 16). The nfya3 mutant and wildtype W22-Uniform Mu plants were grown in 2020 at the same field site and using the same experimental design, nitrogen treatments, and phenotyping methods described above.

    RNA Extraction, Library Preparation, and Sequencing

    [0081] For each of three Arabidopsis RNA replicates, we harvested mature leaves from pre-bolting plants on 43 DAS between 9 and 11 AM from two plants, flash froze in liquid nitrogen and stored in −80 C. We isolated RNA using Direct-zol RNA Kits following manufacturer's instructions (Zymo Research). RNA quality was assessed on an Agilent Tape station using RNA ScreenTape (Agilent cat 5067-5576). All 108 stranded RNA-seq libraries were made using the NEBNext® Ultra™ II Directional RNA Library Prep Kit for Illumina® (NEB cat E7768) and assessed using DNA high sensitivity D1000 ScreenTape system (Agilent cat 5067-5584). The RNA-Seq libraries were sequenced using Illumina HiSeq 2500 v4 with 1×75 bp single-end read chemistry at the GenCore Facility at New York University Center for Genomics and Systems Biology.

    [0082] For each of three maize RNA replicates, we collected leaf tissues from two inches from the base of leaf 13 subtending the top ear at R1 stage between 9 and 11 AM, flash froze in liquid nitrogen and stored in −80 C. We extracted RNA from frozen leaf tissue using CTAB-chloroform method. Genomic DNA was removed using DNAse I (NEB cat M0303). RNA-seq libraries were prepared using a TruSeq Stranded mRNAseq Sample Prep kit (Illumina cat RS-122-2101) according to the protocol provided. Single-end 150 bp reads were generated using the Illumina HiSeq 4000 at the Roy J Carver Biotechnology Center in the University of Illinois at Urbana-Champaign.

    Identification of N Response Differentially Expressed Genes (N-DEGs)

    [0083] All RNA-seq raw reads were processed using the same pipeline to remove optical duplicates (Clumpify 37.24) and adapters (BBDuk 37.24).sup.65. The trimmed reads were aligned to the latest genome in 2018, TAIR10.sup.66 for Arabidopsis and Zm-B73-REFERENCE-GRAMENE-4.0.sup.12 for maize, using BBMap (37.24). The mapped reads were assigned by featureCounts (1.5.1).sup.67 using the latest annotation in 2018: Araport11.sup.68 for Arabidopsis and AGPv4.32.sup.12 for maize. The parameters and software versions for the above steps are available in GEO accession GSE152249. We identified N-DEGs in the training data set (n-1 genotypes) and repeated n times (n=number of genotypes in each species). In each round of analysis, we first filtered out the lowly expressed genes (CPM>1 in less than 10 samples) and normalized the data using upper-quantile (EDASeq 2.18.0).sup.69 and replicate samples (RUVSeq 1.18.0).sup.70. Subsequently, we used edgeR (3.26.8).sup.17 to detect genes differentially expressed in high vs low N condition across genotypes (FDR <0.05). Lastly, we intersected the n lists of DEGs and only retained the ones occurring on n lists as a common set of N-DEGs. These analyses resulted in 2,123 Arabidopsis N-DEGs and 6,914 maize N-DEGs (FIG. 4). The Arabidopsis—Maize homolog mapping file is generated from Phytozome 10.sup.18.

    [0084] We held out a testing genotype before the DEG stage; and only training genotypes (n-1 genotypes) were used in DEG analysis and XGBoost models. The held-out test genotypes were then used to validate the model performance. This round robin approach (FIGS. 10a(i) & 10b(i)), generated 18 and 16 independent DEG lists for Arabidopsis and maize, respectively. In approach a, we identified a unified list of gene features by intersecting these independent lists (e.g. 18 for Arabidopsis and 16 for maize) (FIG. 10a(ii)). By contrast, in approach b, cross species analysis was performed on each independent DEG list (e.g. 18 for Arabidopsis or 16 for maize).

    [0085] To rule out the possibility that using the intersected DEGs (e.g. within species) would overly optimize the XGBoost results, we further compared the XGBoost performance using the intersected DEGs (FIG. 10a) with the alternative approach that did not go through the within species list intersection (FIG. 10b). The results of these two approaches are comparable (FIG. 10c). However, the advantage of conducting the cross-genotype intersection (FIG. 10a), which we used in this manuscript), has the benefit of resulting in a unified list of gene features, compared to multiple independent lists of gene features. Generating a unified list of gene features will enable the gene feature ranking across genotypes, rather than restricted to an individual genotype.

    Construction and Evaluation of Predictive Machine Learning Models

    [0086] We used a tree model with gradient boosting, XGBoost.sup.13 R implementation, to train and test the models. For each species, we split the data into training (n-1 phenotypes) and testing (left-out genotype) sets. We used five-fold internal cross-validation to select the optimized hyperparameters. We tuned “nrounds” (number of trees), “colsample_bytree” (the proportion of features for constructing each tree), “subsamples” (the portion of training data samples for training each additional tree), and “eta” (shrinkage of feature weights to make the boosting process more conservative and prevent overfitting) in an XGBoost:regression model. Subsequently, we made predictions on each of the left-out genotype, assessed the model accuracy by calculating the Pearson's correlation coefficient r between the predicted and actual values.sup.71, and reported the r from 100 iterations.

    Selection of Candidate Genes for Functional Validation in NUE

    [0087] We used two parallel procedures to select candidate genes for functional validation. First, we used the XGBoost-generated feature importance score that indicates how useful each feature was in the construction of model. We summed the score on a gene-by-gene basis from 18 models for Arabidopsis and 16 models for maize and generated a ranked list. Second, we used a Random Forest-based algorithm GENIE3 to infer the transcription factors regulating the gene features. We used the N-responsive TFs (184 Arabidopsis TFs and 545 maize TFs) as the regulators and the gene features (610 Arabidopsis genes and 248 maize genes) as the targets and kept the default parameters. We constructed the NUE regulatory network using the top 1% of the edges and ranked the TFs based on their connectivity (number of edges).

    [0088] References—This reference listing is not an indication that any particular reference is material to patentability. [0089] 1 McMullen, M. D. et al. Genetic properties of the maize nested association mapping population. Science 325, 737-740, doi:10.1126/science.1174320 (2009). [0090] 2 Han, M., Okamoto, M., Beatty, P. H., Rothstein, S. J. & Good, A. G. The Genetics of Nitrogen Use Efficiency in Crop Plants. Annu Rev Genet 49, 269-289, doi:10.1146/annurev-genet-112414-055037 (2015). [0091] 3 Altman, N. & Krzywinski, M. The curse(s) of dimensionality. Nature Methods 15, 399-400, doi:10.1038/541592-018-0019-x (2018). [0092] 4 Burges, C. J. C. Dimension Reduction: A Guided Tour. Foundations and Trends® in Machine Learning 2, 275-365, doi:10.1561/2200000002 (2010). [0093] 5 Brubaker, D. K., Proctor, E. A., Haigis, K. M. & Lauffenburger, D. A. Computational translation of genomic responses from experimental model systems to humans. PLoS Comput Biol 15, e1006286, doi:10.1371/journal.pcbi.1006286 (2019). [0094] 6 Beatty, PH & Good, A. in Engineering Nitrogen Utilization in Crop Plants (eds Ashok Shrawat, Adel Zayed, & David A. Lightfoot) Ch. 2, 15-35 (Springer, 2018). [0095] 7 Zhang, X. et al. Managing nitrogen for sustainable development. Nature 528, 51-59, doi:10.1038/nature15743 (2015). [0096] 8 Chardon, F., Barthélémy, J., Daniel-Vedele, F. & Masclaux-Daubresse, C. Natural variation of nitrate uptake and nitrogen use efficiency in Arabidopsis thaliana cultivated with limiting and ample nitrogen supply. J Exp Bot 61, 2293-2302, doi:10.1093/jxb/erq059 (2010). [0097] 9 McKhann, H. I. et al. Nested core collections maximizing genetic diversity in Arabidopsis thaliana. Plant J 38, 193-202, doi:10.1111/j.1365-313X.2004.02034.x (2004). [0098] 10 Beckett, T. J., Morales, A. J., Koehler, K. L. & Rocheford, T. R. Genetic relatedness of previously Plant-Variety-Protected commercial maize inbreds. PLoS One 12, e0189277, doi:10.1371/journal.pone.0189277 (2017). [0099] 11 White, M. R., Mikel, M. A., de Leon, N. & Kaeppler, S. M. Diversity and heterotic patterns in North American proprietary dent maize germplasm. Crop Science 60, 100-114, doi:https://doi.org/10.1002/csc2.20050 (2020). [0100] 12 Jiao, Y. et al. Improved maize reference genome with single-molecule technologies. Nature 546, 524-527, doi:10.1038/nature22971 (2017). [0101] 13 Chen, T. & Guestrin, C. in Knowledge Discovery and Data Mining 10 (ACM New York, N. Y., USA, New York, N. Y., USA, 2016). [0102] 14 Huynh-Thu, V. A., Irrthum, A., Wehenkel, L. & Geurts, P. Inferring regulatory networks from expression data using tree-based methods. PLoS One 5, doi:10.1371/journal.pone.0012776 [0103] 15 White, W. G., Vincent, M. L., Moose, S. P. & Below, F. E. The sugar, biomass and biofuel potential of temperate by tropical maize hybrids. GCB Bioenergy 4, 496-508, doi:10.1111/j.1757-1707.2012.01158.x (2012). [0104] 16 Haegele, J. W., Cook, K. A., Nichols, D. M. & Below, F. E. Changes in Nitrogen Use Traits Associated with Genetic Improvement for Grain Yield of Maize Hybrids Released in Different Decades. Crop Science 53, 1256-1268, doi:10.2135/cropsci2012.07.0429 (2013). [0105] 17 Robinson, M. D., McCarthy, D. J. & Smyth, G. K. edgeR: a Bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics 26, 139-140, doi:10.1093/bioinformatics/btp616 (2010). [0106] 18 Goodstein, D. M. et al. Phytozome: a comparative platform for green plant genomics. Nucleic Acids Res 40, D1178-1186, doi:10.1093/nar/gkr944 (2012). [0107] 19 Yang, X. S. et al. Gene expression biomarkers provide sensitive indicators of in planta nitrogen status in maize. Plant Physiol 157, 1841-1852, doi:10.1104/pp. 111.187898 (2011). [0108] 20 Schapire, R. E. in Proceedings of the 16th international joint conference on Artificial intelligence—Volume 2 1401-1406 (Morgan Kaufmann Publishers Inc., Stockholm, Sweden, 1999). [0109] 21 Moose, S. P., Dudley, J. W. & Rocheford, T. R. Maize selection passes the century mark: a unique resource for 21st century genomics. Trends Plant Sci 9, 358-364, doi:10.1016/j.tplants.2004.05.005 (2004). [0110] 22 Uribelarrea, M., Below, F. E. & Moose, S. P. Grain Composition and Productivity of Maize Hybrids Derived from the Illinois Protein Strains in Response to Variable Nitrogen Supply. Crop Science 44, 1593-1600, doi:10.2135/cropsci2004.1593 (2004). [0111] 23 Groen, S. C. et al. The strength and pattern of natural selection on gene expression in rice. Nature 578, 572-576, doi:10.1038/s41586-020-1997-2 (2020). [0112] 24 Kollmus, H. et al. Of mice and men: the host response to influenza virus infection. Mamm Genome 29, 446-470, doi:10.1007/500335-018-9750-y (2018). [0113] 25 Korte, A. & Farlow, A. The advantages and limitations of trait analysis with GWAS: a review. Plant Methods 9, 29, doi:10.1186/1746-4811-9-29 (2013). [0114] 26 Konishi, M. & Yanagisawa, S. Arabidopsis NIN-like transcription factors have a central role in nitrate signalling. Nat Commun 4, 1617, doi:10.1038/ncomms2621 (2013). [0115] 27 Moison, M. et al. Three cytosolic glutamine synthetase isoforms localized in different-order veins act together for N remobilization and seed filling in Arabidopsis. J Exp Bot 69, 4379-4393, doi:10.1093/jxb/ery217 (2018). [0116] 28 Chen, Q. et al. Transcriptome sequencing reveals the roles of transcription factors in modulating genotype by nitrogen interaction in maize. Plant Cell Rep 34, 1761-1771, doi:10.1007/s00299-015-1822-9 (2015). [0117] 29 Yang, X. et al. QTL Mapping by Whole Genome Re-sequencing and Analysis of Candidate Genes for Nitrogen Use Efficiency in Rice. Front Plant Sci 8, 1634, doi:10.3389/fpls.2017.01634 (2017). [0118] 30 Yilmaz, A. et al. AGRIS: the Arabidopsis Gene Regulatory Information Server, an update. Nucleic Acids Res 39, D1118-1122, doi:10.1093/nar/gkq1120 (2011). [0119] 31 Jin, J. et al. PlantTFDB 4.0: toward a central hub for transcription factors and regulatory interactions in plants. Nucleic Acids Res 45, D1040-D1045, doi:10.1093/nar/gkw982 (2017). [0120] 32 Yilmaz, A. et al. GRASSIUS: a platform for comparative regulatory genomics across the grasses. Plant Physiol 149, 171-180, doi:10.1104/pp. 108.128579 (2009). [0121] 33 Qu, B. et al. A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input. Plant Physiol 167, 411-423, doi:10.1104/pp. 114.246959 (2015). [0122] 34 McCarty, D. R. et al. Steady-state transposon mutagenesis in inbred maize. Plant J 44, 52-61, doi:10.1111/j.1365-313X.2005.02509.x (2005). [0123] 35 Walley, J. W. et al. Integration of omic networks in a developmental atlas of maize. Science 353, 814-818, doi:10.1126/science.aag1125 (2016). [0124] 36 Myles, S. et al. Association mapping: critical considerations shift from genotyping to experimental design. Plant Cell 21, 2194-2202, doi:10.1105/tpc.109.068437 (2009). [0125] 37 Shmueli, G. To Explain or to Predict? Statistical Science 25 289-310, doi:10.2139/ssrn.1351252 (2010). [0126] 38 Breiman, L. Statistical Modeling: The Two Cultures (with comments and a rejoinder by the author). Statist. Sci. 16, 199-231, doi:10.1214/ss/1009213726 (2001). [0127] 39 Arp, J. J. Discovery of novel regulators and genes in nitrogen utilization pathways in maize Ph.D. thesis, University of Illinois at Urbana-Champaign, (2017). [0128] 40 Varala, K. et al. Temporal transcriptional logic of dynamic regulatory networks underlying nitrogen signaling and use in plants. Proc Natl Acad Sci USA 115, 6494-6499, doi:10.1073/pnas.1721487115 (2018). [0129] 41 Griffiths, M. et al. A multiple ion-uptake phenotyping platform reveals shared mechanisms affecting nutrient uptake by roots. Plant Physiol 185, 781-795, doi:10.1093/plphys/kiaa080 (2021). [0130] 42 Mu, J., Tan, H., Hong, S., Liang, Y. & Zuo, J. Arabidopsis transcription factor genes NF-YA1, 5, 6, and 9 play redundant roles in male gametogenesis, embryogenesis, and seed development. Mol Plant 6, 188-201, doi:10.1093/mp/sss061 (2013). [0131] 43 Millar, A. A. & Gubler, F. The Arabidopsis GAMYB-like genes, MYB33 and MYB65, are microRNA-regulated genes that redundantly facilitate anther development. Plant Cell 17, 705-721, doi:10.1105/tpc.104.027920 (2005). [0132] 44 Guo, C. et al. Repression of miR156 by miR159 Regulates the Timing of the Juvenile-to-Adult Transition in Arabidopsis. Plant Cell 29, 1293-1304, doi:10.1105/tpc.16.00975 (2017). [0133] 45 Sorin, C. et al. A miR169 isoform regulates specific NF-YA targets and root architecture in Arabidopsis. New Phytol 202, 1197-1211, doi:10.1111/nph.12735 (2014). [0134] 46 Palatnik, J. F. et al. Control of leaf morphogenesis by microRNAs. Nature 425, 257-263, doi:10.1038/nature01958 (2003). [0135] 47 Bruessow, F., Bautor, J., Hoffmann, G. & Parker, J. E. <em>Arabidopsis thaliana</em> natural variation in temperature-modulated immunity uncovers transcription factor UNE12 as a thermoresponsive regulator. bioRxiv, 768911, doi:10.1101/768911 (2019). [0136] 48 Kim, K. C., Lai, Z., Fan, B. & Chen, Z. Arabidopsis WRKY38 and WRKY62 transcription factors interact with histone deacetylase 19 in basal defense. Plant Cell 20, 2357-2371, doi:10.1105/tpc.107.055566 (2008). [0137] 49 Hussain, R. M. F., Sheikh, A. H., Haider, I., Quareshy, M. & Linthorst, H. J. M. Arabidopsis WRKY50 and TGA Transcription Factors Synergistically Activate Expression of. Front Plant Sci 9, 930, doi:10.3389/fpls.2018.00930 (2018). [0138] 50 He, Z., Zhao, X., Kong, F., Zuo, Z. & Liu, X. TCP2 positively regulates HY5/HYH and photomorphogenesis in Arabidopsis. J Exp Bot 67, 775-785, doi:10.1093/jxb/erv495 (2016). [0139] 51 Su, H. et al. Dual functions of ZmNF-YA3 in photoperiod-dependent flowering and abiotic stress responses in maize. Journal of Experimental Botany 69, 5177-5189, doi:10.1093/jxb/ery299 (2018). [0140] 52 Myers, Z. A. & Holt, B. F. NUCLEAR FACTOR-Y: still complex after all these years? Curr Opin Plant Biol 45, 96-102, doi:10.1016/j.pbi.2018.05.015 (2018). [0141] 53 Ly, L. L., Yoshida, H. & Yamaguchi, M. Nuclear transcription factor Y and its roles in cellular processes related to human disease. American journal of cancer research 3, 339-346 (2013). [0142] 54 Mach, J. CONSTANS Companion: CO Binds the NF-YB/NF-YC Dimer and Confers Sequence-Specific DNA Binding. Plant Cell 29, 1183, doi:10.1105/tpc.17.00465 (2017). [0143] 55 Xu, M. Y. et al. Stress-induced early flowering is mediated by miR169 in Arabidopsis thaliana. J Exp Bot 65, 89-101, doi:10.1093/jxb/ert353 (2014). [0144] 56 Liang, G., He, H. & Yu, D. Identification of nitrogen starvation-responsive microRNAs in Arabidopsis thaliana. PLoS One 7, e48951, doi:10.1371/journal.pone.0048951 (2012). [0145] 57 Schauser, L., Roussis, A., Stiller, J. & Stougaard, J. A plant regulator controlling development of symbiotic root nodules. Nature 402, 191-195, doi:10.1038/46058 (1999). [0146] 58 Ueda, Y. & Yanagisawa, S. Perception, transduction, and integration of nitrogen and phosphorus nutritional signals in the transcriptional regulatory network in plants. J Exp Bot 70, 3709-3717, doi:10.1093/jxb/erz148 (2019). [0147] 59 O'Malley, R. C. et al. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165, 1280-1292, doi:10.1016/j.cell.2016.04.038 (2016). [0148] 60 Kiba, T. et al. Repression of Nitrogen Starvation Responses by Members of the Arabidopsis GARP-Type Transcription Factor NIGT1/HRS1 Subfamily. Plant Cell 30, 925-945, doi:10.1105/tpc.17.00810 (2018). [0149] 61 Eulgem, T., Rushton, P. J., Robatzek, S. & Somssich, I. E. The WRKY superfamily of plant transcription factors. Trends Plant Sci 5, 199-206, doi:10.1016/s1360-1385(00)01600-9 (2000). [0150] 62 Bakshi, M. & Oelmüller, R. WRKY transcription factors: Jack of many trades in plants. Plant Signal Behav 9, e27700, doi:10.4161/psb.27700 (2014). [0151] 63 Alonso, J. M. et al. Genome-wide insertional mutagenesis of Arabidopsis thaliana. Science 301, 653-657, doi:10.1126/science.1086391 (2003). [0152] 64 Williams-Carrier, R. et al. Use of Illumina sequencing to identify transposon insertions underlying mutant phenotypes in high-copy Mutator lines of maize. The Plant Journal 63, 167-177, doi:10.1111/j.1365-313X.2010.04231.x (2010). [0153] 65 Bushnell, B. (2016). [0154] 66 Lamesch, P. et al. The Arabidopsis Information Resource (TAIR): improved gene annotation and new tools. Nucleic Acids Res 40, D1202-1210, doi:10.1093/nar/gkr1090 (2012). [0155] 67 Liao, Y., Smyth, G. K. & Shi, W. featureCounts: an efficient general purpose program for assigning sequence reads to genomic features. Bioinformatics 30, 923-930, doi:10.1093/bioinformatics/btt656 (2014). [0156] 68 Cheng, C. Y. et al. Araport11: a complete reannotation of the Arabidopsis thaliana reference genome. Plant J 89, 789-804, doi:10.1111/tpj.13415 (2017). [0157] 69 Risso, D., Schwartz, K., Sherlock, G. & Dudoit, S. GC-content normalization for RNA-Seq data. BMC Bioinformatics 12, 480, doi:10.1186/1471-2105-12-480 (2011). [0158] 70 Risso, D., Ngai, J., Speed, T. P. & Dudoit, S. Normalization of RNA-seq data using factor analysis of control genes or samples. Nat Biotechnol 32, 896-902, doi:10.1038/nbt.2931 (2014). [0159] 71 Waldmann, P. On the Use of the Pearson Correlation Coefficient for Model Evaluation in Genome-Wide Prediction. Front Genet 10, 899, doi:10.3389/fgene.2019.00899 (2019). [0160] 72 Cheng, C. Y. Evolutionarily informed machine learning enhances the power of predictive gene-to-phenotype relationships. Open Science Foundataion doi: 10.17605/OSF.IO/AVJPH (2021).

