Methods and compositions for diagnosis and prognosis of renal injury and renal failure

09696322 ยท 2017-07-04

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to methods and compositions for monitoring, diagnosis, prognosis, and determination of treatment regimens in subjects suffering from or suspected of having a renal injury. In particular, the invention relates to using a measured urine concentration of one or more of TIMP2 and IGFBP7 in combination with one or more of a measured serum creatinine and a measured urine output, which results are correlated to the renal status of the subject, and can be used for diagnosis, prognosis, risk stratification, staging, monitoring, categorizing and determination of further diagnosis and treatment regimens in subjects suffering or at risk of suffering from an injury to renal function, reduced renal function, and/or acute renal failure.

Claims

1. A method for evaluating renal status in a subject not exhibiting AKI as measured by RIFLE I or F, comprising: determining a measured value for a urine Metalloproteinase inhibitor 2 (TIMP2) concentration; determining a measured value for a urine Insulin-like growth factor-binding protein 7 (IGFBP7) concentration; determining a measured value for a serum creatinine concentration; determining a measured value for urine output; correlating the assay result to a risk of future AKI in the subject, wherein said correlation step comprises (i) classifying the subject as at a first risk of future AKI if the serum creatinine value is greater than or equal to 0.3 mg/dL or increased to greater than or equal to 150% (1.5-fold) of a baseline serum creatinine value for the subject, (ii) classifying the subject as at a second risk of future AKI if the urine output value is less than 0.5 mL/kg per hour for more than 6 hours, (iii) classifying the subject as at a third risk of future AKI that is greater than the first and second risks if the subject is classified at both the first risk and the second risk; and (iv) classifying the subject as at a fourth risk of future AKI that is greater than the first, second, and third risks if the subject is classified at the third risk and product of the Insulin-like growth factor-binding protein 7 value and the Metalloproteinase inhibitor 2 value is above a predetermined threshold determined from a population study to indicate an increased risk of future AKI.

2. A method according to claim 1, further comprising treating the patient if the patient is at the fourth risk, wherein the treatment comprises one or more of initiating renal replacement therapy, withdrawing delivery of compounds that are known to be damaging to the kidney, delaying or avoiding procedures that are known to be damaging to the kidney, and modifying diuretic administration.

Description

DETAILED DESCRIPTION OF THE INVENTION

(1) The present invention relates to methods and compositions for diagnosis, differential diagnosis, risk stratification, monitoring, classifying and determination of treatment regimens in subjects suffering or at risk of suffering from injury to renal function, reduced renal function and/or acute renal failure through measurement of one or more kidney injury markers. In various embodiments, a measured urine concentration of one or more of TIMP2 and IGFBP7 in combination with a measured concentration of one or more of serum creatinine and urine output are correlated to the renal status of the subject. Preferred combinations include urine TIMP2urine IGFBP7serum creatinine; urine TIMP2urine IGFBP7/urine output; urine TIMP2urine IGFBP7serum creatinine/urine output; urine TIMP2serum creatinine; urine TIMP2/urine output; urine TIMP2serum creatinine/urine output; urine IGFBP7serum creatinine; urine IGFBP7/urine output; and urine IGFBP7serum creatinine/urine output. In these expressions, the operators and / indicate multiplication and division, respectively. Other methods of combining assay results/clinical indicia can comprise the use of multivariate logistical regression, loglinear modeling, neural network analysis, n-of-m analysis, decision tree analysis, etc. This list is not meant to be limiting.

(2) For purposes of this document, the following definitions apply:

(3) As used herein, an injury to renal function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, still more preferably within 48 hours, even more preferably within 24 hours, and most preferably within 12-18 hours) measurable reduction in a measure of renal function. Such an injury may be identified, for example, by a decrease in glomerular filtration rate or estimated GFR, a reduction in urine output, an increase in serum creatinine, an increase in serum cystatin C, a requirement for renal replacement therapy, etc. Improvement in Renal Function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) measurable increase in a measure of renal function. Preferred methods for measuring and/or estimating GFR are described hereinafter.