    TABLE-US-00003 TABLE 1 Evolutionary conservation of gene responsiveness enhances machine learning outcomes. Comparison of the performance of maize (top) and Arabidopsis (bottom) XGBoost models using the same number of features from different sources: randomly selected expressed genes, top N-DEGs based on FDR ranking in edgeR analysis, and the evolutionarily conserved N-DEGs. The numbers indicate the P-value of one-tailed Mann-Whitney U test. Maize Features Random Cross Species expressed genes Top N-DEGs N-DEGs Pearson′s r r = 0.62 r = 0.68 r = 0.79 Random 6.56e−04  1.5e−05 expressed genes Top N-DEGs 6.56e−04 1.06E−03 Cross Species  1.5e−05  1.06−03 N-DEGs Arabidopsis Features Random Cross Species expressed genes Top N-DEGs N-DEGs Pearson′s r r = 0.53 r = 0.59 r = 0.65 Random 7.63E−06 3.82E−06 expressed genes Top N-DEGs 7.63E−06 1.64E−04 Cross Species 3.82E−06 1.64E−04 N-DEGs

    TABLE-US-00004 TABLE 2 Candidate TFs identified from XGBoost feature importance ranking for predicting NUE and/or hubs in GENIE3 network constructed from XGBoost important gene features. Our validation results confirming the roles of these eight TFs in NUE are provided in FIG. 6, and FIG. 15. Gene ID Symbol Published Functions Selection Criteria AT3G14020 NF-YA6 male gametogenesis, At XGBoost gene-to- embryogenesis, seed morphology, trait model and seed germination; ABA response.sup.42, NF-YAs are predicted target of miR169.sup.45 AT4G02590 UNE12 temperature-responsive SA At and Zm XGBoost immunity regulator.sup.47 gene-to-trait model AT5G58900 DIV1 Nitrogen-response gene in the At and Zm XGBoost Arabidopsis seedling root and gene-to-trait model shoot.sup.40 AT4G18390 TCP2 MicroRNA-mediated leaf At XGBoost gene-to- morphogenesis.sup.46, trait model photomorphogenesis in Arabidopsis.sup.50 AT5G22570 WRKY38 Basal defense.sup.48 At GENIE3 GRN AT5G26170 WRKY50 Systemic Acquired Resistance.sup.49 At GENIE3 GRN AT5G06100 MYB33 The Arabidopsis (MYB33), maize Zm GENIE3 GRN, At and (Zm00001d012544) and rice Zm XGBoost gene-to- (OsGAMYB) homologs are trait model, conserved predicted target of miR159.sup.44, cross-species function juvenile-to-adult transition.sup.44, in anther development anther development.sup.43 AT1G76350 NLP5 The maize homolog of NLP5 Zm GENIE3 GRN, At and (Zm00001d006293) is a marker for Zm XGBoost gene-to- N status.sup.19 and nutrient uptake.sup.41 trait model Zm00001d006835 nfya3 photoperiod-dependent flowering At XGBoost gene-to- and abiotic stress responses.sup.51 trait model

    TABLE-US-00005 TABLE 3 25 MAIZE TRANSCRIPTION FACTORS AND THEIR ARABIDOPSIS HOMOLOGS Machine Machine learning Gene learning Gene Importance to Importance to NUE (Cheng & NUE (Cheng & Maize Coruzzi 2021, Published Arabidopsis Coruzzi 2021, Published Row Gene Table S3) Symbol Description Function Gene Table S3) Symbol Description Function 1 Zm00001 2.1 nf-ya3 CCAAT-HAP2- NA AT3G14020 38.0 NF-YA6 nuclear factor Table 3 d006835 transcription Y, subunit A6 Row 1 factor 2 Zm00001 41.2 hb75 Homeobox- NA AT4G04890 1.3 PDF2 protodermal Table 3 d002234 factor 75 factor 2 Row 46 transcription AT4G21750 3.4 ATM Li Homeobox- Table 3 leucine zipper Row 22 family protein/ lipid-binding START domain- containing protein 3 Zm00001 11.7 nlp17 NLP- Table 2 AT1G20640 18.4 NLP4 Plant regulator NA d006293 transcription Row 3 RWP-RK family factor 17 protein AT1G76350 10.7 NLP5 Plant regulator NA RWP-RK family protein 4 Zm00001 7.2 gras37 GRAS- NA AT3G54220 7.4 SCR SGR1, SHOOT Table 3 d005029 transcription GRAVITROPISM Row 11 factor 37 1 5 Zm00001 6.4 sbp23 SBP- NA AT3G57920 0.6 SPL15 squamosa Table 3 d006028 transcription promoter Row 54 factor 23 binding protein-like 15 6 Zm00001 10.2 hb66 Homeobox- NA AT3G61890 0.6 HB-12 ATHB-12, Table 3 d002799 factor 66 homeobox 12 Row 55 transcription AT2G46680 0.6 HB-7 ATHB-7, Table 3 homeobox 7 Row 53 7 Zm00001 2.3 abi28 ABI3-VP1- NA AT2G24645 1.6 Transcriptional NA d004358 transcription factor B3 factor 28 family protein 8 Zm00001 2.1 bbx6 b-box6 Table 2 AT2G21320 0.3 BBX18 B-box zinc Table 3 d006198 Row 8 finger family Row 62 protein 9 Zm00001 4.2 arr8 ARR-B- NA AT2G25180 2.3 RR12 ARR12, Table 3 d018380 transcription response Row 30 factor 8 regulator 12 10 Zm00001 4.0 nf-ya11 CCAAT-HAP2- NA AT3G05690 4.0 NF-YA2 nuclear factor Table 3 d013676 factor 210 Y, subunit A2 Row 19 transcription AT5G06510 2.5 NF-YA10 nuclear factor Table 3 Y, subunit A10 Row 27 11 Zm00001 0.8 bhlh15 bHLH- NA AT1G03040 14.5 basic helix- Table 3 d013073 9 transcription loop-helix Row 6 factor 159 (bHLH) DNA- binding superfamily protein AT4G02590 12.8 UNE12 basic helix- Table 3 loop-helix Row 7 (bHLH) DNA- binding superfamily protein 12 Zm00001 0.1 myb38 myb Table 2 AT4G38620 1.8 MYB4 ATMYB4, myb Table 3 d032024 transcription Row 12 domain protein Row 37 factor38 4 13 Zm00001 0.6 nlp13 NLP- Table 2 AT1G20640 18.4 NLP4 Plant regulator NA d021442 transcription Row 13 RWP-RK family factor 13 protein AT1G76350 10.7 NLP5 Plant regulator NA RWP-RK family protein 14 Zm00001 0.3 myb74 MYB- Table 2 AT5G06100 1.3 MYB33 Table 3 d012544 transcription Row 14 Row 45 factor 74 15 Zm00001 0.5 c3h39 C3H- NA AT2G19810 4.6 OZF1 AtOZF1, AtTZF2, Table 3 d037769 transcription TZF2, tandem Row 15 factor 39 zinc finger 2 16 Zm00001 0.3 myb34 MYB- NA AT5G58900 15.2 DIV1 Homeodomain- Table 3 d042830 transcription like Row 5 factor 34 transcriptional regulator 17 Zm00001 0.9 ereb81 AP2-EREBP- Table 2 AT2G28550 1.8 RAP2.7 TO E1, TARGET Table 3 d035512 transcription Row 17 OF EARLY Row 35 factor 81 ACTIVATION TAGGED (EAT) 1 18 Zm00001 1.1 nactf10 NAC- Table 2 AT1G01720 0.9 ATAF1 NAC (No Apical Table 3 d042609 9 transcription Row 18 Meristem) Row 50 factor 109 domain transcriptional regulator superfamily protein 19 Zm00001 0.1 wrky40 WRKY- Table 2 AT5G22570 1.8 WRKY38 ATWRKY38, AR Table 3 d043062 transcription Row 19 ABIDOPSIS Row 38 factor 40 THALIANA WRKY DNA- BINDING PROTEIN 38 20 Zm00001 0.3 mybr3 MYB-related- AT5G58900 15.2 DIV1 Homeodomain- Table 3 d038270 transcription like Row 5 factor 3 transcriptional regulator 21 Zm00001 0.1 bzip10 bZIP- Table 2 AT1G77920 2.4 TGA7 bZIP Table 3 d024160 7 transcription Row 21 transcription Row 29 factor 107 factor family protein 22 Zm00001 0.3 wrky58 WRKY- NA AT1G13960 1.5 WRKY4 WRKY DNA- Table 3 d041740 transcription binding protein Row 42 factor 58 4 23 Zm00001 0.1 nlp6 NLP- NA AT5G24310 4.9 ABIL3 ABL interactor- d039266 transcription like protein 3 factor 6 24 Zm00001 0.1 nactf44 NAC- NA AT3G04070 1.2 NAC047 ANAC047, NAC Table 3 d028999 transcription domain Row 47 factor 44 containing protein 47, SHG, SPEEDY HYPONASTIC GROWTH 25 Zm00001 0.1 wrky12 WRKY- NA AT5G26170 0.2 WRKY50 ATWRKY50, Table d037607 5 transcription ARABIDOPSIS Row 63 factor 125 THALIANA WRKY DNA- BINDING PROTEIN 50

    TABLE-US-00006 TABLE 4 25 MAIZE TRANSCRIPTION FACTORS Machine learning Validation Gene Ranking: Ranking: of role in Importance # of # of NUE using to NUE Ranking: # target as target as mutant (Cheng & of target in gene diff- (Cheng & Coruzzi N- features erentially Coruzzi Published Published 2021, Table Rank- assimilation predictive expressed 2021, FIG. N non-N Row Gene Symbol Description S3) sum pathways of NUE TF 6) function function 1 Zm00001 nf-ya3 CCAAT-HAP2- 2.1 46 7 23 16 Yes NA Photoperiod- d006835 transcription dependent factor4 flowering time control (Su et al., 2018) 2 Zm00001 hb75 Homeobox- 41.2 41 19 14 8 NA NA d002234 transcription factor 75 3 Zm00001 nlp27 NLP- 11.7 17 7 3 7 N status Ion Uptake in d006293 transcription biomarker the root factor 17 (Yang et (Griffiths et al., 2011) al., 2020) 4 Zm00001 gras37 GRAS- 7.2 54 12 22 20 NA NA d005029 transcription factor 37 5 Zm00001 sbp23 SBP- 6.4 71 22 24 25 NA NA d006028 transcription factor 23 6 Zm00001 hb66 Homeobox- 10.2 25 7 15 3 NA NA d002799 transcription factor 66 7 Zm00001 abi28 ABI3-VP1- 2.3 27 3 13 11 NA NA d004358 transcription factor 28 8 Zm00001 bbx6 b-box6 2.1 26 14 6 6 NA Leaf d006198 senescence (Sekhon et al., 2019) 9 Zm00001 arr8 ARR-B- 4.2 8 2 5 1 NA NA d018380 transcription factor 8 10 Zm00001 nf-ya11 CCAAT-HAP2- 4.0 39 14 11 14 NA NA d013676 transcription factor 210 11 Zm00001 bhlh159 bHLH- 0.8 63 23 19 21 NA NA d013073 transcription factor 159 12 Zm00001 myb38 myb 0.1 68 24 21 23 Misregulated NA d032024 transcription in factor38 mop1 mutant (Vendra min et al., 2020) 13 Zm00001 nlp13 NLP- 0.6 29 7 8 14 Drought- NA d021442 transcription responsive factor 13 (Jin et al., 2019) 14 Zm00001 myb74 MYB- 0.3 39 6 16 17 Potential NA d012544 transcription targets of factor 74 microRNA (Li et al., 2019) 15 Zm00001 c3h39 C3H- 0.5 13 7 2 4 NA NA d037769 transcription factor 39 16 Zm00001 myb34 MYB- 0.3 19 14 4 1 NA NA d042830 transcription factor 34 17 Zm00001 ereb81 AP2-EREBP- 0.9 74 25 25 24 Stress- NA d035512 transcription responsive factor 81 (Du et al., 2014) 18 Zm00001 nactf10 NAC- 1.1 33 14 7 12 Overexpression NA d042609 9 transcription in factor 109 Arabidopsis enhance drought tolerance (Liu et al., 2019) 19 Zm00001 wrky40 WRKY- 0.1 34 3 18 13 Misregulated NA d043062 transcription in factor 40 mop1 mutant (Vendramin et al., 2020) 20 Zm00001 mybr3 MYB-related- 0.3 13 3 1 9 NA NA d038270 transcription factor 3 21 Zm00001 bzip107 bZIP- 0.1 33 12 12 9 Misregulated NA d024160 transcription in factor 107 mop1 mutant (Vendramin et al., 2020) 22 Zm00001 wrky58 WRKY- 0.3 61 19 20 22 NA NA d041740 transcription factor 58 23 Zm00001 nlp6 NLP- 0.1 54 19 17 18 NA NA d039266 transcription factor 6 24 Zm00001 nactf44 NAC- 0.1 15 1 9 5 NA NA d028999 transcription factor 44 25 Zm00001 wrky125 WRKY- 0.1 47 18 10 19 NA NA d037607 transcription factor 125