(4) As used herein, reduced renal function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) reduction in kidney function identified by an absolute increase in serum creatinine of greater than or equal to 0.1 mg/dL (8.8 mol/L), a percentage increase in serum creatinine of greater than or equal to 20% (1.2-fold from baseline), or a reduction in urine output (documented oliguria of less than 0.5 ml/kg per hour).

(5) As used herein, acute renal failure or ARF is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) reduction in kidney function identified by an absolute increase in serum creatinine of greater than or equal to 0.3 mg/dl (26.4 mol/l), a percentage increase in serum creatinine of greater than or equal to 50% (1.5-fold from baseline), or a reduction in urine output (documented oliguria of less than 0.5 ml/kg per hour for at least 6 hours). This term is synonymous with acute kidney injury or AKI.

(6) As used herein, the terms Metalloproteinase inhibitor 2 or TIMP2 refer to one or more polypeptides present in a biological sample that are derived from the Metalloproteinase inhibitor 2 precursor. The human precursor sequence (Swiss-Prot P16035 (SEQ ID NO: 1)) is as follows:

(7) TABLE-US-00002 102030405060 MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND 708090100110120 IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG 130140150160170180 KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE 190200210220 KNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

(8) The following domains have been identified in Metalloproteinase inhibitor 2:

(9) TABLE-US-00003 Residues Length Domain ID 1-26 26 Signal peptide 27-220 194 Metalloproteinase inhibitor 2

(10) As used herein, the terms Insulin-like growth factor-binding protein 7 or IGFBP7 refer to one or more polypeptides present in a biological sample that are derived from the Insulin-like growth factor-binding protein 7 precursor. The human precursor sequence (Swiss-Prot Q16270 (SEQ ID NO: 2)) is as follows:

(11) TABLE-US-00004 102030405060 MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCC 708090100110120 PMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVC 130140150160170180 GSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS 190200210220230240 CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK 250260270280 EDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

(12) The following domains have been identified in Insulin-like growth factor-binding protein 7:

(13) TABLE-US-00005 Residues Length Domain ID 1-26 26 Signal peptide 27-282 256 Insulin-like growth factor-binding protein 7

(14) As used herein, the term relating a signal to the presence or amount of an analyte reflects the following understanding. Assay signals are typically related to the presence or amount of an analyte through the use of a standard curve calculated using known concentrations of the analyte of interest. As the term is used herein, an assay is configured to detect an analyte if an assay can generate a detectable signal indicative of the presence or amount of a physiologically relevant concentration of the analyte. Because an antibody epitope is on the order of 8 amino acids, an immunoassay configured to detect a marker of interest will also detect polypeptides related to the marker sequence, so long as those polypeptides contain the epitope(s) necessary to bind to the antibody or antibodies used in the assay. The term related marker as used herein with regard to a biomarker such as one of the kidney injury markers described herein refers to one or more fragments, variants, etc., of a particular marker or its biosynthetic parent that may be detected as a surrogate for the marker itself or as independent biomarkers. The term also refers to one or more polypeptides present in a biological sample that are derived from the biomarker precursor complexed to additional species, such as binding proteins, receptors, heparin, lipids, sugars, etc.

(15) In this regard, the skilled artisan will understand that the signals obtained from an immunoassay are a direct result of complexes formed between one or more antibodies and the target biomolecule (i.e., the analyte) and polypeptides containing the necessary epitope(s) to which the antibodies bind. While such assays may detect the full length biomarker and the assay result be expressed as a concentration of a biomarker of interest, the signal from the assay is actually a result of all such immunoreactive polypeptides present in the sample. Expression of biomarkers may also be determined by means other than immunoassays, including protein measurements (such as dot blots, western blots, chromatographic methods, mass spectrometry, etc.) and nucleic acid measurements (mRNA quatitation). This list is not meant to be limiting.

(16) The term positive going marker as that term is used herein refer to a marker that is determined to be elevated in subjects suffering from a disease or condition, relative to subjects not suffering from that disease or condition. The term negative going marker as that term is used herein refer to a marker that is determined to be reduced in subjects suffering from a disease or condition, relative to subjects not suffering from that disease or condition.