    TABLE-US-00007 TABLE 5 63 ARABIDOPSIS TRANSCRIPTION FACTORS Machine Validation learning of role in Gene NUE using Published Importance mutant Nitrogen to NUE (Cheng & function Published (Cheng & Coruzzi using non-Nitrogen function Coruzzi 2021, 2021, mutants/ using Row Gene Symbol Description Table S3) FIG. 6) transgenics mutants/transgenics 1 AT3G14020 NF-YA6 nuclear factor Y, subunit A6 38.0 Yes NA Male gametogenesis, embryogenesis, and seed development (Mu et al., 2013) 2 AT1G54160 NF-YA5 NFYA5, NUCLEAR FACTOR Y A5 22.8 NA Drought resistance (Li et al., 2008) 3 AT1G20640 NLP4 Plant regulator RWP-RK family protein 18.4 NA NA 4 AT3G09370 MYB3R-3 AtMYB3R3, myb domain protein 3R3 16.8 NA DNA repair (Bourbousse et al., 2018) 5 AT5G58900 DIV1 Homeodomain-like transcriptional 15.2 Yes NA NA regulator 6 AT1G03040 basic helix-loop-helix (bHLH) DNA- 14.5 NA Thermoresponsive binding superfamily protein regulator (Bruessow et al., 2021) 7 AT4G02590 UNE12 basic helix-loop-helix (bHLH) DNA- 12.8 Yes NA Thermoresponsive binding superfamily protein regulator (Bruessow et al., 2021) 8 AT1G76350 NLP5 Plant regulator RWP-RK family protein 10.7 Yes NA NA 9 AT5G08190 NF-YB12 nuclear factor Y, subunit B12 9.4 NA NA 10 AT5G20510 AL5 alfin-like 5 8.1 NA Abiotic stress tolerance (Wei ei al., 2015) 11 AT3G54220 SCR SGR1, SHOOT GRAVITROPISM 1 7.4 NA Root development (Di Laurenzio et al., 1996), Bundle sheath differentiation (Cui et al., 2014) 12 AT4G39250 RL1 ATRL1, RAD-like 1, RSM2, 6.9 NA NA RADIALIS-LIKE SANT/MYB 2 13 AT3G46130 MYB48 ATMYB48-1, ATMYB48-2, 6.8 NA NA ATMYB48-3, ATMYB48, myb domain protein 48 14 AT4G26150 CGA1 GATA22, GATA TRANSCRIPTION 4.7 Nitrate- Flowering time and FACTOR 22, GNL, GNC-LIKE responsive cold tolerance (Ritcher and et al., 2013) chlorophyll synthesis (Bi et all, 2005) 15 AT2G19810 OZF1 AtOZF1, AtTZF2, TZF2, tandem zinc 4.6 NA JA and ABA response finger 2 (Lee et al., 2012) 16 AT4G35270 NLP2 Plant regulator RWP-RK family protein 4.5 NA NA 17 AT5G6541O HB25 ATHB25, ARABIDOPSIS THALIANA 4.4 NA Gibberellin signalling HOMEOBOX PROTEIN in seed longevity 25, ZFHD2, ZINC (Bueso et al., 2012) FINGER HOMEODOMAIN 2, ZHD1, ZINC FINGER HOMEODOMAIN 1 18 AT1G78600 LZF1 BBX22, B-box domain protein 4.0 NA Photomorphogenesis 22, DBB3, DOUBLE (Gangappa et al., B-BOX 3, STH3,SALT 2013) TOLERANCE HOMOLOG 3 NA 19 AT3G05690 NF-YA2 ATHAP2B, HEME 4.0 NA ACTIVATOR PROTEIN (YEAST) HOMOLOG 2B, AtNF- YA2, HAP2B, HEME ACTIVATOR PROTEIN (YEAST) HOMOLOG 2B, UNE8, UNFERTILIZED EMBRYO SAC 8 20 AT1G30500 NF-YA7 nuclear factor Y, subunit A7 3.8 NA Abiotic stress tolerance (Leyva- González et al., 2012) 21 AT3G20640 basic helix-loop-helix (bHLH) DNA- 3.6 NA Cell elongation and binding superfamily protein seed germination (Lee et al., 2005) 22 AT4G21750 ATML1 Homeobox-leucine zipper family 3.4 NA Shoot epidermal cell protein/lipid-binding START domain- differentiation (Takada containing protein et al., 2013) 23 AT3G59580 NLP9 Plant regulator RWP-RK family protein 3.3 NA NA 24 AT2G34720 NF-YA4 nuclear factor Y, subunit A4 3.0 NA NA 25 AT2G43500 NLP8 Plant regulator RWP-RK 3.0 Nitrate- NA family protein promoted seed germination (Yan et al., 2016) 26 AT3G15270 SPL5 squamosa promoter binding protein- 2.7 Nitrate- Flowering time (Lal et like 5 mediated al., 2011) flowering time control (Olas et al., 2019) 27 AT5G06510 NF-YA10 nuclear factor Y, subunit A10 2.5 NA Leaf growth via auxin signaling (Zhang et al., 2017) 28 AT5G24930 COL4 ATCOL4, BBX5, B-box 2.4 NA Abiotic stress domain protein 5 tolerance (Min et al., 2015) 29 AT1G77920 TGA7 bZIP transcription factor family 2.4 NA Disease resistance protein (Kesarwani et al., 2007) 30 AT2G25180 RR12 ARR12, response regulator 2.3 NA Cytokinin signal 12, AtARR12 transduction (Mason et al., 2005) 31 AT3G20910 NF-YA9 nuclear factor Y, subunit A9 2.2 NA Male gametogenesis, embryogenesis, and seed development (Mu et al., 2013) 32 AT4G18390 TCP2 TEOSINTE BRANCHED 1, cycloidea 2.2 Yes NA Photomorphogenesis and PCF transcription factor 2 (He et al., 2016) 33 AT1G19510 RL5 ATRL5, RAD-like 5, RSM4, 2.0 NA NA RADIALIS-LIKE SANT/MYB 4 34 AT1G72650 TRFL6 TRF-like 6 1.9 NA NA 35 AT2G28550 RAP2.7 TOE1, TARGET OF 1.8 NA Flowering time and EARLY ACTIVATION innate immunity (Zhai TAGGED (EAT) 1 et al., 2015) 36 AT2G42280 FBH4 AKS3, ABA-responsive kinase 1.8 NA Flowering time (Ito et substrate 3 al., 2012) 37 AT4G38620 MYB4 ATMYB4, myb domain protein 4 1.8 NA Flavonoid biosynthesis (Wang et al., 2020) 38 AT5G22570 WRKY38 ATWRKY38, 1.8 Yes NA Plant defense (Kim et ARABIDOPSIS THALIANA al., 2008) WRKY DNA-BINDING PROTEIN 38 39 AT5G59780 MYB59 ATMYB59-1, ATMYB59-2, 1.7 NA NA ATMYB59-3, ATMYB59, MYB DOMAIN PROTEIN 59 40 AT1G30210 TCP24 ATTCP24 1.7 NA Secondary cell wall thickening and anther endothecium (Wang et al., 2015) 41 AT2G24645 Transcriptional factor B3 family 1.6 NA NA protein 42 AT1G13960 WRKY4 WRKY DNA-binding protein 4 1.5 NA Plant resistance to biotrophic pathogens (Lai et al., 2008) 43 AT5G67420 LBD37 ASL39, ASYMMETRIC 1.4 Anthocyanin NA LEAVES2-LIKE 39 synthesis and nitrogen responses (Rubin et al., 200) 44 AT2G16770 bZIP23 Basic-leucine zipper (bZIP) 1.4 NA Zinc sensor (Lilav et al., transcription factor family protein 2021) 45 AT5G06100 MYB33 ATMYB33 1.3 Yes NA Regulated by miR159 in anther development (Miller and Gubler, 2005) 46 AT4G04890 PDF2 protodermal factor 2 1.3 NA Embryo development (Ogawa et al., 2015) 47 AT3G04070 NAC047 ANAC047, NAC domain containing 1.2 NA Waterlogging-induced protein 47, SHG, SPEEDY hyponastic leaf growth HYPONASTIC GROWTH (Rauf et al., 2013) 48 AT3G42790 AL3 alfin-like 3 0.9 NA NA 49 AT2G02470 AL6 alfin-like 6 0.9 NA Abiotic stress (Wei et al., 2015) 50 AT1G01720 ATAF1 NAC (No Apical Meristem) domain 0.9 NA Embryogenesis transcriptional regulator superfamily (Kunieda et al., 2008) protein 51 AT3G19510 HAT3.1 Homeodomain-like protein with 0.8 NA NA RING/FYVE/PHD-type zinc finger domain-containing protein 52 AT1G56170 NF-YC2 ATHAP5B, HAP5B 0.7 NA Flowering (Hackenberg et al., 2012) 53 AT2G46680 HB-7 ATHB-7, homeobox 0.6 NA Drought response (Re 7, ATHB7, ARABIDOPSIS THALIANA et al., 2014) HOMEOBOX7 54 AT3G57920 SPL15 squamosa promoter binding protein- 0.6 NA Flowering (Hyun et al., like 15 2016) 55 AT3G61890 HB-12 ATHB-12, homeobox 0.6 NA Drought response (Re 12, ATHB12, ARABIDOPSIS THALIANA et al., 2014) HOMEOBOX 12 56 AT1G53160 SPL4 FTM6, FLORAL TRANSITION 0.5 NA Flowering (Jung et al., AT THE MERISTEM6 2016) 57 AT5G11510 MYB3R-4 AtMYB3R4, myb domain protein 3R4 0.5 NA Cell cycle (Haga et al., 2011) 58 AT1G14920 GAI RGA2, RESTORATION ON 0.5 NA Gibberellin GROWTH ON AMMONIA 2 responses (Peng et al., 1997) 59 AT2G21230 bZIP30 Basic-leucine zipper (bZIP) 0.4 NA Reproductive transcription factor family protein development (Lozano- Sotomayor et al., 2016) 60 AT2G27230 LHW transcription factor-like protein 0.4 NA Epidermal responses to phosophate deprivation (Wendrich et al., 2020) 61 AT3G49940 LBD38 LOB domain-containing protein 38 0.4 Anthocyanin synthesis and nitrogen responses (Rubin et al., 200) 62 AT2G21320 BBX18 B-box zinc finger family protein 0.3 NA Thermomorphogenesis (Ding et al., 2018) 63 AT5G26170 WRKY50 ATWRKY50, 0.2 Yes NA Plant defense ARABIDOPSIS THALIANA (Hussain WRKY DNA-BINDING PROTEIN 50 et al., 2018)