(17) The term subject as used herein refers to a human or non-human organism. Thus, the methods and compositions described herein are applicable to both human and veterinary disease. Further, while a subject is preferably a living organism, the invention described herein may be used in post-mortem analysis as well. Preferred subjects are humans, and most preferably patients, which as used herein refers to living humans that are receiving medical care for a disease or condition. This includes persons with no defined illness who are being investigated for signs of pathology.

(18) Preferably, an analyte is measured in a sample. Such a sample may be obtained from a subject, or may be obtained from biological materials intended to be provided to the subject. For example, a sample may be obtained from a kidney being evaluated for possible transplantation into a subject, and an analyte measurement used to evaluate the kidney for preexisting damage. Preferred samples are body fluid samples.

(19) The term body fluid sample as used herein refers to a sample of bodily fluid obtained for the purpose of diagnosis, prognosis, classification or evaluation of a subject of interest, such as a patient or transplant donor. In certain embodiments, such a sample may be obtained for the purpose of determining the outcome of an ongoing condition or the effect of a treatment regimen on a condition. Preferred body fluid samples include blood, serum, plasma, cerebrospinal fluid, urine, saliva, sputum, and pleural effusions. In addition, one of skill in the art would realize that certain body fluid samples would be more readily analyzed following a fractionation or purification procedure, for example, separation of whole blood into serum or plasma components.

(20) The term diagnosis as used herein refers to methods by which the skilled artisan can estimate and/or determine the probability (a likelihood) of whether or not a patient is suffering from a given disease or condition. In the case of the present invention, diagnosis includes using the results of an assay, most preferably an immunoassay, for a kidney injury marker of the present invention, optionally together with other clinical characteristics, to arrive at a diagnosis (that is, the occurrence or nonoccurrence) of an acute renal injury or ARF for the subject from which a sample was obtained and assayed. That such a diagnosis is determined is not meant to imply that the diagnosis is 100% accurate. Many biomarkers are indicative of multiple conditions. The skilled clinician does not use biomarker results in an informational vacuum, but rather test results are used together with other clinical indicia to arrive at a diagnosis. Thus, a measured biomarker level on one side of a predetermined diagnostic threshold indicates a greater likelihood of the occurrence of disease in the subject relative to a measured level on the other side of the predetermined diagnostic threshold.

(21) Similarly, a prognostic risk signals a probability (a likelihood) that a given course or outcome will occur. A level or a change in level of a prognostic indicator, which in turn is associated with an increased probability of morbidity (e.g., worsening renal function, future ARF, or death) is referred to as being indicative of an increased likelihood of an adverse outcome in a patient.

(22) Marker Assays

(23) In general, immunoassays involve contacting a sample containing or suspected of containing a biomarker of interest with at least one antibody that specifically binds to the biomarker. A signal is then generated indicative of the presence or amount of complexes formed by the binding of polypeptides in the sample to the antibody. The signal is then related to the presence or amount of the biomarker in the sample. Numerous methods and devices are well known to the skilled artisan for the detection and analysis of biomarkers. See, e.g., U.S. Pat. Nos. 6,143,576; 6,113,855; 6,019,944; 5,985,579; 5,947,124; 5,939,272; 5,922,615; 5,885,527; 5,851,776; 5,824,799; 5,679,526; 5,525,524; and 5,480,792, and The Immunoassay Handbook, David Wild, ed. Stockton Press, New York, 1994, each of which is hereby incorporated by reference in its entirety, including all tables, figures and claims.

(24) The assay devices and methods known in the art can utilize labeled molecules in various sandwich, competitive, or non-competitive assay formats, to generate a signal that is related to the presence or amount of the biomarker of interest. Suitable assay formats also include chromatographic, mass spectrographic, and protein blotting methods. Additionally, certain methods and devices, such as biosensors and optical immunoassays, may be employed to determine the presence or amount of analytes without the need for a labeled molecule. See, e.g., U.S. Pat. Nos. 5,631,171; and 5,955,377, each of which is hereby incorporated by reference in its entirety, including all tables, figures and claims. One skilled in the art also recognizes that robotic instrumentation including but not limited to Beckman ACCESS, Abbott AXSYM, Roche ELECSYS, Dade Behring STRATUS systems are among the immunoassay analyzers that are capable of performing immunoassays. But any suitable immunoassay may be utilized, for example, enzyme-linked immunoassays (ELISA), radioimmunoassays (RIAs), competitive binding assays, and the like.