    TABLE-US-00008 TABLE 6 209 MAIZE NON-TRANSCRIPTION FACTORS AND THEIR ARABIDOPSIS HOMOLOGS Machine learning Machine learning Gene Im- portance Gene Im- portance to NUE to NUE (Cheng & Coruzzi (Cheng & Coruzzi Row Maize Gene 2021, Table S3) Symbol Description Arabidopsis Gene 2021, Table S3) Symbol Description 1 Zm00001d0 128.9 morf2 multiple AT4G09010 0.2 TL29 APX4, ascorbate peroxidase 4 02426 organellar RNA 2 Zm00001d0 96.5 editing factor2 AT1G15820 3.1 LHCB6 CP24 01857 3 Zm00001d0 90.8 AT3G15360 1.2 TRX-M4 ATHM4, ATM4, ARABIDOPSIS 02854 THIOREDOXIN M-TYPE 4 4 Zm00001d0 74.4 mlo9 barley mlo defense AT5G53760 2.6 MLO11 ATM LO11, MILDEW 01804 gene homolog9 RESISTANCE LOCUS O 11 5 Zm00001d0 71.4 imd2 isopropylmalate AT5G14200 0.5 IMD1 ATIMD1, ARABIDOPSIS 02880 dehydrogenase2 ISOPROPYLMALATE DEHYDROGENASE 1 6 Zm00001d0 59.7 pco139896 Photosystem I AT1G08380 1.9 PSAO photosystem I subunit O 03767 subunit O 7 Zm00001d0 51.0 Probable AT1G08630 18.0 THA1 threonine aldolase 1 03059 low-specificity L-threonine aldolase 1 8 Zm00001d0 40.8 Peroxisomal (S)-2- AT4G18360 1.5 GOX3 Aldolase-type TIM barrel 02261 hydroxy-acid oxidase family protein GLO1 9 Zm00001d0 39.3 OJ000126_13.10 AT4G26950 2.0 senescence regulator 02798 protein (Protein of unknown function, DUF584) 10 Zm00001d0 38.5 ABC transporter AT3G60160 0.3 ABCC9 ATMRP9, multidrug 02503 C family resistance-associated protein member 9 9, MRP9, multidrug resistance-associated protein 9 11 Zm00001d0 36.7 Photosystem AT4G28750 0.8 PSAE-1 Photosystem I reaction 05446 I reaction centre subunit IV/PsaE center subunit IV A protein AT2G20260 0.4 PSAE-2 photosystem I subunit E-2 12 Zm00001d0 30.3 SAUR11 auxin-responsive AT2G45210 2.0 SAUR36 SAG201, senescence- 02826 SAUR associated gene 201 family member AT3G60690 0.2 SAUR59 SMALL AUXIN UPREGULATED RNA 59 13 Zm00001d0 26.9 Cyclopropane fatty AT3G23530 4.3 Cyclopropane-fatty-acyl- 06098 acid synthase phospholipid synthase 14 Zm00001d0 26.1 cys1 cysteine synthase1 AT2G43750 1.4 OASB ACS1, ARABIDOPSIS 08379 CYSTEINE SYNTHASE 1, ATCS- B, ARABIDOPSIS THALIANA CYSTEIN SYNTHASE- B, CPACS1, CHLOROPLAST O-ACETYLSERINE SULFHYDRYLASE 1 15 Zm00001d0 20.8 Probable metal- AT5G41000 0.7 YSL4 AtYSL4 03941 nicotianamine transporter YSL6 16 Zm00001d0 18.6 hct5 hydroxycinnamoyl- AT5G48930 5.1 HCT hydroxycinnamoyl-CoA 03129 transferase5 shikimate/quinate hydroxycinnamoyl transferase 17 Zm00001d0 17.5 PLAT domain- AT2G22170 0.6 PLAT2 Lipase/lipooxygenase, 03457 containing PLAT/LH2 family protein protein 3 18 Zm00001d0 17.1 pco080190 Amino acid binding AT2G36840 2.0 ACR10 ACT-like superfamily protein 05317 protein 19 Zm00001d0 16.1 Cysteine-rich AT4G23180 2.4 CRK10 RLK4 06793 receptor-like AT4G23150 1.3 CRK7 cysteine-rich RLK (RECEPTOR- protein kinase 10 like protein kinase) 7 AT4G23130 0.3 CRK5 RLK6, RECEPTOR-LIKE PROTEIN KINASE 6 AT4G23140 0.1 CRK6 cysteine-rich RLK (RECEPTOR- like protein kinase) 6 AT4G11530 0.7 CRK34 cysteine-rich RLK (RECEPTOR- like protein kinase) 34 AT4G23230 0.9 CRK15 cysteine-rich RECEPTOR-like kinase 20 Zm00001d0 15.3 ga2ox2 gibberellin AT4G21200 9.1 GA20X8 ATGA20X8, ARABIDOPSIS 02999 2-oxidase2 THALIANA GIBBERELLIN 2- OXIDASE 8 21 Zm00001d0 15.0 elip1 early light inducible AT3G22840 0.2 ELIP1 ELIP 07827 protein1 AT4G14690 0.0 ELIP2 Chlorophyll A-B binding family protein 22 Zm00001d0 14.6 Photosystem AT1G55670 0.6 PSAG photosystem I subunit G 05996 I reaction center subunit V 23 Zm00001d0 13.4 pspb1 photosystem AT1G06680 2.6 PSBP-1 OE23, OXYGEN EVOLVING 07857 II oxygen COMPLEX SUBUNIT 23 evolving KDA, OEE2, OXYGEN- polypeptide1 EVOLVING ENHANCER PROTEIN 2, PSII- P, PHOTOSYSTEM II SUBUNIT P 24 Zm00001d0 12.6 Serine/threonine- AT4G38470 4.9 STY46 ACT-like protein tyrosine 06267 protein kinase kinase family protein STY46 25 Zm00001d0 12.5 cytochrome P450 AT2G46660 1.8 CYP78A6 EOD3, enhancer of da1-1 06193 family 78 subfamily A polypeptide 8 26 Zm00001d0 12.3 Protein LURP1 AT1G33840 1.3 LURP-one-like protein 05193 (DUF567) 27 Zm00001d0 12.0 IDP2449 Gamma- AT4G39640 1.0 GGT1 gamma-glutamyl 03446 glutamyltrans- peptidase transpeptidase 1 1 28 Zm00001d0 11.7 Probable alpha- AT5G13980 1.6 Glycosyl hydrolase family 38 07383 mannosidase protein 29 Zm00001d0 8.6 cl11315_1a Protein disulfide- AT1G75690 0.8 LQY1 DnaJ/Hsp40 cysteine-rich 03459 isomerase LQY1 domain superfamily protein chloroplastic 30 Zm00001d0 8.1 Protein kinase Kelch AT2G44130 1.2 KFB39 Galactose oxidase/kelch 07274 repeat:Kelch repeat superfamily protein, Kelch-domain-containing F- box protein 39, KMD3, KISS ME DEADLY 3 31 Zm00001d0 7.5 UDP- AT2G43840 2.5 UGT74F1 UDP-glycosyltransferase 74 06140 glycosyltransferase F1 74B1 AT2G43820 0.6 UGT74F2 ATSAGT1, Arabidopsis thaliana salicylic acid glucosyltransferase l 32 Zm00001d0 7.1 pza03240 Proline oxidase AT3G30775 4.5 ERD5 AT- 29853 POX, ATPDH, ATPOX, ARABIDOPSIS THALIANA PROLINE OXIDASE, PDH1, proline dehydrogenase 1, PRO1, PRODH, PROLINE DEHYDROGENASE 33 Zm00001d0 5.9 pco112665 Bifunctional protein AT3G12290 0.8 Amino acid dehydrogenase 10867 FolD 2 family protein 34 Zm00001d0 5.7 Oxygen-evolving AT4G21280 1.5 PSBQA PSBQ-1, PHOTOSYSTEM II 06540 enhancer protein 3-1 SUBUNIT Q- 1, PSBQ, PHOTOSYSTEM II SUBUNIT Q AT4G05180 1.7 PS BQ-2 PS BQ, PHOTOSYSTEM II SUBUNIT Q, PSII-Q 35 Zm00001d0 5.7 3′-5′ exonuclease AT2G25910 2.9 3′-5′ exonuclease domain- 11188 domain-containing containing protein/K protein/K homology homology domain-containing domain-containing protein/KH domain- protein/KH domain- containing protein containing protein 36 Zm00001d0 5.4 Mitochondrial AT1G79900 2.8 BAC2 Mitochondrial substrate 08974 arginine carrier family protein transporter BAC2 37 Zm00001d0 5.4 Ihca1 light harvesting AT3G61470 0.5 LHCA2 photosystem l light 06663 complex A1 harvesting complex protein 38 Zm00001d0 4.7 Serinc-domain AT4G13345 1.1 MEE55 Serinc-domain containing 08772 containing serine and serine and sphingolipid sphingolipid biosynthesis biosynthesis protein protein 39 Zm00001d0 4.2 L-type lectin-domain AT4G02420 0.2 LecRK- Concanavalin A-like lectin 24637 containing receptor IV.4, L-type protein kinase family protein kinase V.9 lectin receptor kinase IV.4 40 Zm00001d0 4.1 umc1272 Probable amino acid AT5G23810 0.7 AAP7 amino acid permease 7 25665 permease 7 41 Zm00001d0 4.0 hct6 hydroxycinnamoyl- AT5G48930 5.1 HCT hydroxycinnamoyl-CoA 17186 transferase6 shikimate/quinate hydroxycinnamoyl transferase 42 Zm00001d0 3.9 Tetratricopeptide AT4G10840 0.9 KLCR1 Tetratricopeptide repeat 14961 repeat (TPR)-like superfamily (TPR)-like protein superfamily protein 43 Zm00001d0 3.7 AY109733 40S ribosomal protein AT4G09800 8.2 RPS18C S18 ribosomal protein 13086 S18 44 Zm00001d0 3.7 UDP- AT2G43840 2.5 UGT74F1 UDP-glycosyltransferase 74 06137 glycosyltransferase F1 74B1 AT2G43820 0.6 UGT74F2 ATSAGT1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, GT, SAGT1, salicylic acid glucosyltransferase l, SGTl, UDP-glucose: salicylic acid glucosyltransferase l 45 Zm00001d0 3.6 mlkp3 Maize LINC KASH AT3G13360 3.7 WIP3 WPP domain interacting 05997 AtWIP-like3 protein 3 46 Zm00001d0 3.5 lhcb6 light harvesting AT1G15820 3.1 LHCB6 CP24 26599 chlorophyll a/b binding protein6 47 Zm00001d0 3.4 TIDP2961 Auxin-responsive AT1G29450 2.6 SAUR64 SMALL AUXIN 06274 protein UPREGULATED RNA 64 SAUR61 AT1G29510 1.4 SAUR68 SMALL AUXIN UPREGULATED RNA 68 AT1G29500 2.1 SAUR66 SMALL AUXIN UPREGULATED RNA 66 48 Zm00001d0 3.4 Thioredoxin-like AT1G76080 1.3 CDSP32 ATCDSP32, ARABIDOPSIS 21334 protein THALIANA CHLOROPLASTIC CDSP32 DROUGHT-INDUCED STRESS chloroplastic PROTEIN OF 32 KD 49 Zm00001d0 3.3 DEAD-box ATP- AT5G62190 2.4 PRH75 DEAD box RNA helicase 06160 dependent RNA (PRH75) helicase 7 50 Zm00001d0 3.0 Sm-like protein AT5G48870 2.9 SADI AtLSM5, AtSAD1, LSM5, SM- 38088 LSM5 like 5 51 Zm00001d0 3.0 Ultraviolet- AT2G06520 0.7 PSBX photosystem II subunit X 08681 B-repressible protein 52 Zm00001d0 2.9 fdh1 formaldehyde AT5G43940 0.7 HOT5 ADH2, ALCOHOL 18468 dehydrogenase DEHYDROGENASE homolog1 2, ATGSNOR1, GSNOR,S- NITROSOGLUTATHIONE REDUCTASE, PAR2, PARAQUAT RESISTANT 2 53 Zm00001d0 2.9 mkkk27 MAP kinase kinase AT5G28080 0.7 WNK9 Protein kinase superfamily 06644 kinase27 protein 54 Zm00001d0 2.9 IhcblO light harvesting AT2G34430 0.4 LHB1B1 LHCB1.4, LIGHT- 11285 chlorophyll a/b HARVESTING binding CHLOROPHYLL-PROTEIN COMPLEX II SUBUNIT Bl protein10 AT2G34420 0.6 LHB1B2 LHCB1.5, PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5 AT1G29910 0.4 CAB3 AB180, LHCB1.2, LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2 55 Zm00001d0 2.9 Serine AT3G17180 0.5 scpl33 serine carboxypeptidase-like 09178 carboxypeptidase- like 33 33 56 Zm00001d0 2.8 pco070301 MtN19-like protein AT5G61820 1.4 stress up-regulated Nod 19 31677 protein 57 Zm00001d0 2.8 Rhodanese-like AT4G01050 2.3 TROL thylakoid rhodanese-like 16100 domain- protein containing protein 4 chloroplastic 58 Zm00001d0 2.6 Phospholipase A1- AT2G30550 0.6 DALL3 alpha/beta-Hydrolases 10463 Igamma1 superfamily protein, DAD1- chloroplastic Like Lipase 3 59 Zm00001d0 2.5 stcl sesquiterpene AT4G20230 0.3 terpenoid synthase 45054 cyclase1 superfamily protein 60 Zm00001d0 2.5 nrt5 nitrate transports AT1G12940 7.9 NRT2.5 ATNRT2.5, nitrate 11679 transporter2.5 61 Zm00001d0 2.5 npi447a agal1; alpha- AT5G08370 9.0 AGAL2 AtAGAL2, alpha-galactosidase 32605 galactosidase1: Entrez 2 Gene relates to alpha- galactosidase 1 (AGAL) of Arabidopsis 62 Zm00001d0 2.5 oec33 oxygen evolving AT5G66570 0.4 PSBO1 MSP-1, MANGANESE- 36535 complex, 33 kDa STABILIZING PROTEIN subunit 1, OE33, OXYGEN EVOLVING COMPLEX 33 KILODALTON PROTEIN, OEE1, 33 KDA OXYGEN EVOLVING POLYPEPTIDE 1, OEE33, OXYGEN EVOLVING ENHANCER PROTEIN 33, PSBO-1, PS II OXYGEN- EVOLVING COMPLEX 1 AT3G50820 1.7 PSBO2 OEC33, OXYGEN EVOLVING COMPLEX SUBUNIT 33 KDA, PSBO-2, PHOTOSYSTEM II SUBUNIT O-2 63 Zm00001d0 2.4 pco129777 Phospho- AT1G48600 0.6 PMEAMT AtPMEAMT 11642 b ethanolamine N-methyl- transferase 3 64 Zm00001d0 2.4 cytochrome P450 AT3G14690 0.7 CYP72A15 cytochrome P450, family 72, 11418 family 72 subfamily subfamily A, polypeptide 15 A polypeptide 8 65 Zm00001d0 2.4 Agmatine deiminase AT5G08170 2.5 EMB1873 ATAIH, AGMATINE 25644 IMINOHYDROLASE 66 Zm00001d0 2.4 Syntaxin-81 AT1G51740 2.4 SYP81 ATSYP81, ATUFE1, 25915 ARABIDOPSIS THALIANA ORTHOLOG OF YEAST UFE1 (UNKNOWN FUNCTION-ESSENTIAL 1), UFE1, ORTHOLOG OF YEAST UFE1 (UNKNOWN FUNCTION-ESSENTIAL 1), Rhodanese/Cell cycle control phosphatase superfamily protein 67 Zm00001d0 2.4 Rhodanese-like AT2G42220 0.7 19899 domain- containing protein 9 chloroplastic 68 Zm00001d0 2.3 Vacuolar-sorting AT2G14740 0.4 VSR3 ATVSR3, vaculolar sorting 14303 receptor 4 receptor 3, BP80-2; 2, binding protein of 80 kDa 2; 2, VSR2; 2, VACUOLAR SORTING RECEPTOR 2; 2 69 Zm00001d0 2.3 amo1 amine oxidase1 AT4G12290 1.5 Copper amine oxidase family 25103 protein 70 Zm00001d0 2.3 Photosystem AT1G31330 1.4 PSAF photosystem I subunit F 13146 I reaction center subunit III chloroplastic 71 Zm00001d0 2.3 psah1 photosystem I H AT3G16140 0.3 PSAH-1 photosystem I subunit H-1 38984 subunit1 72 Zm00001d0 2.3 atg18d autophagy18d AT3G56440 0.3 ATG18D ATATG18D, homolog of yeast 08691 autophagy 18 (ATG18) D 73 Zm00001d0 2.1 Iox5 lipoxygenase5 AT3G22400 4.6 LOX5 PLAT/LH2 domain-containing 13493 lipoxygenase family protein 74 Zm00001d0 2.1 cdc2 cell division control AT3G48750 1.9 CDC2 CDC2A, CDC2AAT, CDK2, 27373 protein homolog2 CDKA 1, CDKA; 1 75 Zm00001d0 2.1 Iox1 lipoxygenase1 AT3G22400 4.6 LOX5 PLAT/LH2 domain-containing 42541 lipoxygenase family protein 76 Zm00001d0 2.1 psb29 photosystem II AT3G08940 3.8 LHCB4.2 light harvesting complex 21763 subunit29 photosystem II AT5G01530 2.0 LHCB4.1 light harvesting complex photosystem II 77 Zm00001d0 2.1 hex3 hexokinase3 AT2G19860 3.3 HXK2 ATHXK2, ARABIDOPSIS 10796 THALIANA HEXOKINASE 2 78 Zm00001d0 2.1 Vacuolar protein AT3G49645 1.4 FAD- 34796 sorting- binding associated protein 9A protein 79 Zm00001d0 2.0 Peptidyl-prolyl AT3G25220 6.2 FKBP15-1 FK506-binding protein 15 kD- 21021 cis-trans 1 isomerase 80 Zm00001d0 2.0 S-adenosyl-L- AT2G41380 1.7 S-adenosyl-L-methionine- 09084 methionine- dependent dependent methyltransferases methyltransferases superfamily protein superfamily protein 81 Zm00001d0 1.9 alpha/beta-Hydrolases AT5G38220 9.1 alpha/beta-Hydrolases 11624 superfamily protein superfamily protein 82 Zm00001d0 1.9 peamt2 Phosphoethanolamine AT1G48600 0.6 PMEAMT AtPMEAMT 38891 N-methyltransferase 3 83 Zm00001d0 1.8 Methyl-CpG-binding AT5G52230 1.1 MBD13 methyl-CPG-binding domain 24306 domain-containing protein 13 protein 13 84 Zm00001d0 1.8 chaperone protein AT5G43260 1.4 chaperone protein dnaJ-like 16561 dnaJ-related protein 85 Zm00001d0 1.8 sqd1 sulfolipid AT4G33030 9.8 SQD1 sulfoquinovosyldiacylglycerol 09967 biosynthesis1 1 86 Zm00001d0 1.8 mpk4 MAP kinase4 AT4G01370 1.3 MPK4 ATMPK4, MAP kinase 24568 4, MAPK4 AT1G01560 1.0 MPK11 ATMPK11, MAP kinase 11 87 Zm00001d0 1.7 Phospho-2-dehydro- AT1G22410 4.3 Class-11 DAHP synthetase 06900 3-deoxyheptonate family protein aldolase 2 chloroplastic 88 Zm00001d0 1.7 actin binding protein AT1G52080 9.7 AR791 actin binding protein family 37695 family 89 Zm00001d0 1.7 rl1 radialis homolog1 AT1G19510 2.0 39118 AT4G39250 6.9 90 Zm00001d0 1.5 Histidine-containing AT3G16360 4.1 AHP4 HPT phosphotransmitter 4 10791 phosphotransfer protein 4 91 Zm00001d0 1.5 Protein AT4G11910 3.6 NYE2, STAY-GREEN-like protein 06211 STAY-GREEN 1 NONY chloroplastic ELLOWING 2, SGR2, STAY- GREEN 2 AT4G22920 0.6 NYE1 ATNYE1, NON-YELLOWING 1, SGR1, STAY-GREEN 1, SGR, STAY-GREEN 92 Zm00001d0 1.5 Histone deacetylase AT2G45640 6.3 SAP18 ATSAP18, SIN3 ASSOCIATED 15058 complex subunit POLYPEPTIDE 18 SAP18 93 Zm00001d0 1.5 Probable AT3G23790 7.7 AAE16 AMP-dependent synthetase 34832 acyl-activating and ligase family protein enzyme 16 chloroplastic 94 Zm00001d0 1.5 Chlorophyll AT3G47470 1.0 LHCA4 CAB4 50403 a-b binding protein 4 95 Zm00001d0 1.4 mrpa10 multidrug resistance AT3G59140 4.1 ABCC10 ATMRP14, multidrug 31447 protein associated10 resistance-associated protein 14, MRP14, multidrug resistance-associated protein 14 96 Zm00001d0 1.4 Photosystem AT1G55670 0.6 PSAG photosystem I subunit G 20877 I reaction center subunit V chloroplastic 97 Zm00001d0 1.3 Nuclear pore AT3G15970 3.1 NUP50 (Nucleoporin 50 kDa) protein 43757 complex protein NUP50A 98 Zm00001d0 1.3 gpm930 Photosystem AT4G28750 0.8 PSAE-1 Photosystem I reaction 19518 I reaction centre subunit IV/PsaE center subunit IV A protein AT2G20260 0.4 PSAE-2 photosystem I subunit E-2 99 Zm00001d0 1.3 IDP755 D111/G-patch AT1G63980 12.5 D111/G-patch domain- 27444 domain- containing protein containing protein 100 Zm00001d0 1.3 GTP-binding protein AT5G57960 2.3 HfIx GTP-binding protein, HfIX 48944 hfIX 101 Zm00001d0 1.3 Glucomannan AT5G22740 1.1 CSLA02 ATCSLA02, ARABIDOPSIS 53696 4-beta- THALIANA CELLULOSE mannosyl- SYNTHASE-LIKE transferase 2 A02, ATCSLA2, ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE A2, CSLA2, CELLULOSE SYNTHASE-LIKE A 2 102 Zm00001d0 1.3 umc1383 lhcb9; light AT2G05070 