(25) Antibodies or other polypeptides may be immobilized onto a variety of solid supports for use in assays. Solid phases that may be used to immobilize specific binding members include include those developed and/or used as solid phases in solid phase binding assays. Examples of suitable solid phases include membrane filters, cellulose-based papers, beads (including polymeric, latex and paramagnetic particles), glass, silicon wafers, microparticles, nanoparticles, TentaGels, AgroGels, PEGA gels, SPOCC gels, and multiple-well plates. An assay strip could be prepared by coating the antibody or a plurality of antibodies in an array on solid support. This strip could then be dipped into the test sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot. Antibodies or other polypeptides may be bound to specific zones of assay devices either by conjugating directly to an assay device surface, or by indirect binding. In an example of the later case, antibodies or other polypeptides may be immobilized on particles or other solid supports, and that solid support immobilized to the device surface.

(26) Biological assays require methods for detection, and one of the most common methods for quantitation of results is to conjugate a detectable label to a protein or nucleic acid that has affinity for one of the components in the biological system being studied. Detectable labels may include molecules that are themselves detectable (e.g., fluorescent moieties, electrochemical labels, metal chelates, etc.) as well as molecules that may be indirectly detected by production of a detectable reaction product (e.g., enzymes such as horseradish peroxidase, alkaline phosphatase, etc.) or by a specific binding molecule which itself may be detectable (e.g., biotin, digoxigenin, maltose, oligohistidine, 2,4-dintrobenzene, phenylarsenate, ssDNA, dsDNA, etc.).

(27) Preparation of solid phases and detectable label conjugates often comprise the use of chemical cross-linkers. Cross-linking reagents contain at least two reactive groups, and are divided generally into homofunctional cross-linkers (containing identical reactive groups) and heterofunctional cross-linkers (containing non-identical reactive groups). Homobifunctional cross-linkers that couple through amines, sulfhydryls or react non-specifically are available from many commercial sources. Maleimides, alkyl and aryl halides, alpha-haloacyls and pyridyl disulfides are thiol reactive groups. Maleimides, alkyl and aryl halides, and alpha-haloacyls react with sulfhydryls to form thiol ether bonds, while pyridyl disulfides react with sulfhydryls to produce mixed disulfides. The pyridyl disulfide product is cleavable. Imidoesters are also very useful for protein-protein cross-links. A variety of heterobifunctional cross-linkers, each combining different attributes for successful conjugation, are commercially available.

(28) In certain aspects, the present invention provides kits for the analysis of the described kidney injury markers. The kit comprises reagents for the analysis of at least one test sample which comprise at least one antibody that a kidney injury marker. The kit can also include devices and instructions for performing one or more of the diagnostic and/or prognostic correlations described herein. Preferred kits will comprise an antibody pair for performing a sandwich assay, or a labeled species for performing a competitive assay, for the analyte. Preferably, an antibody pair comprises a first antibody conjugated to a solid phase and a second antibody conjugated to a detectable label, wherein each of the first and second antibodies that bind a kidney injury marker. Most preferably each of the antibodies are monoclonal antibodies. The instructions for use of the kit and performing the correlations can be in the form of labeling, which refers to any written or recorded material that is attached to, or otherwise accompanies a kit at any time during its manufacture, transport, sale or use. For example, the term labeling encompasses advertising leaflets and brochures, packaging materials, instructions, audio or video cassettes, computer discs, as well as writing imprinted directly on kits.

(29) Antibodies

(30) The term antibody as used herein refers to a peptide or polypeptide derived from, modeled after or substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, capable of specifically binding an antigen or epitope. See, e.g. Fundamental Immunology, 3rd Edition, W. E. Paul, ed., Raven Press, N.Y. (1993); Wilson (1994; J. Immunol. Methods 175:267-273; Yarmush (1992) J. Biochem. Biophys. Methods 25:85-97. The term antibody includes antigen-binding portions, i.e., antigen binding sites, (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term antibody.

(31) Antibodies used in the immunoassays described herein preferably specifically bind to a kidney injury marker of the present invention. The term specifically binds is not intended to indicate that an antibody binds exclusively to its intended target since, as noted above, an antibody binds to any polypeptide displaying the epitope(s) to which the antibody binds. Rather, an antibody specifically binds if its affinity for its intended target is about 5-fold greater when compared to its affinity for a non-target molecule which does not display the appropriate epitope(s). Preferably the affinity of the antibody will be at least about 5 fold, preferably 10 fold, more preferably 25-fold, even more preferably 50-fold, and most preferably 100-fold or more, greater for a target molecule than its affinity for a non-target molecule. In preferred embodiments, Preferred antibodies bind with affinities of at least about 10.sup.7 M.sup.1, and preferably between about 10.sup.8 M.sup.1 to about 10.sup.9 M.sup.1, about 10.sup.9 M.sup.1 to about 10.sup.10 M.sup.1, or about 10.sup.10 M.sup.1 to about 10.sup.12 M.sup.1.

(32) Affinity is calculated as K.sub.d=k.sub.off/k.sub.on (k.sub.off is the dissociation rate constant, K.sub.on is the association rate constant and K.sub.d is the equilibrium constant). Affinity can be determined at equilibrium by measuring the fraction bound (r) of labeled ligand at various concentrations (c). The data are graphed using the Scatchard equation: r/c=K(nr): where r=moles of bound ligand/mole of receptor at equilibrium; c=free ligand concentration at equilibrium; K=equilibrium association constant; and n=number of ligand binding sites per receptor molecule. By graphical analysis, r/c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot. Antibody affinity measurement by Scatchard analysis is well known in the art. See, e.g., van Erp et al., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput. Methods Programs Biomed. 27: 65-8, 1988.

(33) The term epitope refers to an antigenic determinant capable of specific binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.

(34) Numerous publications discuss the use of phage display technology to produce and screen libraries of polypeptides for binding to a selected analyte. See, e.g, Cwirla et al., Proc. Natl. Acad. Sci. USA 87, 6378-82, 1990; Devlin et al., Science 249, 404-6, 1990, Scott and Smith, Science 249, 386-88, 1990; and Ladner et al., U.S. Pat. No. 5,571,698. A basic concept of phage display methods is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide. This physical association is provided by the phage particle, which displays a polypeptide as part of a capsid enclosing the phage genome which encodes the polypeptide. The establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides. Phage displaying a polypeptide with affinity to a target bind to the target and these phage are enriched by affinity screening to the target. The identity of polypeptides displayed from these phage can be determined from their respective genomes. Using these methods a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means. See, e.g., U.S. Pat. No. 6,057,098, which is hereby incorporated in its entirety, including all tables, figures, and claims.

(35) The antibodies that are generated by these methods may then be selected by first screening for affinity and specificity with the purified polypeptide of interest and, if required, comparing the results to the affinity and specificity of the antibodies with polypeptides that are desired to be excluded from binding. The screening procedure can involve immobilization of the purified polypeptides in separate wells of microtiter plates. The solution containing a potential antibody or groups of antibodies is then placed into the respective microtiter wells and incubated for about 30 min to 2 h. The microtiter wells are then washed and a labeled secondary antibody (for example, an anti-mouse antibody conjugated to alkaline phosphatase if the raised antibodies are mouse antibodies) is added to the wells and incubated for about 30 min and then washed. Substrate is added to the wells and a color reaction will appear where antibody to the immobilized polypeptide(s) are present.

(36) The antibodies so identified may then be further analyzed for affinity and specificity in the assay design selected. In the development of immunoassays for a target protein, the purified target protein acts as a standard with which to judge the sensitivity and specificity of the immunoassay using the antibodies that have been selected. Because the binding affinity of various antibodies may differ; certain antibody pairs (e.g., in sandwich assays) may interfere with one another sterically, etc., assay performance of an antibody may be a more important measure than absolute affinity and specificity of an antibody.