4.2 LHCB2.2 LHCB2, LIGHT-HARVESTING 33132 harvesting CHLOROPHYLL B-BINDING 2 chlorophyll binding protein9: cDNA sequence is a classll Ihcb, unlike previously characterized lhcb genes which are class1 (Viret et al 1993) 103 Zm00001d0 1.2 lhcb2 light harvesting AT2G34430 0.4 LHB1B1 LHCB1.4, 21435 chlorophyll a/b LIGHT-HARVESTING binding CHLOROPHYLL-PROTEIN protein2 COMPLEX II SUBUNIT B1 AT2G34420 0.6 LHB1B2 LHCB1.5, PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5 AT1G29910 0.4 CAB3 AB180, LHCB1.2, LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2 104 Zm00001d0 1.2 Nuclear transport AT5G04830 1.2 Nuclear transport factor 2 11799 factor (NTF2) family protein 2 (NTF2) family protein 105 Zm00001d0 1.2 Pollen Ole e 1 AT5G15780 1.1 Pollen Ole e 1 allergen and 52518 allergen extensin family protein and extensin family protein 106 Zm00001d0 1.1 Chlorophyll a-b AT3G61470 0.5 LHCA2 photosystem I light 21906 binding protein harvesting complex protein 107 Zm00001d0 1.1 pip1b plasma membrane AT4G23400 0.6 PIP1; 5 PIP1D 17526 intrinsic protein1 AT1G01620 0.9 PIP1C PIP1; 3, PLASMA MEMBRANE INTRINSIC PROTEIN 1; 3, TMP-B 108 Zm00001d0 1.1 D-xylose-proton AT5G17010 2.8 Major facilitator superfamily 14435 symporter-like l protein 109 Zm00001d0 1.1 psad1 photosystem I AT4G02770 0.5 PSAD-1 photosystem I subunit D-1 13039 subunit d1 110 Zm00001d0 1.1 photosystem II light AT2G34430 0.4 LHB1B1 LHCB1.4, 44401 harvesting complex LIGHT-HARVESTING gene B1B2 CHLOROPHYLL-PROTEIN COMPLEX II SUBUNIT B1 AT2G34420 0.6 LHB1B2 LHCB1.5, PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5 AT1G29910 0.4 CAB3 AB180, LHCB1.2, LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2 ill Zm00001d0 1.1 Phospho-2-dehydro- AT1G22410 4.3 Class-II DAHP synthetase 22181 3-deoxyheptonate family protein aldolase 1 112 Zm00001d0 1.1 AY111834 Cytochrome P450 AT2G46660 1.8 CYP78A6 EOD3, enhancer of da1-1 32042 CYP78A53 113 Zm00001d0 1.1 elip2 early light inducible AT3G22840 0.2 ELIP1 ELIP 18940 protein2 AT4G14690 0.0 ELIP2 Chlorophyll A-B binding family protein 114 Zm00001d0 1.1 Chlorophyll AT3G47470 1.0 LHCA4 CAB4 32197 a-b binding protein 4 chloroplastic 115 Zm00001d0 1.1 d9 dwarf plant9 AT1G14920 0.5 13465 116 Zm00001d0 1.1 hydroxyproline-rich AT2G39050 1.8 EULS3 ArathEULS3 40190 glycoprotein family protein 117 Zm00001d0 1.1 405 ribosomal AT4G09800 8.2 RPS18C S18 ribosomal protein 34422 protein 518 118 Zm00001d0 1.0 Transcription factor AT3G20640 3.6 43248 bHLH112 119 Zm00001d0 1.0 alia1 allantoinase1 AT4G04955 15.7 ALN ATALN, allantoinase 26635 120 Zm00001d0 1.0 cncr1 cinnamoyl CoA AT1G80820 4.6 CCR2 ATCCR2 32152 reductase1 121 Zm00001d0 1.0 BTB/POZ domain- AT1G55760 10.5 SIBP1 BTB/POZ domain-containing 52837 containing protein protein 122 Zm00001d0 1.0 pspb2 photosystem AT1G06680 2.6 PSBP-1 OE23, OXYGEN EVOLVING 18779 II oxygen COMPLEX SUBUNIT 23 evolving KDA, OEE2, OXYGEN- polypeptide2 EVOLVING ENHANCER PROTEIN 2, PSII- P, PHOTOSYSTEM II SUBUNIT P 123 Zm00001d0 1.0 Alanine-glyoxylate AT4G39660 14.4 AGT2 alanine: glyoxylate 27861 aminotransferase 2 aminotransferase 2 homolog 1 mitochondrial 124 Zm00001d0 0.9 Serine/threonine- AT1G65800 0.8 RK2 ARK2, receptor kinase 12609 protein kinase 2, AtARK2 125 Zm00001d0 0.9 Serine/threonine- AT4G21380 0.3 RK3 ARK3, receptor kinase 3 12609 protein kinase AT1G65790 0.1 RK1 ARK1, receptor kinase 1 126 Zm00001d0 0.9 Encodes a protein AT1G66480 11.5 plastid movement impaired 2 32233 whose expression is responsive to nematode infection. 127 Zm00001d0 0.9 Putative AT5G60900 0.1 RLK1 receptor-like protein kinase 1 25035 D-mannose binding lectin family receptor-like protein kinase 128 Zm00001d0 0.9 ubiquitin-associated AT1G04850 5.0 ubiquitin-associated 50551 (UBA)/TS-N (UBA)/TS-N domain- domain- containing protein containing protein 129 Zm00001d0 0.8 Peptide transporter AT1G52190 0.4 AtNPF1.2, Major facilitator superfamily 43374 PTR2 NP protein F1.2, NRT1/ PTR family 1.2, NRT1.11 130 Zm00001d0 0.8 psan1 photosystem I N AT5G64040 0.8 PSAN photosystem I reaction 41819 subunit1 center subunit PSI-N, chloroplast, putative/PSI-N, putative (PSAN) 131 Zm00001d0 0.8 pba1 PBA1 homolog1 AT4G01150 0.8 CURT1A CURVATURE THYLAKOID 27456 1A-like protein 132 Zm00001d0 0.8 psan2 photosystem I N AT5G64040 0.8 PSAN photosystem I reaction 23713 subunit2 center subunit PSI-N, chloroplast, putative/PSI-N, putative (PSAN) 133 Zm00001d0 0.8 TIDP3460 cytochrome AT1G57750 2.5 CYP96A15 MAH1, MID-CHAIN ALKANE 27601 P450 family HYDROXYLASE 1 96 subfamily A polypeptide 1 134 Zm00001d0 0.8 Zn-dependent AT4G33540 0.6 met allo-beta-lactamase 51842 hydrolase%2C family protein including glyoxylase 135 Zm00001d0 0.8 Peroxiredoxin-5 AT3G52960 1.1 Thioredoxin superfamily 46682 protein 136 Zm00001d0 0.8 ago101 argonaute101 AT5G43810 1.8 AGO10 PNH, PINHEAD, ZLL, 46438 ZWILLE 137 Zm00001d0 0.8 alpha/beta- AT4G39955 9.1 alpha/beta-Hydrolases 22182 Hydrolases superfamily protein superfamily protein 138 Zm00001d0 0.8 Thioredoxin M1 AT3G15360 1.2 TRX-M4 ATHM4, ATM4, ARABIDOPSIS 17379 chloroplastic THIOREDOXIN M-TYPE 4 139 Zm00001d0 0.8 SPIa/RYanodine AT1G35470 15.3 RanBPM SPIa/RYanodine receptor 16825 receptor (SPRY) domain-containing (SPRY) domain- protein containing protein AT4G09340 1.5 SPIa/RYanodine receptor (SPRY) domain-containing protein 140 Zm00001d0 0.7 Phosphatase AT1G17710 0.6 PEPC1 AtPEPC1, Arabidopsis thaliana 43621 phospho1 phosphoethanolamine/phos phocholine phosphatase 1 141 Zm00001d0 0.7 UDP-glucuronic acid AT5G59290 0.5 UXS3 ATUXS3 47797 decarboxylase 5 142 Zm00001d0 0.7 Probable AT1G79110 3.1 BRG2 zinc ion binding protein 33419 BOI-related E3 ubiquitin-protein ligase 2 143 Zm00001d0 0.7 IDP518 Chlorophyll AT2G34430 0.4 LHB1B1 LHCB1.4, 44396 a-b binding LIGHT-HARVESTING protein 48% 2C CHLOROPHYLL-PROTEIN chloroplastic COMPLEX II SUBUNIT B1 AT2G34420 0.6 LHB1B2 LHCB1.5, PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5 AT1G2991O 0.4 CAB3 AB180, LHCB1.2, LIGHT HARVESTING CHLOROPHYLL A/B BINDING PROTEIN 1.2 144 Zm00001d0 0.7 gst31 glutathione AT1G59700 0.4 GSTU16 ATGSTU16, glutathione S- 27557 transferase31 transferase TAU 16 AT1G59670 0.6 GSTU15 ATGSTU15, glutathione S- transferase TAU 15 145 Zm00001d0 0.7 pco123453 S-adenosyl-L- AT4G28830 1.4 S-adenosyl-L-methionine- 36274 methionine- dependent dependent methyltransferases methyltransferases superfamily protein superfamily protein 146 Zm00001d0 0.6 idh1 isocitrate AT1G65930 0.8 cICDH cytosolic NADP+-dependent 11487 dehydrogenase1 isocitrate dehydrogenase 147 Zm00001d0 0.6 pip1e plasma membrane AT4G23400 0.6 PIP1; 5 PIP1D 51872 intrinsic proteinl AT1G01620 0.9 PIP1C PIP1; 3, PLASMA MEMBRANE INTRINSIC PROTEIN 1; 3, TMP-B 148 Zm00001d0 0.6 Putative leucine-rich AT1G28440 0.5 HSL1 HAESA-like 1 09029 repeat receptor-like protein kinase family protein 149 Zm00001d0 0.6 Metallothionein-like AT5G02380 1.9 MT2B metallothionein 2B 39914 protein type 2 150 Zm00001d0 0.6 Snf1-related kinase AT1G80940 2.6 Snf1 kinase interactor-like 18364 interacting protein SKI1 protein 151 Zm00001d0 0.6 ROTUNDIFOLIA AT2G39705 0.6 RTFL8 DVL11, DEVIL 11 28598 like 8 152 Zm00001d0 0.6 ATPase AT4G28070 0.6 AFG1-like ATPase family 25892 protein 153 Zm00001d0 0.6 Ultraviolet-B- AT2G06520 0.7 PSBX photosystem II subunit X 39715 repressible protein 154 Zm00001d0 0.6 Protein LRP16 AT2G40600 0.3 appr-1-p processing enzyme 29065 family protein 155 Zm00001d0 0.6 Proline oxidase AT3G30775 4.5 ERD5 AT- 47124 POX, ATPDH, ATPOX, ARABIDOPSIS THALIANA PROLINE OXIDASE, PDH1, proline dehydrogenase 1, PRO1, PRODH, PROLINE DEHYDROGENASE 156 Zm00001d0 0.6 NAD(P)-linked AT1G59950 1.1 NAD(P)-linked 28360 oxidoreductase oxidoreductase superfamily superfamily protein protein 157 Zm00001d0 0.6 gdh1 glutamic AT3G03910 4.1 GDH3 glutamate dehydrogenase 3 34420 dehydrogenase1 158 Zm00001d0 0.6 Putative calcium- AT4G09570 0.7 CPK4 ATCPK4 23560 dependent protein kinase family protein 159 Zm00001d0 0.5 gpm345 NAD(P)H AT4G27270 1.1 Quinone reductase family 12607 dehydrogenase protein (quinone) FQR1 160 Zm00001d0 0.5 oec33b oxygen-evolving AT5G66570 0.4 PSBO1 MSP-1, MANGANESE- 14564 complex 33 kda STABILIZING PROTEIN protein b 1, OE33, OXYGEN EVOLVING COMPLEX 33 KILODALTON PROTEIN, OEE1, 33 KDA OXYGEN EVOLVING POLYPEPTIDE 1, OEE33, OXYGEN EVOLVING ENHANCER PROTEIN 33, PSBO-1, PS II OXYGEN- EVOLVING COMPLEX 1 AT3G50820 1.7 PSBO2 OEC33, OXYGEN EVOLVING COMPLEX SUBUNIT 33 KDA, PSBO-2, PHOTOSYSTEM II SUBUNIT O-2 161 Zm00001d0 0.5 kch1 potassium AT2G26650 1.8 KT1 AKT1, K+ transporter 44056 channel 1 1, ATAKT1 162 Zm00001d0 0.5 3′-5′ exonuclease AT2G25910 2.9 3′-5′ exonuclease domain- 44243 domain-containing containing protein/K protein/K homology homology domain-containing domain-containing protein/KH domain- protein/KH domain- containing protein containing protein 163 Zm00001d0 0.5 abh3 abscisic acid 8′- AT3G19270 0.5 CYP707A4 cytochrome P450, family 50021 hydroxylase3 707, subfamily A, polypeptide 4 164 Zm00001d0 0.5 protein; Expressed AT5G16110 6.5 hypothetical protein 41410 protein 165 Zm00001d0 0.5 see2b senescence AT4G32940 1.7 GAMMAVPE 44495 enhanced2b 166 Zm00001d0 0.5 Chaperone AT1G16680 5.6 Chaperone DnaJ-domain 41488 DnaJ-domain superfamily protein superfamily protein 167 Zm00001d0 0.4 Serine AT4G12910 6.9 scpl20 serine carboxypeptidase-like 41769 carboxypeptidase- 20 like20 168 Zm00001d0 0.4 FAD/NAD(P)- AT4G38540 0.4 FAD/NAD(P)-binding 48416 binding oxidoreductase family oxidoreductase family protein protein 169 Zm00001d0 0.4 chaperone protein AT2G24395 0.7 chaperone protein dnaJ-like 31514 dnaJ-related protein 170 Zm00001d0 0.4 Ultraviolet-B- AT2G06520 0.7 PSBX photosystem II subunit X 22464 repressible protein 171 Zm00001d0 0.4 Photosystem II repair AT1G03600 2.6 PSB27 photosystem II family protein 29049 protein PSB27-H1 chloroplastic 172 Zm00001d0 0.4 AT4G11910 3.6 NYE2, STAY-GREEN-like protein 21288 NONY ELLOWING Senescence-inducible 2, SGR2, chloroplast STAY- stay-green GREEN 2 protein 1 AT4G22920 0.6 NYE1 ATNYE1, NON-YELLOWING 1, SGR1, STAY-GREEN 1, SGR, STAY-GREEN 173 Zm00001d0 0.4 RNase L inhibitor AT5G10070 30.6 RNase L inhibitor protein-like 48190 protein-related protein 174 Zm00001d0 0.4 GDSL AT1G28580 0.3 GDSL-like 44465 esterase/lipase Lipase/Acylhydrolase superfamily protein AT1G28570 13.3 SGNH hydrolase-type esterase superfamily protein 175 Zm00001d0 0.4 rte2 rotten ear2 AT3G62270 2.1 BOR2, HCO3-transporter family 41590 REQUIRES HIGH BORON 2 176 Zm00001d0 0.4 gst19 glutathione AT1G17170 0.8 GSTU24 ATGSTU24, glutathione S- 36951 transferase19 transferase TAU 24, GST, Arabidopsis thaliana Glutathione S-transferase (class tau) 24 177 Zm00001d0 0.3 amt1 ammonium AT4G13510 0.4 AMT1; 1 ATAMT1; 1, ATAMT1, 25831 transporter1 ARABIDOPSIS THALIANA AMMONIUM TRANSPORT 1 178 Zm00001d0 0.3 mdh4 malate AT1G04410 6.9 c-NAD- Lactate/malate 32695 dehydrogenase4 MDH1 dehydrogenase family protein 179 Zm00001d0 0.3 Cytochrome c AT1G53030 11.8 COX17 Cytochrome C oxidase 52040 oxidase copper copper chaperone (COX17) chaperone%3B Cytochrome c oxidase copper chaperone isoform 1% 3B Cytochrome c oxidase copper chaperone isoform 2 180 Zm00001d0 0.3 ATPase%2C AT1G71960 3.6 ABCG25 ATABCG25, Arabidopsis 53049 coupled thaliana ATP-binding to transmembrane cassette G25 movement of substance%3B ATPase%2C coupled to transmembrane movement of substances 181 Zm00001d0 0.3 SGF29 tudor-like AT3G27460 16.0 SGF29a AtSGF29a 23689 domain 182 Zm00001d0 0.3 Transmembrane 9 AT5G25100 0.1 Endomembrane protein 70 24141 superfamily protein family member 9 AT5G10840 1.3 EMP1 Endomembrane protein 70 protein family AT2G24170 0.5 Endomembrane protein 70 protein family 183 Zm00001d0 0.3 Serine AT3G17180 0.5 scpl33 serine carboxypeptidase-like 40741 carboxypeptidase- like 33 33 184 Zm00001d0 0.3 Protein FREE1 AT1G20110 0.5 FREE1 RING/FYVE/PHD zinc finger 21878 superfamily protein 185 Zm00001d0 0.3 cys2 cysteine synthase2 AT4G14880 1.2 OASA1 ATCYS- 31136 3A, CYTACS1, OLD3, ONSET OF LEAF DEATH 3 186 Zm00001d0 0.3 mate6 multidrug and toxic AT4G39030 0.3 EDS5 SCORD3, susceptible to 15060 compound coronatine-deficient Pst extrusion6 DC3000 3, SID1, SALICYLIC ACID INDUCTION DEFICIENT 1 187 Zm00001d0 0.3 evolutionarily AT1G79270 0.4 ECT8 evolutionarily conserved C- 43860 conserved terminal region 8 C-terminal region 8 188 Zm00001d0 0.3 Photosystem II repair AT1G03600 2.6 PSB27 photosystem II family protein 47532 protein PSB27-H1 chloroplastic 189 Zm00001d0 0.3 NAD(P)H AT4G27270 1.1 Quinone reductase family 43249 dehydrogenase protein (quinone) FQR1 190 Zm00001d0 0.3 Cytochrome AT2G40890 3.4 CYP98A3 REF8, REDUCED EPIDERMAL 43174 P450 98A3 FLUORESCENCE 8 191 Zm00001d0 0.2 Tryptophan AT1G34060 19.5 Pyridoxal phosphate (PLP)- 43651 aminotransferase- dependent transferases related protein 4 superfamily protein 192 Zm00001d0 0.2 ROTUNDIFOLIA AT2G39705 0.6 RTFL8 DVL11, DEVIL 11 47820 like 8 193 Zm00001d0 0.2 Phosphatidylinositol AT4G00440 4.5 TRM15 GPI-anchored adhesin-like 48540 N-acety- protein, putative (DUF3741) glucosaminly- transferase subunit P-related 194 Zm00001d0 0.2 cyp11 cytochrome P450 11 AT3G14690 0.7 CYP72A15 cytochrome P450, family 72, 44159 subfamily A, polypeptide 15 195 Zm00001d0 0.2 F11F12.5 protein AT3G20300 4.4 extracellular ligand-gated ion 46652 channel protein (DUF3537) 196 Zm00001d0 0.2 Photosystem II AT2G30570 0.4 PSBW photosystem II reaction 43299 reaction center W center W protein chloroplastic 197 Zm00001d0 0.2 Ribosomal protein AT4G22380 0.3 Ribosomal protein 47958 L7Ae/L30e/S12e/ L7Ae/L30e/S12e/Gadd45 Gadd4 family protein 5 family protein 198 Zm00001d0 0.2 Grx_A2-gluta AT4G33040 0.8 Thioredoxin superfamily 39468 redoxin protein subgroup III 199 Zm00001d0 0.2 Putative membrane AT5G59350 8.9 transmembrane protein 37644 lipoprotein 200 Zm00001d0 0.2 HIT-type Zinc finger AT4G28820 14.1 HIT-type Zinc finger family 42997 family protein protein 201 Zm00001d0 0.2 PIF/Ping-Pong AT5G12010 0.5 nuclease 44300 family of plant transposases 202 Zm00001d0 0.2 Glutathione S- AT1G59700 0.4 GSTU16 ATGSTU16, glutathione S- 43795 transferase GSTU6 transferase TAU 16 AT1G59670 0.6 GSTU15 ATGSTU15, glutathione S- transferase TAU 15 203 Zm00001d0 0.1 GINS complex AT1G19080 10.2 TTN10 PSF3, Partner of SLD5 3 52742 protein 204 Zm00001d0 0.1 Photosystem II core AT1G67740 4.9 PSBY YCF32 49650 complex protein psbY 205 Zm00001d0 0.1 5-hydroxyisourate AT5G58220 0.3 TTL ALNS, allantoin synthase 47217 hydrolase 206 Zm00001d0 0.1 Tryptophan AT1G34060 19.5 Pyridoxal phosphate (PLP)- 43650 aminotransferase- dependent transferases related protein 4 superfamily protein 207 Zm00001d0 0.1 F-box/kelch-repeat AT2G44130 1.2 KFB39, Galactose oxidase/kelch 49016 protein SKIP20 KMD3, repeat superfamily protein, KISS Kelch-domain-containing F- ME box protein 39 DEADLY 3 208 Zm00001d0 0.1 gid1 gibberellin- AT3G05120 1.4 GID1A ATGIDIA, GA INSENSITIVE 38165 insensitive DWARF1A dwarf protein homolog1 AT3G63010 0.5 GID1B ATGID1B 209 Zm00001d0 0.0 cytoplasmic AT1G33490 0.7 E3 ubiquitin-protein ligase 53786 membrane protein