(37) While the present application describes antibody-based binding assays in detail, alternatives to antibodies as binding species in assays are well known in the art. These include receptors for a particular target, aptamers, etc. Aptamers are oligonucleic acid or peptide molecules that bind to a specific target molecule. Aptamers are usually created by selecting them from a large random sequence pool, but natural aptamers also exist. High-affinity aptamers containing modified nucleotides conferring improved characteristics on the ligand, such as improved in vivo stability or improved delivery characteristics. Examples of such modifications include chemical substitutions at the ribose and/or phosphate and/or base positions, and may include amino acid side chain functionalities.

(38) Assay Correlations

(39) The term correlating as used herein in reference to the use of biomarkers refers to comparing the presence or amount of the biomarker(s) in a patient to its presence or amount in persons known to suffer from, or known to be at risk of, a given condition; or in persons known to be free of a given condition. Often, this takes the form of comparing an assay result in the form of a biomarker concentration to a predetermined threshold selected to be indicative of the occurrence or nonoccurrence of a disease or the likelihood of some future outcome.

(40) Selecting a diagnostic threshold involves, among other things, consideration of the probability of disease, distribution of true and false diagnoses at different test thresholds, and estimates of the consequences of treatment (or a failure to treat) based on the diagnosis. For example, when considering administering a specific therapy which is highly efficacious and has a low level of risk, few tests are needed because clinicians can accept substantial diagnostic uncertainty. On the other hand, in situations where treatment options are less effective and more risky, clinicians often need a higher degree of diagnostic certainty. Thus, cost/benefit analysis is involved in selecting a diagnostic threshold.

(41) Suitable thresholds may be determined in a variety of ways. For example, one recommended diagnostic threshold for the diagnosis of acute myocardial infarction using cardiac troponin is the 97.5th percentile of the concentration seen in a normal population. Another method may be to look at serial samples from the same patient, where a prior baseline result is used to monitor for temporal changes in a biomarker level.

(42) Population studies may also be used to select a decision threshold. Reciever Operating Characteristic (ROC) arose from the field of signal dectection therory developed during World War II for the analysis of radar images, and ROC analysis is often used to select a threshold able to best distinguish a diseased subpopulation from a nondiseased subpopulation. A false positive in this case occurs when the person tests positive, but actually does not have the disease. A false negative, on the other hand, occurs when the person tests negative, suggesting they are healthy, when they actually do have the disease. To draw a ROC curve, the true positive rate (TPR) and false positive rate (FPR) are determined as the decision threshold is varied continuously. Since TPR is equivalent with sensitivity and FPR is equal to 1-specificity, the ROC graph is sometimes called the sensitivity vs (1-specificity) plot. A perfect test will have an area under the ROC curve of 1.0; a random test will have an area of 0.5. A threshold is selected to provide an acceptable level of specificity and sensitivity.

(43) In this context, diseased is meant to refer to a population having one characteristic (the presence of a disease or condition or the occurrence of some outcome) and nondiseased is meant to refer to a population lacking the characteristic. While a single decision threshold is the simplest application of such a method, multiple decision thresholds may be used. For example, below a first threshold, the absence of disease may be assigned with relatively high confidence, and above a second threshold the presence of disease may also be assigned with relatively high confidence. Between the two thresholds may be considered indeterminate. This is meant to be exemplary in nature only.

(44) In addition to threshold comparisons, other methods for correlating assay results to a patient classification (occurrence or nonoccurrence of disease, likelihood of an outcome, etc.) include decision trees, rule sets, Bayesian methods, and neural network methods. These methods can produce probability values representing the degree to which a subject belongs to one classification out of a plurality of classifications.

(45) Measures of test accuracy may be obtained as described in Fischer et al., Intensive Care Med. 29: 1043-51, 2003, and used to determine the effectiveness of a given biomarker. These measures include sensitivity and specificity, predictive values, likelihood ratios, diagnostic odds ratios, and ROC curve areas. The area under the curve (AUC) of a ROC plot is equal to the probability that a classifier will rank a randomly chosen positive instance higher than a randomly chosen negative one. The area under the ROC curve may be thought of as equivalent to the Mann-Whitney U test, which tests for the median difference between scores obtained in the two groups considered if the groups are of continuous data, or to the Wilcoxon test of ranks.