    TABLE-US-00009 TABLE 7 224 MAIZE NON-TRANSCRIPTION FACTORS Machine learning Gene Importance to NUE (Cheng & Coruzzi 2021, Row Gene Symbol Description Table S3)  1 Zm00001d002530 169.7  2 Zm00001d002426 morf2 multiple organellar RNA editing 128.9 factor2  3 Zm00001d001857 96.5  4 Zm00001d002854 90.8  5 Zm00001d001804 mlo9 barley mio defense gene 74.4 homolog9  6 Zm00001d002880 imd2 isopropylmalate dehydrogenase2 71.4  7 Zm00001d003767 pco139896 Photosystem I subunit O 59.7  8 Zm00001d003059 Probable low-specificity 51.0 L-threonine aldolase 1  9 Zm00001d002261 Peroxisomal (S)-2-hydroxy-acid 40.8 oxidase GLO1  10 Zm00001d002798 OJ000126_13.10 protein; protein 39.3  11 Zm00001d002503 ABC transporter C family member 9 38.5  12 Zm00001d005446 Photosystem I reaction center 36.7 subunit IV A  13 Zm00001d002826 SAUR11-auxin-responsive SAUR 30.3 family member  14 Zm00001d006098 Cyclopropane fatty acid synthase 26.9  15 Zm00001d008379 cys1 cysteine synthasel 26.1  16 Zm00001d003941 Probable metal-nicotianamine 20.8 transporter YSL6  17 Zm00001d003129 hct5 hydroxycinnamoyltransferase5 18.6  18 Zm00001d003457 PLAT domain-containing protein 3 17.5  19 Zm00001d005317 pco080190 Amino acid binding protein 17.1  20 Zm00001d006793 Cysteine-rich receptor-like 16.1 protein kinase 10  21 Zm00001d002999 ga2ox2 gibberellin 2-oxidase2 15.3  22 Zm00001d007827 elip1 early light inducible proteinl 15.0  23 Zm00001d005996 Photosystem I reaction center 14.6 subunit V  24 Zm00001d007857 pspb1 photosystem II oxygen evolving 13.4 polypeptide1  25 Zm00001d006267 Serine/threonine-protein kinase 12.6 STY46  26 Zm00001d006193 cytochrome P450 family 78 12.5 subfamily A polypeptide 8  27 Zm00001d005193 Protein LURP1 12.3  28 Zm00001d003446 IDP2449 Gamma-glutamyltranspeptidase 1 12.0  29 Zm00001d007383 Probable alpha-mannosidase 11.7  30 Zm00001d003459 cl11315_1a Protein disulfide-isomerase LQY1 8.6 chloroplastic  31 Zm00001d007274 Protein kinase Kelch repeat: Kelch 8.1  32 Zm00001d006140 UDP-glycosyltransferase 74B1 7.5  33 Zm00001d029853 pza03240 Proline oxidase 7.1  34 Zm00001d010867 pco112665 Bifunctional protein FolD 2 5.9  35 Zm00001d005657 5.9  36 Zm00001d020348 5.7  37 Zm00001d006540 Oxygen-evolving enhancer 5.7 protein 3-1  38 Zm00001d011188 3′-5′ exonuclease domain- 5.7 containing protein/K homology domain-containing protein/KH domain-containing protein  39 Zm00001d008974 Mitochondrial arginine 5.4 transporter BAC2  40 Zm00001d006663 lhca1 light harvesting complex A1 5.4  41 Zm00001d008772 Serinc-domain containing serine 4.7 and sphingolipid biosynthesis protein  42 Zm00001d017768 4.2  43 Zm00001d024637 L-type lectin-domain containing 4.2 receptor kinase V.9  44 Zm00001d025665 umc1272 Probable amino acid permease 7 4.1  45 Zm00001d017186 hct6 hydroxycinnamoyltransferase6 4.0  46 Zm00001d014961 Tetratricopeptide repeat (TPR)- 3.9 like superfamily protein  47 Zm00001d013086 AY109733 40S ribosomal protein S18 3.7  48 Zm00001d006137 UDP-glycosyltransferase 74B1 3.7  49 Zm00001d005997 mlkp3 Maize LINC KASH AtWIP-like3 3.6  50 Zm00001d026599 lhcb6 light harvesting chlorophyll a/b 3.5 binding protein6  51 Zm00001d006274 TIDP2961 Auxin-responsive protein SAUR61 3.4  52 Zm00001d021334 Thioredoxin-like protein CDSP32 3.4 chloroplastic  53 Zm00001d006160 DEAD-box ATP-dependent RNA 3.3 helicase 7  54 Zm00001d038088 Sm-like protein LSM5 3.0  55 Zm00001d008681 GRMZM2G380414 Ultraviolet-B-repressible protein 3.0  56 Zm00001d018468 fdh1 formaldehyde dehydrogenase 2.9 homolog1  57 Zm00001d006644 mkkk27 MAP kinase kinase kinase27 2.9  58 Zm00001d011285 lhcb10 light harvesting chlorophyll a/b 2.9 binding protein10  59 Zm00001d009178 Serine carboxypeptidase-like 33 2.9  60 Zm00001d031677 pco070301 MtN19-like protein 2.8  61 Zm00001d016100 Rhodanese-like domain- 2.8 containing protein 4 chloroplastic  62 Zm00001d006521 2.7  63 Zm00001d010463 Phospholipase A1-lgamma1 2.6 chloroplastic  64 Zm00001d045054 stc1 sesquiterpene cyclase1 2.5  65 Zm00001d011679 nrt5 nitrate transports 2.5  66 Zm00001d032605 npi447a agal1; alpha-galactosidase1: 2.5 Entrez Gene relates to alpha- galactosidase 1 (AGAL) of Arabidopsis  67 Zm00001d036535 oec33 oxygen evolving complex, 33 kDa 2.5 subunit  68 Zm00001d011642 pco129777b Phosphoethanolamine N- 2.4 methyltransferase 3  69 Zm00001d011418 cytochrome P450 family 72 2.4 subfamily A polypeptide 8  70 Zm00001d025644 Agmatine deiminase 2.4  71 Zm00001d025915 Syntaxin-81 2.4  72 Zm00001d019899 Rhodanese-like domain- 2.4 containing protein 9 chloroplastic  73 Zm00001d014303 Vacuolar-sorting receptor 4 2.3  74 Zm00001d025103 amo1 amine oxidase1 2.3  75 Zm00001d013146 Photosystem I reaction center 2.3 subunit III chloroplastic  76 Zm00001d038984 psah1 photosystem I H subunit1 2.3  77 Zm00001d008691 atgl8d autophagy18d 2.3  78 Zm00001d026026 2.3  79 Zm00001d013493 lox5 lipoxygenases 2.1  80 Zm00001d027373 cdc2 cell division control protein 2.1 homolog2  81 Zm00001d042541 lox1 lipoxygenase1 2.1  82 Zm00001d021763 psb29 photosystem II subunit29 2.1  83 Zm00001d010796 hex3 hexokinase3 2.1  84 Zm00001d034796 Vacuolar protein sorting- 2.1 associated protein 9A  85 Zm00001d021021 Peptidyl-prolyl cis-trans 2.0 isomerase  86 Zm00001d009084 S-adenosyl-L-methionine- 2.0 dependent methyltransferases superfamily protein  87 Zm00001d011624 alpha/beta-Hydrolases 1.9 superfamily protein  88 Zm00001d038891 peamt2 Phosphoethanolamine 1.9 N-methyltransferase 3  89 Zm00001d024306 Methyl-CpG-binding domain- 1.8 containing protein 13  90 Zm00001d016561 chaperone protein dnaJ-related 1.8  91 Zm00001d009967 sqd1 sulfolipid biosynthesis1 1.8  92 Zm00001d030766 1.8  93 Zm00001d024568 mpk4 MAP kinase4 1.8  94 Zm00001d006900 Phospho-2-dehydro-3- 1.7 deoxyheptonate aldolase 2 chloroplastic  95 Zm00001d037695 actin binding protein family 1.7  96 Zm00001d032306 1.7  97 Zm00001d039118 rl1 radialis homolog1 1.7  98 Zm00001d010791 Histidine-containing 1.5 phosphotransfer protein 4  99 Zm00001d006211 Protein STAY-GREEN 1 1.5 chloroplastic 100 Zm00001d048497 1.5 101 Zm00001d015058 Histone deacetylase complex 1.5 subunit SAP18 102 Zm00001d034832 Probable acyl-activating enzyme 1.5 16 chloroplastic 103 Zm00001d050403 Chlorophyll a-b binding protein 4 1.5 104 Zm00001d031447 mrpa10 multidrug resistance protein 1.4 associated10 105 Zm00001d016800 1.4 106 Zm00001d020877 Photosystem I reaction center 1.4 subunit V chloroplastic 107 Zm00001d043757 Nuclear pore complex protein 1.3 NUP50A 108 Zm00001d019518 gpm930 Photosystem I reaction center 1.3 subunit IV A 109 Zm00001d027444 IDP755 D111/G-patch domain-containing 1.3 protein 110 Zm00001d048944 GTP-binding protein hfIX 1.3 111 Zm00001d053696 Glucomannan 4-beta- 1.3 mannosyltransferase 2 112 Zm00001d033132 umc1383 lhcb9; light harvesting chlorophyll 1.3 binding protein9: cDNA sequence is a classII lhcb, unlike previously characterized lhcb genes which are class1 (Viret et al 1993) 113 Zm00001d021435 lhcb2 light harvesting chlorophyll a/b 1.2 binding protein2 114 Zm00001d011799 Nuclear transport factor 2 (NTF2) 1.2 family protein 115 Zm00001d052518 Pollen Ole e 1 allergen and 1.2 extensin family protein 116 Zm00001d021906 Chlorophyll a-b binding protein 1.1 117 Zm00001d020264 1.1 118 Zm00001d017526 pip1b plasma membrane intrinsic 1.1 proteinl 119 Zm00001d016991 1.1 120 Zm00001d014435 D-xylose-proton symporter-like l 1.1 121 Zm00001d013039 psad1 photosystem I subunit d1 1.1 122 Zm00001d044401 photosystem II light harvesting 1.1 complex gene B1B2 123 Zm00001d022181 Phospho-2-dehydro-3- 1.1 deoxyheptonate aldolase 1 124 Zm00001d032042 AY111834 Cytochrome P450 CYP78A53 1.1 125 Zm00001d018940 elip2 early light inducible protein2 1.1 126 Zm00001d032197 Chlorophyll a-b binding protein 4 1.1 chloroplastic 127 Zm00001d013465 d9 dwarf plant9 1.1 128 Zm00001d040190 hydroxyproline-rich glycoprotein 1.1 family protein 129 Zm00001d034422 40S ribosomal protein S18 1.1 130 Zm00001d043248 Transcription factor bHLH112 1.0 131 Zm00001d026635 alla1 allantoinase1 1.0 132 Zm00001d032152 cncr1 cinnamoyl CoA reductasel 1.0 133 Zm00001d052837 BTB/POZ domain-containing 1.0 protein 134 Zm00001d018779 pspb2 photosystem II oxygen evolving 1.0 polypeptide2 135 Zm00001d027861 Alanine--glyoxylate 1.0 aminotransferase 2 homolog l mitochondrial 136 Zm00001d012609 Serine/threonine-protein kinase 0.9 137 Zm00001d032233 Encodes a protein whose 0.9 expression is responsive to nematode infection. 138 Zm00001d025035 Putative D-mannose binding 0.9 lectin family receptor-like protein kinase 139 Zm00001d050551 ubiquitin-associated (UBA)/TS-N 0.9 domain-containing protein 140 Zm00001d038346 0.9 141 Zm00001d019117 0.9 142 Zm00001d043374 Peptide transporter PTR2 0.8 143 Zm00001d041819 psan1 photosystem I N subunitl 0.8 144 Zm00001d027456 pba1 PBA1 homolog1 0.8 145 Zm00001d023713 psan2 photosystem I N subunit2 0.8 146 Zm00001d027601 TIDP3460 cytochrome P450 family 96 0.8 subfamily A polypeptide 1 147 Zm00001d051842 Zn-dependent hydrolase % 2C 0.8 including glyoxylase 148 Zm00001d046682 Peroxiredoxin-5 0.8 149 Zm00001d046438 ago101 argonaute101 0.8 150 Zm00001d022182 alpha/beta-Hydrolases 0.8 superfamily protein 151 Zm00001d017379 Thioredoxin M1 chloroplastic 0.8 152 Zm00001d016825 SPIa/RYanodine receptor (SPRY) 0.8 domain-containing protein 153 Zm00001d043621 Phosphatase phospho1 0.7 154 Zm00001d047797 UDP-glucuronic acid 0.7 decarboxylase 5 155 Zm00001d033419 Probable BOI-related E3 0.7 ubiquitin-protein ligase 2 156 Zm00001d044396 IDP518 Chlorophyll a-b binding protein 0.7 48% 2C chloroplastic 157 Zm00001d027557 gst31 glutathione transferase31 0.7 158 Zm00001d036274 pco123453 S-adenosyl-L-methionine- 0.7 dependent methyltransferases superfamily protein 159 Zm00001d011487 idh1 isocitrate dehydrogenasel 0.6 160 Zm00001d051872 pip1e plasma membrane intrinsic 0.6 protein1 161 Zm00001d009029 Putative leucine-rich repeat 0.6 receptor-like protein kinase family protein 162 Zm00001d039914 Metallothionein-like protein type 2 0.6 163 Zm00001d018364 Snfl-related kinase interacting 0.6 protein SKI1 164 Zm00001d028598 ROTUNDIFOLIA like 8 0.6 165 Zm00001d025892 ATPase 0.6 166 Zm00001d039715 Ultraviolet-B-repressible protein 0.6 167 Zm00001d029065 Protein LRP16 0.6 168 Zm00001d047124 Proline oxidase 0.6 169 Zm00001d028360 NAD(P)-linked oxidoreductase 0.6 superfamily protein 170 Zm00001d034420 gdh1 glutamic dehydrogenasel 0.6 171 Zm00001d023560 Putative calcium-dependent 0.6 protein kinase family protein 172 Zm00001d012607 gpm345 NAD(P)H dehydrogenase 0.5 (quinone) FQR1 173 Zm00001d014564 oec33b oxygen-evolving complex 33 kda 0.5 protein b 174 Zm00001d044056 kch1 potassium channel 1 0.5 175 Zm00001d044243 3′-5′ exonuclease domain- 0.5 containing protein/K homology domain-containing protein/KH domain-containing protein 176 Zm00001d050021 abh3 abscisic acid 8′-hydroxylase3 0.5 177 Zm00001d041410 protein; Expressed protein 0.5 178 Zm00001d044495 see2b senescence enhanced2b 0.5 179 Zm00001d041488 Chaperone DnaJ-domain 0.5 superfamily protein 180 Zm00001d041769 Serine carboxypeptidase-like 20 0.4 181 Zm00001d048416 FAD/NAD(P)-binding 0.4 oxidoreductase family protein 182 Zm00001d031514 chaperone protein dnaJ-related 0.4 183 Zm00001d022464 Ultraviolet-B-repressible protein 0.4 184 Zm00001d029049 Photosystem II repair protein 0.4 PSB27-H1 chloroplastic 185 Zm00001d021288 Senescence-inducible chloroplast 0.4 stay-green protein 1 186 Zm00001d048190 RNase L inhibitor protein-related 0.4 187 Zm00001d044465 GDSL esterase/lipase 0.4 188 Zm00001d041590 rte2 rotten ear2 0.4 189 Zm00001d036951 gst19 glutathione transferase19 0.4 190 Zm00001d025831 amt1 ammonium transporter1 0.3 191 Zm00001d032695 mdh4 malate dehydrogenase4 0.3 192 Zm00001d052040 Cytochrome c oxidase copper 0.3 chaperone % 3B Cytochrome c oxidase copper chaperone isoform 1% 3B Cytochrome c oxidase copper chaperone isoform 2 193 Zm00001d053049 ATPase % 2C coupled to 0.3 transmembrane movement of substance % 3B ATPase % 2C coupled to transmembrane movement of substances 194 Zm00001d023689 SGF29 tudor-like domain 0.3 195 Zm00001d024141 Transmembrane 9 superfamily 0.3 member 9 196 Zm00001d040741 Serine carboxypeptidase-like 33 0.3 197 Zm00001d021878 Protein FREE1 0.3 198 Zm00001d031136 cys2 cysteine synthase2 0.3 199 Zm00001d015060 mate6 multidrug and toxic compound 0.3 extrusion6 200 Zm00001d043860 evolutionarily conserved 0.3 C-terminal region 8 201 Zm00001d047532 Photosystem II repair protein 0.3 PSB27-H1 chloroplastic 202 Zm00001d043249 NAD(P)H dehydrogenase 0.3 (quinone) FQR1 203 Zm00001d043174 GRMZM2G138074 Cytochrome P450 98A3 0.3 204 Zm00001d043651 Tryptophan aminotransferase- 0.2 related protein 4 205 Zm00001d047820 ROTUNDIFOLIA like 8 0.2 206 Zm00001d048540 Phosphatidylinositol N- 0.2 acetyglucosaminlytransferase subunit P-related 207 Zm00001d048135 0.2 208 Zm00001d044159 cyp11 cytochrome P450 11 0.2 209 Zm00001d046652 F11F12.5 protein 0.2 210 Zm00001d043299 Photosystem II reaction center W 0.2 protein chloroplastic 211 Zm00001d047958 Ribosomal protein 0.2 L7Ae/L30e/S12e/Gadd45 family protein 212 Zm00001d039468 Grx_A2-glutaredoxin subgroup III 0.2 213 Zm00001d037644 Putative membrane lipoprotein 0.2 214 Zm00001d042997 HIT-type Zinc finger family 0.2 protein 215 Zm00001d044300 PIF/Ping-Pong family of plant 0.2 transposases 216 Zm00001d043795 Glutathione S-transferase GSTU6 0.2 217 Zm00001d038964 0.2 218 Zm00001d052742 GINS complex protein 0.1 219 Zm00001d049650 Photosystem II core complex 0.1 protein psbY 220 Zm00001d047217 5-hydroxyisourate hydrolase 0.1 221 Zm00001d043650 Tryptophan aminotransferase- 0.1 related protein 4 222 Zm00001d049016 F-box/kelch-repeat protein 0.1 SKIP20 223 Zm00001d038165 gid1 gibberellin-insensitive dwarf 0.1 protein homolog1 224 Zm00001d053786 cytoplasmic membrane protein 0.0

    TABLE-US-00010 TABLE 8 547 ARABIDOPSIS NON-TRANSCRIPTION FACTORS Machine learning Gene Importance to NUE (Cheng & Coruzzi 2021, Row Gene Symbol Description Table S3)  1 AT5G10070 RNase L inhibitor protein-like protein 30.6  2 AT1G20550 O-fucosyltransferase family protein 21.0  3 AT3G59800 stress response protein 20.4  4 AT4G03240 FH ATFH 20.3  5 AT1G34060 Pyridoxal phosphate (PLP)-dependent transferases superfamily 19.5 protein  6 AT5G04940 SUVH1 SU(VAR)3-9 homolog 1 19.0  7 AT1G08630 THA1 threonine aldolase 1 18.0  8 AT4G22340 CDS2 cytidinediphosphate diacylglycerol synthase 2 17.6  9 AT2G34200 RING/FYVE/PHD zinc finger superfamily protein 17.6  10 AT1G79390 centrosomal protein 17.4  11 AT3G10220 EMB2804 tubulin folding cofactor B 16.6  12 AT2G29960 CYP5 ATCYP5, ARABIDOPSIS THALIANA CYCLOPHILIN 5, CYP19-4, 16.2 CYCLOPHILIN 19-4  13 AT3G27460 SGF29a AtSGF29a 16.0  14 AT4G04955 ALN ATALN,allantoinase 15.7  15 AT5G53920 ribosomal protein L11 methyltransferase-like protein 15.3  16 AT5G59210 myosin heavy chain-like protein 15.3  17 AT1G35470 RanBPM SPIa/RYanodine receptor (SPRY) domain-containing protein 15.3  18 AT4G39660 AGT2 alanine: glyoxylate aminotransferase 2 14.4  19 AT4G28820 HIT-type Zinc finger family protein 14.1  20 AT5G56460 Protein kinase superfamily protein 13.9  21 AT1G28570 SGNH hydrolase-type esterase superfamily protein 13.3  22 AT5G46620 hypothetical protein 13.3  23 AT5G57000 DEAD-box ATP-dependent RNA helicase 12.5  24 AT1G63980 D111/G-patch domain-containing protein 12.5  25 AT1G53030 Cytochrome C oxidase copper chaperone (COX17) 11.8  26 AT5G65480 CCI1, Clavata complex interactor 1 11.7  27 AT4G32660 AME3 Protein kinase superfamily protein 11.6  28 AT1G66480 plastid movement impaired 2 11.5  29 AT3G13224 RNA-binding (RRM/RBD/RNP motifs) family protein 11.0  30 AT3G20650 mRNA capping enzyme family protein 10.6  31 AT1G55760 SIBP1 BTB/POZ domain-containing protein 10.5  32 AT1G22160 senescence-associated family protein (DUF581) 10.4  33 AT1G19080 TTN10 PSF3, Partner of SLD5 3 10.2  34 AT4G33030 SQD1 sulfoquinovosyldiacylglycerol l 9.8  35 AT1G52080 AR791 actin binding protein family 9.7  36 AT4G01320 ATSTE24 Peptidase family M48 family protein 9.6  37 AT5G10100 TPPI Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 9.6  38 AT3G01560 proline-rich receptor-like kinase, putative (DUF1421) 9.3  39 AT4G39955 alpha/beta-Hydrolases superfamily protein 9.1  40 AT4G21200 GA20X8 ATGA2OX8, ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8 9.1  41 AT5G38220 alpha/beta-Hydrolases superfamily protein 9.1  42 AT5G64740 CESA6 E112, IXR2, ISOXABEN RESISTANT 2, PRC1, PROCUSTE 1 9.1  43 AT5G08370 AGAL2 AtAGAL2, alpha-galactosidase 2 9.0  44 AT1G14560 CoAc1, CoA Carrier 1 Mitochondrial substrate carrier family protein 9.0  45 AT5G59350 transmembrane protein 8.9  46 AT5G18130 transmembrane protein 8.6  47 AT5G64160 plant/protein 8.4  48 AT4G09800 RPS18C S18 ribosomal protein 8.2  49 AT4G11560 bromo-adjacent homology (BAH) domain-containing protein 8.0  50 AT1G12940 NRT2.5 ATNRT2.5, nitrate transporter2.5 7.9  51 AT3G23790 AAE16 AMP-dependent synthetase and ligase family protein 7.7  52 AT4G25850 ORP4B OSBP(oxysterol binding protein)-related protein 4B 7.5  53 AT1G58080 ATP-PRT1 ATATP-PRT1, ATP phosphoribosyl transferase 1, HISN1A 7.2  54 AT1G15110 PSS1 AtPSS1 7.0  55 AT1G04410 c-NAD-MDHl Lactate/malate dehydrogenase family protein 6.9  56 AT4G12910 scpl20 serine carboxypeptidase-like 20 6.9  57 AT5G04090 histidine-tRNA ligase 6.8  58 AT1G03340 hypothetical protein 6.8  59 AT1G05560 UGT75B1 UGT1, UDP-GLUCOSE TRANSFERASE 1 6.8  60 AT5G09300 Thiamin diphosphate-binding fold (THDP-binding) superfamily 6.7 protein  61 AT2G44950 HUB1 RDO4, REDUCED DORMANCY 4 6.5  62 AT5G1611O hypothetical protein 6.5  63 AT3G13730 CYP90D1 cytochrome P450, family 90, subfamily D, polypeptide 1 6.4  64 AT5G59050 G patch domain protein 6.4  65 AT4G38250 Transmembrane amino acid transporter family protein 6.3  66 AT2G45640 SAP18 ATSAP18, SIN3 ASSOCIATED POLYPEPTIDE 18 6.3  67 AT1G73720 SMU1 transducin family protein/WD-40 repeat family protein 6.3  68 AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 6.2  69 AT4G00330 CRCK2 calmodulin-binding receptor-like cytoplasmic kinase 2 6.2  70 AT1G51560 Pyridoxamine 5′-phosphate oxidase family protein 6.1  71 AT5G19420 Regulator of chromosome condensation (RCC1) family with FYVE zinc 6.1 finger domain-containing protein  72 AT3G47010 Glycosyl hydrolase family protein 6.0  73 AT1G42430 inactive purple acid phosphatase-like protein 5.8  74 AT1G15710 prephenate dehydrogenase family protein 5.6  75 AT1G16680 Chaperone DnaJ-domain superfamily protein 5.6  76 AT4G33180 alpha/beta-Hydrolases superfamily protein 5.6  77 AT1G08730 XIC Myosin family protein with Dil domain-containing protein 5.5  78 AT5G54160 OMT1 ATOMT1, O-methyltransferase 1, AtCOMT, COMT1, caffeate 5.5 O-methyltransferase 1, OMT3, O-methyltransferase 3  79 AT5G09830 BolA2 BolA-like family protein, homolog of E. coli BolA 2 5.2  80 AT1G63970 ISPF MECPS, 2C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE 5.1 SYNTHASE  81 AT5G48930 HCT hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl 5.1 transferase  82 AT1G20696 HMGB3 NFD03, NFD3 5.0  83 AT3G57680 Peptidase S41 family protein 5.0  84 AT1G04850 ubiquitin-associated (UBA)/TS-N domain-containing protein 5.0  85 AT1G67740 PSBY YCF32 4.9  86 AT1G13440 GAPC2 GAPC-2, GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2 4.9  87 AT5G24310 ABIL3 ABL interactor-like protein 3 4.9  88 AT4G38470 STY46 ACT-like protein tyrosine kinase family protein 4.9  89 AT3G20550 DDL SMAD/FHA domain-containing protein 4.9  90 AT2G33770 PHO2 ATUBC24, UBIQUITIN-CONJUGATING ENZYME 24, UBC24, UBIQUITIN- 4.8 CONJUGATING ENZYME 24  91 AT4G11110 SPA2 SPA1-related 2 4.8  92 AT1G73700 MATE efflux family protein 4.7  93 AT3G22400 LOX5 PLAT/LH2 domain-containing lipoxygenase family protein 4.6  94 AT1G80820 CCR2 ATCCR2 4.6  95 AT3G30775 ERD5 AT-POX, ATPDH, ATPOX, ARABIDOPSIS THALIANA PROLINE 4.5 OXIDASE, PDH1, proline dehydrogenase 1, PRO1, PRODH, PROLINE DEHYDROGENASE  96 AT4G00440 TRM15 GPI-anchored adhesin-like protein, putative (DUF3741) 4.5  97 ATIG10600 AMSH2 associated molecule with the SH3 domain of STAM 2 4.5  98 AT3G08620 RNA-binding KH domain-containing protein 4.4  99 AT5G09920 NRPB4 RNA polymerase II, Rpb4, core protein 4.4 100 AT1G76940 RNA-binding (RRM/RBD/RNP motifs) family protein 4.4 101 AT3G20300 extracellular ligand-gated ion channel protein (DUF3537) 4.4 102 AT1G22410 Class-II DAHP synthetase family protein 4.3 103 AT3G23530 Cyclopropane-fatty-acyl-phospholipid synthase 4.3 104 AT3G54460 SNF2 domain-containing protein/helicase domain-containing 4.3 protein/F-box family protein 105 AT4G21110 G10 family protein 4.3 106 AT3G24315 AtSec20 Sec20 family protein 4.2 107 AT2G22190 TPPE Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 4.2 108 AT2G05070 LHCB2.2 LHCB2, LIGHT-HARVESTING CHLOROPHYLL B-BINDING 2 4.2 109 AT3G03910 GDH3 glutamate dehydrogenase 3 4.1 110 AT5G51940 NRPB6A RNA polymerase Rpb6 4.1 111 AT3G59140 ABCC10 ATMRP14, multidrug resistance-associated protein 14, 4.1 MRP14, multidrug resistance-associated protein 14 112 AT3G16360 AHP4 HPT phosphotransmitter 4 4.1 113 AT4G11920 CCS52A2 FZRI, FIZZY-RELATED 1 4.0 114 AT5G15260 ribosomal protein L34e superfamily protein 3.9 115 AT5G10350 RNA-binding (RRM/RBD/RNP motifs) family protein 3.9 116 AT5G67320 HOS15 WD-40 repeat family protein 3.9 117 AT3G08940 LHCB4.2 light harvesting complex photosystem II 3.8 118 AT3G15095 HCF243 Serine/Threonine-kinase pakA-like protein 3.8 119 AT5G17920 ATMS1 ATCIMS, COBALAMIN-INDEPENDENT METHIONINE SYNTHASE, ATMETS 3.8 120 AT4G12800 PSAL photosystem I subunit 1 3.7 121 AT3G13360 WIP3 WPP domain interacting protein 3 3.7 122 AT1G47330 methyltransferase, putative (DUF21) 3.6 123 AT4G11910 NYE2, STAY-GREEN-like protein 3.6 NONYELLOWING 2, SGR2, STAY-GREEN 2 124 AT2G26810 Putative methyltransferase family protein 3.6 125 AT1G52570 PLDALPHA2 phospholipase D alpha 2 3.6 126 AT1G71960 ABCG25 ATABCG25, Arabidopsis thaliana ATP-binding cassette G25 3.6 127 AT1G36380 transmembrane protein 3.5 128 AT4G32750 transmembrane protein 3.5 129 AT2G36750 UGT73C1 UDP-glucosyl transferase 73C1 3.4 130 AT2G40890 CYP98A3 REF8, REDUCED EPIDERMAL FLUORESCENCE 8 3.4 131 AT2G18196 Heavy metal transport/detoxification superfamily protein 3.4 132 AT2G28060 KIN&#946;3 5′-AMP-activated protein kinase beta-2 subunit protein 3.3 133 AT2G19860 HXK2 ATHXK2, ARABIDOPSIS THALIANA HEXOKINASE 2 3.3 134 AT5G51040 SDHAF2 succinate dehydrogenase assembly factor 3.2 135 AT5G53400 BOB1 HSP20-like chaperones superfamily protein 3.2 136 AT1G49350 pfkB-like carbohydrate kinase family protein 3.2 137 AT2G30950 VAR2 FTSH2 3.2 138 AT3G15970 NUP50 protein Nucleoporin 50 kDa 3.1 139 AT1G15820 LHCB6 CP24 3.1 140 AT2G45695 URM11 Ubiquitin related modifier 1 3.1 141 AT1G79110 BRG2 zinc ion binding protein 3.1 142 AT2G36380 ABCG34 ATPDR6, PLEIOTROPIC DRUG RESISTANCE 6, PDR6, pleiotropic drug 3.0 resistance 6 143 AT3G05170 Phosphoglycerate mutase family protein 2.9 144 AT5G16570 GLN1; 4 glutamine synthetase 1; 4 2.9 145 AT1G79630 Protein phosphatase 2C family protein 2.9 146 AT3G46450 SEC14 cytosolic factor 2.9 family protein/ phosphoglyceride transfer family protein 147 AT5G48870 SAD1 AtLSM5, AtSAD1, LSM5, SM-like 5 2.9 148 AT2G25910 3′-5′ exonuclease domain-containing protein/K homology domain- 2.9 containing protein/KH domain-containing protein 149 AT5G11760 stress response protein 2.8 150 AT4G23840 Leucine-rich repeat (LRR) family protein 2.8 151 AT5G17010 Major facilitator superfamily protein 2.8 152 AT3G09560 PAH1 ATPAH1, PHOSPHATIDIC ACID PHOSPHOHYDROLASE 1 2.8 153 AT1G79900 BAC2 Mitochondrial substrate carrier family protein 2.8 154 AT1G67250 Proteasome maturation factor UMP1 2.7 155 AT3G50360 CEN2 ATCEN2, centrin2, CEN1, CENTRIN 1 2.7 156 AT5G53760 MLO11 ATMLO11, MILDEW RESISTANCE LOCUS O 11 2.6 157 AT5G40640 transmembrane protein 2.6 158 AT1G06680 PSBP-1 OE23, OXYGEN EVOLVING COMPLEX SUBUNIT 23 KDA, OEE2, OXYGEN- 2.6 EVOLVING ENHANCER PROTEIN 2, PSII-P, PHOTOSYSTEM II SUBUNIT P 159 AT1G03600 PSB27 photosystem II family protein 2.6 160 AT1G29450 SAUR64 SMALL AUXIN UPREGULATED RNA64 2.6 161 AT3G20760 Nse4 component of Smc5/6 DNA repair complex 2.6 162 AT1G80940 Snfl kinase interactor-like protein 2.6 163 AT2G47980 SCC3 ATSCC3, SISTER-CHROMATID COHESION PROTEIN 3 2.6 164 AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 2.5 165 AT5G08170 EMB1873 ATAIH, AGMATINE IMINOHYDROLASE 2.5 166 AT1G57750 CYP96A15 MAH1, MID-CHAIN ALKANE HYDROXYLASE 1 2.5 167 AT1G77590 LACS9 long chain acyl-CoA synthetase 9 2.5 168 AT1G55610 BRL1 BRI1 like 2.5 169 AT1G51740 SYP81 ATSYP81, ATUFE1, ARABIDOPSIS THALIANA ORTHOLOG OF YEAST 2.4 UFEI (UNKNOWN FUNCTION-ESSENTIAL 1), UFE1, ORTHOLOG OF YEAST UFE1 (UNKNOWN FUNCTION-ESSENTIAL 1) 170 AT5G65010 ASN2 asparagine synthetase 2 2.4 171 AT2G25220 Protein kinase superfamily protein 2.4 172 AT5G62190 PRH75 DEAD box RNA helicase (PRH75) 2.4 173 AT4G23180 CRK10 RLK4 2.4 174 AT4G01050 TROL thylakoid rhodanese-like protein 2.3 175 AT5G57960 Hflx GTP-binding protein, HflX 2.3 176 AT5G61040 hypothetical protein 2.3 177 AT2G32320 tRNAHis guanylyltransferase 2.3 178 AT3G06270 Protein phosphatase 2C family protein 2.2 179 AT4G21215 transmembrane protein 2.2 180 AT3G14840 LIK1, LysM RLK1- Leucine-rich repeat transmembrane protein kinase 2.2 interacting kinase 1 181 AT5G46840 RNA-binding (RRM/RBD/RNP motifs) family protein 2.2 182 AT5G50580 SAE1B AT-SAE1-2 2.2 183 AT4G17670 senescence-associated family protein (DUF581) 2.2 184 AT2G07050 CAS1 cycloartenol synthase 1 2.2 185 AT4G14960 TUA6 Tubulin/FtsZ family protein 2.2 186 AT1G01420 UGT72B3 UDP-glucosyl transferase 72B3 2.2 187 AT1G10140 Uncharacterized conserved protein UCP031279 2.2 188 AT2G18040 PIN1AT peptidylprolyl cis/trans isomerase, NIMA-interacting 1 2.1 189 AT3G62270 BOR2 HCO3-transporter family, REQUIRES HIGH BORON 2 2.1 190 AT5G44070 CAD1 ARA8, ATPCS1, ARABIDOPSISTHALIANA PHYTOCHELATIN SYNTHASE 2.1 1, PCS1, PHYTOCHELATIN SYNTHASE 1 191 AT1G29500 SAUR66 SAUR-like auxin-responsive protein family, , SMALL AUXIN 2.1 UPREGULATED RNA66 192 AT1G11170 lysine ketoglutarate reductase trans-splicing-like protein (DUF707) 2.1 193 AT1G02850 BGLU11 beta glucosidase 11 2.1 194 AT5G47060 hypothetical protein (DUF581) 2.1 195 AT3G63140 CSP41A chloroplast stem-loop binding protein of 41 kDa 2.0 196 AT5G50110 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein 2.0 197 AT5G57700 BNR/Asp-box repeat family protein 2.0 198 AT5G57230 2.0 199 AT2G45210 SAUR36 SAG201, senescence-associated gene 201 2.0 200 AT5G01530 LHCB4.1 light harvesting complex photosystem II 2.0 201 AT4G39720 VQ motif-containing protein 2.0 202 AT4G26950 senescence regulator (Protein of unknown function, DUF584) 2.0 203 AT2G36840 ACR10 ACT-like superfamily protein 2.0 204 AT5G13290 CRN SOL2, SUPPRESSOR OF LLP1 2 2.0 205 AT2G35170 Histone H3 K4-specific methyltransferase SET7/9 family protein 2.0 206 AT5G02380 MT2B metallothionein 2B 1.9 207 AT5G63135 transcription termination factor 1.9 208 AT3G03780 MS2 ATMS2, methionine synthase 2 1.9 209 AT3G48750 CDC2 CDC2A, CDC2AAT, CDK2, CDKA1, CDKA; 1 1.9 210 AT1G11220 cotton fiber, putative (DUF761) 1.9 211 AT1G08380 PSAO photosystem I subunit O 1.9 212 AT2G40980 Protein kinase superfamily protein 1.9 213 AT4G16146 cAMP-regulated phosphoprotein 19-related protein 1.9 214 AT1G16860 Ubiquitin-specific protease family C19-related protein 1.8 215 AT1G56190 Phosphoglycerate kinase family protein 1.8 216 AT2G44280 Major facilitator superfamily protein 1.8 217 AT2G18740 Small nuclear ribonucleoprotein family protein 1.8 218 AT2G39050 EULS3 ArathEULS3 1.8 219 AT2G46660 CYP78A6 EOD3, enhancer of da1-1 1.8 220 AT1G76520 PILS3, PIN-LIKES 3 Auxin efflux carrier family protein 1.8 221 AT1G76270 O-fucosyltransferase family protein 1.8 222 AT2G26650 KT1 AKT1, K+ transporter 1, ATAKT1 1.8 223 AT5G43810 AGO10 PNH, PINHEAD, ZLL, ZWILLE 1.8 224 AT2G41380 S-adenosyl-L-methionine-dependent methyltransferases superfamily 1.7 protein 225 AT2G46200 U11/U12 small nuclear ribonucleoprotein 1.7 226 AT3G50820 PSBO2 OEC33, OXYGEN EVOLVING COMPLEX SUBUNIT 33 KDA, PSBO-2, 1.7 PHOTOSYSTEM II SUBUNIT O-2 227 AT4G05180 PSBQ-2 PSBQ, PHOTOSYSTEM II SUBUNIT Q, PSII-Q 1.7 228 AT4G32940 GAMMA-VPE GAMMAVPE 1.7 229 AT1G02640 BXL2 ATBXL2, BETA-XYLOSIDASE 2 1.6 230 AT5G52450 MATE efflux family protein 1.6 231 AT3G25860 LTA2 2-oxoacid dehydrogenases acyltransferase family protein 1.6 232 AT2G32415 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC 1.6 domain-containing protein 233 AT1G73350 ankyrin repeat protein 1.6 234 AT1G03475 LIN2 ATCPO-I, HEMF1 1.6 235 AT4G27820 BGLU9 beta glucosidase 9 1.6 236 AT1G12840 DET3 ATVH A-C, ARABIDOPSIS THALIANA VACUOLAR ATP SYNTHASE 1.6 SUBUNIT C 237 AT4G01670 hypothetical protein 1.6 238 AT4G36940 NAPRT1 nicotinate phosphoribosyltransferase 1 1.6 239 AT5G13980 Glycosyl hydrolase family 38 protein 1.6 240 AT4G18360 GOX3 Aldolase-type TIM barrel family protein 1.5 241 AT4G21280 PSBQA PSBQ-1, PHOTOSYSTEM II SUBUNIT Q-1, PSBQ, PHOTOSYSTEM II 1.5 SUBUNIT Q 242 AT4G12290 Copper amine oxidase family protein 1.5 243 AT4G38400 EXLA2 ATEXLA2, expansin-like A2, ATEXPL2, ATHEXP BETA 1.5 2.2, EXPL2, EXPANSIN L2 244 AT5G57330 Galactose mutarotase-like superfamily protein 1.5 245 AT2G43780 cytochrome oxidase assembly protein 1.5 246 AT4G09340 SPIa/RYanodine receptor (SPRY) domain-containing protein 1.5 247 AT4G36720 HVA22K HVA22-like protein K 1.5 248 AT4G21660 proline-rich spliceosome-associated (PSP) family protein 1.5 249 AT5G12250 TUB6 beta-6 tubulin 1.5 250 AT1G01790 KEA1 ATKEA1, K+ EFFLUX ANTI PORTER 1 1.5 251 AT3G06350 MEE32 EMB3004, EMBRYO DEFECTIVE 3004 1.4 252 AT5G61820 stress up-regulated Nod 19 protein 1.4 253 AT2G43750 OASB ACS1, ARABIDOPSIS CYSTEINE SYNTHASE 1, ATCS-B, ARABIDOPSIS 1.4 THALIANA CYSTEIN SYNTHASE-B, CPACS1, CHLOROPLAST O-ACETYLSERINE SULFHYDRYLASE 1 254 AT1G07470 Transcription factor IIA, alpha/beta subunit 1.4 255 AT2G37770 ChlAKR AKR4C9, Aldo-keto reductase family 4 member C9 1.4 256 AT1G29510 SAUR68 SAUR67, SMALL AUXIN UPREGULATED RNA 67 1.4 257 AT4G14600 Target SNARE coiled-coil domain protein 1.4 258 AT1G31330 PSAF photosystem I subunit F 1.4 259 AT5G43260 chaperone protein dnaJ-like protein 1.4 260 AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 1.4 261 AT3G05120 GID1A ATGID1A, GA INSENSITIVE DWARF1A 1.4 262 AT4G28830 S-adenosyl-L-methionine-dependent methyltransferases superfamily 1.4 protein 263 AT3G49645 FAD-binding protein 1.4 264 AT1G76080 CDSP32 ATCDSP32, ARABIDOPSIS THALIANA CHLOROPLASTIC DROUGHT- 1.3 INDUCED STRESS PROTEIN OF 32 KD 265 AT2G01490 PAHX phytanoyl-CoA dioxygenase (PhyH) family protein 1.3 266 AT2G07680 ABCC13 ATMRP11, multidrug resistance-associated protein 11, AtABCC13, 1.3 MRP11, multidrug resistance-associated protein 11 267 AT4G23150 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 1.3 268 AT2G47060 PTI1-4 Protein kinase superfamily protein 1.3 269 AT4G01370 MPK4 ATMPK4, MAP kinase 4, MAPK4 1.3 270 AT1G5445O Calcium-binding EF-hand family protein 1.3 271 AT2G41830 Uncharacterized protein 1.3 272 AT2G18600 Ubiquitin-conjugating enzyme family protein 1.3 273 AT4G24400 CIPK8 ATCIPK8, PKS11, PROTEIN KINASE 11, SnRK3.13, SNF1-RELATED 1.3 PROTEIN KINASE 3.13 274 AT4G28706 pfkB-like carbohydrate kinase family protein 1.3 275 AT1G21210 WAK4 wall associated kinase 4 1.3 276 AT5G53800 nucleic acid-binding protein 1.3 277 AT5G10840 EMP1 Endomembrane protein 70 protein family 1.3 278 AT1G33840 LURP-one-like protein (DUF567) 1.3 279 AT5G63030 GRXC1 Thioredoxin superfamily protein 1.3 280 AT2G44130 KFB39, Kelch-domain-containing F-box protein 39, KMD3, KISS ME 1.2 DEADLY 3 281 AT5G04830 Nuclear transport factor 2 (NTF2) family protein 1.2 282 AT3G15360 TRX-M4 ATHM4, ATM4, ARABIDOPSIS THIOREDOXIN M-TYPE 4 1.2 283 AT4G14880 OASA1 ATCYS-3A, CYTACS1, OLD3, ONSET OF LEAF DEATH 3 1.2 284 AT2G21390 Coatomer, alpha subunit 1.2 285 AT5G10780 ER membrane protein complex subunit-like protein 1.2 286 AT5G46910 Transcription factor jumonji (jmj) family protein/zinc finger (C5HC2 type) 1.2 family protein 287 AT1G65820 microsomal glutathione s-transferase 1.2 288 AT1G65840 PAO4 ATPAO4, polyamine oxidase 4 1.2 289 AT1G64640 ENODL8 AtENODL8 1.2 290 AT5G49830 EXO84B exocyst complex component 84B 1.2 291 AT4G13345 MEE55 Serinc-domain containing serine and sphingolipid biosynthesis 1.1 protein 292 AT5G63890 HDH ATHDH, histidinol dehydrogenase, HISN8, HISTIDINE BIOSYNTHESIS 8 1.1 293 AT3G52960 Thioredoxin superfamily protein 1.1 294 AT1G59950 NAD(P)-linked oxidoreductase superfamily protein 1.1 295 AT3G57050 CBL cystathionine beta-lyase 1.1 296 AT5G52230 MBD13 methyl-CPG-binding domain protein 13 1.1 297 AT2G27510 FD3 ATFD3, ferredoxin 3 1.1 298 AT5G15780 Pollen Ole e l allergen and extensin family protein 1.1 299 AT1G67570 zinc finger CONSTANS-like protein (DUF3537) 1.1 300 AT5G06230 TBL9 TRICHOME BIREFRINGENCE-LIKE 9 1.1 301 AT4G27270 Quinone reductase family protein 1.1 302 AT1G15410 aspartate-glutamate racemase family 1.1 303 AT3G47000 Glycosyl hydrolase family protein 1.1 304 AT5G22740 CSLA02 ATCSLA02, ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE 1.1 A02, ATCSLA2, ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE A2, CSLA2, CELLULOSE SYNTHASE-LIKE A 2 305 AT4G39400 BRI1 ATBRI1, BIN1, BR INSENSITIVE 1, CBB2, CABBAGE 2, DWF2, DWARF 2 1.1 306 AT1G77460 CSI3 CELLULOSE SYNTHASE INTERACTIVE 3 1.0 307 AT5G14880 KUP8 Potassium transporter family protein 1.0 308 AT3G47470 LHCA4 CAB4 1.0 309 AT4G39640 GGT1 gamma-glutamyl transpeptidase 1 1.0 310 AT2G06010 ORG4 OBP3-responsive protein 4 (ORG4) 1.0 311 AT5G61220 LYR family of Fe/S cluster biogenesis protein 1.0 312 AT3G28740 CYP81D11 Cytochrome P450 superfamily protein 1.0 313 AT4G33950 OST1 ATOST1, OPEN STOMATA l, P44, SNRK2-6, SUCROSE NONFERMENTING 1.0 1-RELATED PROTEIN KINASE 2-6, SNRK2.6, SNFl-RELATED PROTEIN KINASE 2.6, SRK2E 314 AT1G01560 MPK11 ATMPK11, MAP kinase 11 1.0 315 AT3G23090 WDL3 TPX2 (targeting protein for Xklp2) protein family 1.0 316 AT4G09750 NAD(P)-binding Rossmann-fold superfamily protein 1.0 317 AT3G54890 LHCA1 chlorophyll a-b binding protein 6 1.0 318 AT3G46780 PTAC16 plastid transcriptionally active 16 0.9 319 AT5G40440 MKK3 ATMKK3, mitogen-activated protein kinase kinase 3 0.9 320 AT4G23230 CRK15 cysteine-rich RECEPTOR-like kinase 0.9 321 AT4G10840 KLCR1 Tetratricopeptide repeat (TPR)-like superfamily protein 0.9 322 AT4G37400 CYP81F3 cytochrome P450, family 81, subfamily F, polypeptide 3 0.9 323 AT5G67570 DG1 EMB1408, embryo defective 1408, EMB246, EMBRYO DEFECTIVE 246 0.9 324 AT2G41050 PQ-loop repeat family protein/transmembrane family protein 0.9 325 AT1G01620 PIP1C PIP1; 3, PLASMA MEMBRANE INTRINSIC PROTEIN 1; 3, TMP-B 0.9 326 AT3G21055 PSBTN photosystem II subunit T 0.9 327 AT4G15910 DI21 ATDI21, drought-induced 21 0.9 328 AT1G53470 MSL4 mechanosensitive channel of small conductance-like 4 0.9 329 AT1G14290 SBH2 AtSBH2 0.9 330 AT2G42960 Protein kinase superfamily protein 0.9 331 AT1G71080 RNA polymerase II transcription elongation factor 0.9 332 AT5G63970 RGLG3 Copine (Calcium-dependent phospholipid-binding protein) family 0.9 333 AT5G35100 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 0.9 334 AT1G14000 VIK VHl-interacting kinase 0.9 335 AT3G47050 Glycosyl hydrolase family protein 0.8 336 AT1G17600 Disease resistance protein (TIR-NBS-LRR class) family 0.8 337 AT3G12290 Amino acid dehydrogenase family protein 0.8 338 AT5G65620 OOP Zincin-like metalloproteases family protein, organellar 0.8 oligopeptidase, TOP1, thimet metalloendopeptidase 1 339 AT4G28750 PSAE-1 Photosystem 1 reaction centre subunit IV/PsaE protein 0.8 340 AT1G65800 RK2 ARK2, receptor kinase 2, AtARK2 0.8 341 AT1G75690 LQY1 DnaJ/Hsp40 cysteine-rich domain superfamily protein 0.8 342 AT4G01150 CURT1A CURVATURE THYLAKOID 1A-like protein 0.8 343 AT1G03680 THM1 ATHM1, thioredoxin M-type 1, ATM1, ARABIDOPSIS THIOREDOXIN 0.8 M-TYPE 1, TRX-M1, THIOREDOXIN M-TYPE 1 344 AT4G33040 Thioredoxin superfamily protein 0.8 345 AT4G32260 PDE334 ATPase, F0 complex, subunit B/B′, bacterial/chloroplast 0.8 346 AT2G34730 myosin heavy chain-like protein 0.8 347 AT3G09830 PCRK1 Protein kinase superfamily protein 0.8 348 AT4G09510 CINV2 A/N-lnvl, alkaline/neutral invertase 1 0.8 349 AT1G04820 TUA4 TOR2, TORTIFOLIA 2 0.8 350 AT5G62200 Embryo-specific protein 3, (ATS3) 0.8 351 AT1G17170 GSTU24 ATGSTU24, glutathione S-transferase TAU 24, GST, Arabidopsis thaliana 0.8 Glutathione S-transferase (class tau) 24 352 AT5G4647O RPS6 disease resistance protein (TIR-NBS-LRR class) family 0.8 353 AT5G6514O TPPJ Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 0.8 354 AT5G64040 PSAN photosystem 1 reaction center subunit PSI-N, chloroplast, putative/ 0.8 PSI-N, putative (PSAN) 355 AT1G65930 cICDH cytosolic NADP+-dependent isocitrate dehydrogenase 0.8 356 AT5G2381O AAP7 amino acid permease 7 0.7 357 AT2G24395 chaperone protein dnaJ-like protein 0.7 358 AT2G42220 Rhodanese/Cell cycle control phosphatase superfamily protein 0.7 359 AT1G14910 ENTH/ANTH/VHS superfamily protein 0.7 360 AT1G72230 Cupredoxin superfamily protein 0.7 361 AT4G11530 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 0.7 362 AT3G14690 CYP72A15 cytochrome P450, family 72, subfamily A, polypeptide 15 0.7 363 AT4G09570 CPK4 ATCPK4 0.7 364 AT5G28080 WNK9 Protein kinase superfamily protein 0.7 365 AT1G01180 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein 0.7 366 AT1G67500 REV3 ATREV3, recovery protein 3 0.7 367 AT3G47090 Leucine-rich repeat protein kinase family protein 0.7 368 AT2G36800 DOGT1 UGT73C5, UDP-GLUCOSYL TRANSFERASE 73C5 0.7 369 AT5G43940 HOT5 ADH2, ALCOHOL DEHYDROGENASE 2, ATGSNOR1, GSNOR, S- 0.7 NITROSOGLUTATHIONE REDUCTASE, PAR2, PARAQUAT RESISTANT 2 370 AT1G22610 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein 0.7 371 AT2G41740 VLN2 ATVLN2 0.7 372 AT5G50100 Putative thiol-disulfide oxidoreductase DCC 0.7 373 AT4G03110 RBP-DR1 AtBRN1, AtRBP-DR1, RNA-binding protein-defense related 1, 0.7 BRN1, Bruno-like 1 374 AT5G47770 FPS1 farnesyl diphosphate synthase 1 0.7 375 AT1G78460 SOUL heme-binding family protein 0.7 376 AT5G41000 YSL4 AtYSL4 0.7 377 AT1G33490 E3 ubiquitin-protein ligase 0.7 378 AT2G06520 PSBX photosystem II subunit X 0.7 379 AT1G76140 Prolyl oligopeptidase family protein 0.7 380 AT1G55670 PSAG photosystem I subunit G 0.6 381 AT5G01880 DAFL2, RING/U-box superfamily protein 0.6 DAF-Like gene 2 382 AT4G22920 NYE1 ATNYE1, NON-YELLOWING 1, SGR1, STAY-GREEN 1, SGR, STAY-GREEN 0.6 383 AT2G26910 ABCG32 ATPDR4, PLEIOTROPIC DRUG RESISTANCE 4, AtABCG32, PDR4, 0.6 pleiotropic drug resistance 4, PEC1, PERMEABLE CUTICLE 1 384 AT1G80380 P-loop containing nucleoside triphosphate hydrolases superfamily protein 0.6 385 AT3G06890 transmembrane protein 0.6 386 AT3G46460 UBC13 ubiquitin-conjugating enzyme 13 0.6 387 AT1G13195 RING/U-box superfamily protein 0.6 388 AT1G17710 PEPC1 AtPEPCl, Arabidopsis thaliana phosphoethanolamine/phosphocholine 0.6 phosphatase 1 389 AT4G28070 AFGl-like ATPase family protein 0.6 390 AT3G13620 PUT4 Amino acid permease family protein 0.6 391 AT4G33540 metallo-beta-lactamase family protein 0.6 392 AT2G39705 RTFL8 DVL11, DEVIL 11 0.6 393 AT2G43820 UGT74F2 ATSAGTl1 Arabidopsis thaliana salicylic acid glucosyltransferase 1, GT, 0.6 SAGT1, salicylic acid glucosyltransferase 1, SGT1, UDP-glucose: salicylic acid glucosyltransferase l 394 AT1G74410 RING/U-box superfamily protein 0.6 395 AT4G24670 TAR2 tryptophan aminotransferase related 2 0.6 396 AT1G59670 GSTU15 ATGSTU15, glutathione S-transferase TAU 15 0.6 397 AT2G22170 PLAT2 Lipase/lipooxygenase, PLAT/LH2 family protein 0.6 398 AT1G80860 PLMT ATPLMT, ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE 0.6 399 AT2G35130 Tetratricopeptide repeat (TPR)-like superfamily protein 0.6 400 AT1G16110 WAKL6 wall associated kinase-like 6 0.6 401 AT4G38060 CCI2, Clavata complex hypothetical protein 0.6 interactor 2 402 AT1G7653O PILS4, PIN-LIKES 4 Auxin efflux carrier family protein 0.6 403 AT2G26400 ARD3 ARD, ACIREDUCTONE DIOXYGENASE, ATARD3, acireductone 0.6 dioxygenase 3 404 AT1G48600 PMEAMT AtPMEAMT 0.6 405 AT1G16260 Wall-associated kinase family protein 0.6 406 AT2G34420 LHB1B2 LHCB1.5, PHOTOSYSTEM II LIGHT HARVESTING COMPLEX GENE 1.5 0.6 407 AT4G23400 PIP1; 5 PIPID 0.6 408 AT2G30550 DALL3, DAD1-Like alpha/beta-Hydrolases superfamily protein 0.6 Lipase 3 409 AT1G24170 LGT9 Nucleotide-diphospho-sugar transferases superfamily protein 0.6 410 AT1G13750 ATPAP1, Purple acid phosphatases superfamily protein 0.5 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, PAP1, PURPLE ACID PHOSPHATASE 1 411 AT4G04640 ATPC1 ATPase, F1 complex, gamma subunit protein 0.5 412 AT4G24460 CLT2 CRT (chloroquine-resistance transporter)-like transporter 2 0.5 413 AT3G63010 GID1B ATGIDIB 0.5 414 AT5G59290 UXS3 ATUXS3 0.5 415 AT5G66850 MAPKKK5 mitogen-activated protein kinase kinase kinase 5 0.5 416 AT4G02770 PSAD-1 photosystem I subunit D-1 0.5 417 AT1G30380 PSAK photosystem I subunit K 0.5 418 AT1G28440 HSL1 HAESA-like 1 0.5 419 AT3G21600 Senescence/dehydration-associated protein-like protein 0.5 420 AT1G21270 WAK2 wall-associated kinase 2 0.5 421 AT4G34150 Calcium-dependent lipid-binding (CaLB domain) family protein 0.5 422 AT3G19270 CYP707A4 cytochrome P450, family 707, subfamily A, polypeptide 4 0.5 423 AT5G12010 nuclease 0.5 424 AT2G24170 Endomembrane protein 70 protein family 0.5 425 AT1G07650 Leucine-rich repeat transmembrane protein kinase 0.5 426 AT5G13120 Pnsl5 ATCYP20-2, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, CYP20-2, 0.5 cyclophilin 20-2 427 AT5G33320 CUE1 ARAPPT, ARABIDOPSIS THALIANA 0.5 PHOSPHATE/PHOSPHOENOLPYRUVATE TRANSLOCATOR, PPT, PHOSPHOENOLPYRUVATE/PHOSPHATE TRANSLOCATOR 428 AT4G10340 LHCB5 light harvesting complex of photosystem II 5 0.5 429 AT3G61470 LHCA2 photosystem 1 light harvesting complex protein 0.5 430 AT5G43150 elongation factor 0.5 431 AT5G44060 embryo sac development arrest protein 0.5 432 AT5G16400 TRXF2 ATF2 0.5 433 AT5G14200 IMD1 ATIMD1, ARABIDOPSIS ISOPROPYLMALATE DEHYDROGENASE 1 0.5 434 AT1G05630 5PTASE13 AT5PTASE13, Arabidopsis thaliana inositol-polyphosphate 5- 0.5 phosphatase 13 435 AT1G50010 TUA2 tubulin alpha-2 chain 0.5 436 AT3G17180 scpl33 serine carboxypeptidase-like 33 0.5 437 AT2G36310 URH1 NSH1, nucleoside hydrolase 1 0.5 438 AT1G63840 RING/U-box superfamily protein 0.5 439 AT1G20110 FREE1, FYVE domain protein required for endosomal sorting 1, FYVE1, 0.5 FYVE-domain protein 1 440 AT1G79270 ECT8 evolutionarily conserved C-terminal region 8 0.4 441 AT2G30570 PSBW photosystem II reaction center W 0.4 442 AT3G50910 netrin receptor DCC 0.4 443 AT2G42070 NUDX23 ATNUDT23, ARABIDOPSIS THALIANA NUDIX HYDROLASE HOMOLOG 0.4 23, ATNUDX23, nudix hydrolase homolog 23 444 AT5G66570 PSBO1 MSP-1, MANGANESE-STABILIZING PROTEIN 1, OE33, OXYGEN 0.4 EVOLVING COMPLEX 33 KILODALTON PROTEIN, OEE1, 33 KDA OXYGEN EVOLVING POLYPEPTIDE 1, OEE33, OXYGEN EVOLVING ENHANCER PROTEIN 33, PSBO-1, PS II OXYGEN-EVOLVING COMPLEX 1 445 AT1G67060 peptidase M50B-like protein 0.4 446 AT1G34210 SERK2 ATSERK2 0.4 447 AT2G34430 LHB1B1 LHCB1.4, LIGHT-HARVESTING CHLOROPHYLL-PROTEIN COMPLEX II 0.4 SUBUNIT B1 448 AT3G52750 FTSZ2-2 Tubulin/FtsZ family protein 0.4 449 AT3G12780 PGK1 phosphoglycerate kinase 1 0.4 450 AT4G34490 CAP1 ATCAP1, cyclase associated protein 1, CAP 1 0.4 451 AT2G38120 AUX1 AtAUX1, MAP1, MODIFIER OF ARF7/NPH4 PHENOTYPES 1, PIR1, 0.4 WAV5, WAVY ROOTS 5 452 AT1G12990 beta-1, 4-N-acetylglucosaminyltransferase family protein 0.4 453 AT5G39320 UDG4 UDP-glucose 6-dehydrogenase family protein 0.4 454 AT5G06750 APD8 Protein phosphatase 2C family protein 0.4 455 AT5G11000 hypothetical protein (DUF868) 0.4 456 AT1G61520 LHCA3 PSI type III chlorophyll a/b-binding protein 0.4 457 AT1G07000 EXO70B2 ATEXO70B2, exocyst subunit exo70 family protein B2 0.4 458 AT5G07030 Eukaryotic aspartyl protease family protein 0.4 459 AT1G59700 GSTU16 ATGSTU16, glutathione S-transferase TAU 16 0.4 460 AT2G20260 PSAE-2 photosystem I subunit E-2 0.4 461 AT2G39740 HESO1 Nucleotidyltransferase family protein 0.4 462 AT3G15760 cytochrome P450 family protein 0.4 463 AT2G33730 P-loop containing nucleoside triphosphate hydrolases superfamily protein 0.4 464 AT2G36330 CASPL4A3 CASP-like protein 4A3, Uncharacterized protein family (UPFO497) 0.4 465 AT5G14540 basic salivary proline-rich-like protein (DUF1421) 0.4 466 AT4G13510 AMT1;1 ATAMT1;1, ATAMT1, ARABIDOPSIS THALIANA AMMONIUM 0.4 TRANSPORT 1 467 AT1G29910 CAB3 AB180, LHCB1.2, LIGHT HARVESTING CHLOROPHYLL A/B BINDING 0.4 PROTEIN 1.2 468 AT2G31810 ACT domain-containing small subunit of acetolactate synthase 0.4 protein 469 AT1G52190 AtNPF1.2, NPF1.2, Major facilitator superfamily protein 0.4 NRT1/PTR family 1.2, NRT1.11, nitrate transporter 1.11 470 AT5G01240 LAX1 like AUXIN RESISTANT 1 0.4 471 AT5G64090 hyccin 0.4 472 AT4G38540 FAD/NAD(P)-binding oxidoreductase family protein 0.4 473 AT3G25510 disease resistance protein (TIR-NBS-LRR class) family protein 0.4 474 AT1G75590 SAUR52 SAUR-like auxin-responsive protein family, SMALL AUXIN 0.4 UPREGULATED RNA 52 475 AT5G09930 ABCF2 ABC transporter family protein 0.4 476 AT2G14740 VSR3 ATVSR3, vaculolar sorting receptor 3, BP80-2;2, binding protein of 80 kDa 2;2, 0.4 VSR2;2, VACUOLAR SORTING RECEPTOR 2;2 477 AT5G66200 ARO2 armadillo repeat only 2 0.4 478 AT1G31540 Disease resistance protein (TIR-NBS-LRR class) family 0.4 479 AT5G62900 basic-leucine zipper transcription factor K 0.3 480 AT3G49350 Ypt/Rab-GAP domain of gyp1p superfamily protein 0.3 481 AT5G50375 CPI1 cyclopropyl isomerase 0.3 482 AT3G05520 CPA AtCPA 0.3 483 AT4G36640 Sec14p-like phosphatidylinositol transfer family protein 0.3 484 AT3G62110 Pectin lyase-like superfamily protein 0.3 485 AT4G36040 J11 DJC23, DNA J protein C23 0.3 486 AT3G56440 ATG18D ATATG18D, homolog of yeast autophagy 18 (ATG18) D 0.3 487 AT3G05350 Metallopeptidase M24 family protein 0.3 488 AT3G52340 SPP2 ATSPP2, SUCROSE-PHOSPHATASE 2 0.3 489 AT1G34750 Protein phosphatase 2C family protein 0.3 490 AT5G47870 RAD52-2 ODB2, Organellar DNA-Binding protein 2, RAD52-2B 0.3 491 AT4G22380 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein 0.3 492 AT5G46110 APE2 TPT, triose-phosphate &#8260; phosphate translocator 0.3 493 AT3G63470 scpl40 serine carboxypeptidase-like 40 0.3 494 AT4G39030 EDS5 SCORD3, susceptible to coronatine-deficient Pst DC3000 3, SID1, 0.3 SALICYLIC ACID INDUCTION DEFICIENT 1 495 AT3G60160 ABCC9 ATMRP9, multidrug resistance-associated protein 9, MRP9, multidrug 0.3 resistance-associated protein 9 496 AT5G53550 YSL3 ATYSL3, YELLOW STRIPE LIKE 3 0.3 497 AT4G21190 emb1417 Pentatricopeptide repeat (PPR) superfamily protein 0.3 498 AT3G16140 PSAH-1 photosystem I subunit H-1 0.3 499 AT2G36360 Galactose oxidase/kelch repeat superfamily protein 0.3 500 AT2G04630 NRPB6B RNA polymerase Rpb6 0.3 501 AT5G58220 TTL ALNS, allantoin synthase 0.3 502 AT2G45290 TKL2 Transketolase 0.3 503 AT1G13320 PP2AA3 protein phosphatase 2A subunit A3 0.3 504 AT3G58100 PDCB5 plasmodesmata callose-binding protein 5 0.3 505 AT1G20780 SAUL1 ATPUB44, ARABIDOPSIS THALIANA PLANT U-BOX 44, PUB44, 0.3 PLANT U-BOX 44 506 AT4G21380 RK3 ARK3, receptor kinase 3 0.3 507 AT4G20230 terpenoid synthase superfamily protein 0.3 508 AT3G17410 Protein kinase superfamily protein 0.3 509 AT2G40600 appr-1-p processing enzyme family protein 0.3 510 AT1G28580 GDSL-like Lipase/Acylhydrolase superfamily protein 0.3 511 AT4G23130 CRK5 RLK6, RECEPTOR-LIKE PROTEIN KINASE 6 0.3 512 AT4G27830 BGLU10 AtBGLU10 0.3 513 AT2G25520 Drug/metabolite transporter superfamily protein 0.3 514 AT1G34130 STT3B staurosporin and temperature sensitive 3-like b 0.2 515 AT4G29440 Regulator of Vps4 activity in the MVB pathway protein 0.2 516 AT1G77490 TAPX thylakoidal ascorbate peroxidase 0.2 517 AT4G38660 Pathogenesis-related thaumatin superfamily protein 0.2 518 AT3G29360 UGD2 UDP-glucose 6-dehydrogenase family protein 0.2 519 AT5G62580 ARM repeat superfamily protein 0.2 520 AT1G16670 Protein kinase superfamily protein 0.2 521 AT4G09010 TL29 APX4, ascorbate peroxidase 4 0.2 522 AT3G60690 SAUR59 SAUR-like auxin-responsive protein family, SMALL AUXIN 0.2 UPREGULATED RNA 59 523 AT2G37550 AGD7 ASP1, yeast pde1 sup, pressor 1 0.2 524 AT5G11250 Disease resistance protein (TIR-NBS-LRR class) 0.2 525 AT5G19780 TUA5 tubulin alpha-5 0.2 526 AT1G55910 ZIP11 zinc transporter 11 precursor 0.2 527 AT5G24870 RING/U-box superfamily protein 0.2 528 AT3G22840 ELIP1 ELIP 0.2 529 AT5G19770 TUA3 tubulin alpha-3 0.2 530 AT1G34630 transmembrane protein 0.2 531 AT3G55260 HEXO1 ATHEX2 0.2 532 AT4G02420 LecRK-IV.4, L-type lectin receptor kinase IV.4 0.2 533 AT1G69730 Wall-associated kinase family protein 0.2 534 AT1G66880 Protein kinase superfamily protein 0.1 535 AT4G23140 CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 0.1 536 AT2G31020 ORP1A OSBP(oxysterol binding protein)-related protein 1A 0.1 537 AT2G16950 TRN1 ATTRN1, TRANSPORTIN 1 0.1 538 AT5G48380 BIR1 BAK1-interacting receptor-like kinase 1 0.1 539 AT5G25100 Endomembrane protein 70 protein family 0.1 540 AT1G21250 WAK1 AtWAK1, PRO25 0.1 541 AT5G22770 alpha-ADR alpha-adaptin 0.1 542 AT5G60900 RLK1 receptor-like protein kinase 1 0.1 543 AT1G65790 RK1 ARK1, receptor kinase 1 0.1 544 AT5G35200 ENTH/ANTH/VHS superfamily protein 0.1 545 AT2G42900 Plant basic secretory protein (BSP) family protein 0.1 546 AT3G54100 O-fucosyltransferase family protein 0.0 547 AT4G14690 ELIP2 Chlorophyll A-B binding family protein 0.0

    [0161] Other embodiments of the disclosure will be apparent to those skilled in the art from consideration of the specification and practice of the disclosure disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the disclosure being indicated by the following claims.