(46) As discussed above, suitable tests may exhibit one or more of the following results on these various measures: a specificity of greater than 0.5, preferably at least 0.6, more preferably at least 0.7, still more preferably at least 0.8, even more preferably at least 0.9 and most preferably at least 0.95, with a corresponding sensitivity greater than 0.2, preferably greater than 0.3, more preferably greater than 0.4, still more preferably at least 0.5, even more preferably 0.6, yet more preferably greater than 0.7, still more preferably greater than 0.8, more preferably greater than 0.9, and most preferably greater than 0.95; a sensitivity of greater than 0.5, preferably at least 0.6, more preferably at least 0.7, still more preferably at least 0.8, even more preferably at least 0.9 and most preferably at least 0.95, with a corresponding specificity greater than 0.2, preferably greater than 0.3, more preferably greater than 0.4, still more preferably at least 0.5, even more preferably 0.6, yet more preferably greater than 0.7, still more preferably greater than 0.8, more preferably greater than 0.9, and most preferably greater than 0.95; at least 75% sensitivity, combined with at least 75% specificity; a ROC curve area of greater than 0.5, preferably at least 0.6, more preferably 0.7, still more preferably at least 0.8, even more preferably at least 0.9, and most preferably at least 0.95; an odds ratio different from 1, preferably at least about 2 or more or about 0.5 or less, more preferably at least about 3 or more or about 0.33 or less, still more preferably at least about 4 or more or about 0.25 or less, even more preferably at least about 5 or more or about 0.2 or less, and most preferably at least about 10 or more or about 0.1 or less; a positive likelihood ratio (calculated as sensitivity/(1-specificity)) of greater than 1, at least 2, more preferably at least 3, still more preferably at least 5, and most preferably at least 10; and or a negative likelihood ratio (calculated as (1-sensitivity)/specificity) of less than 1, less than or equal to 0.5, more preferably less than or equal to 0.3, and most preferably less than or equal to 0.1

(47) Additional clinical indicia may be combined with the kidney injury marker assay result(s) of the present invention. These include other biomarkers related to renal status. Examples include the following, which recite the common biomarker name, followed by the Swiss-Prot entry number for that biomarker or its parent: Actin (P68133); Adenosine deaminase binding protein (DPP4, P27487); Alpha-1-acid glycoprotein 1 (P02763); Alpha-1-microglobulin (P02760); Albumin (P02768); Angiotensinogenase (Renin, P00797); Annexin A2 (P07355); Beta-glucuronidase (P08236); B-2-microglobulin (P61679); Beta-galactosidase (P16278); BMP-7 (P18075); Brain natriuretic peptide (proBNP, BNP-32, NTproBNP; P16860); Calcium-binding protein Beta (S100-beta, PO4271); Carbonic anhydrase (Q16790); Casein Kinase 2 (P68400); Ceruloplasmin (P00450); Clusterin (P10909); Complement C3 (P01024); Cysteine-rich protein (CYR61, 000622); Cytochrome C (P99999); Epidermal growth factor (EGF, P01133); Endothelin-1 (P05305); Exosomal Fetuin-A (P02765); Fatty acid-binding protein, heart (FABP3, P05413); Fatty acid-binding protein, liver (P07148); Ferritin (light chain, P02793; heavy chain P02794); Fructose-1,6-biphosphatase (P09467); GRO-alpha (CXCL1, (P09341); Growth Hormone (P01241); Hepatocyte growth factor (P14210); Insulin-like growth factor I (P01343); Immunoglobulin G; Immunoglobulin Light Chains (Kappa and Lambda); Interferon gamma (P01308); Lysozyme (P61626); Interleukin-1alpha (P01583); Interleukin-2 (P60568); Interleukin-4 (P60568); Interleukin-9 (P15248); Interleukin-12p40 (P29460); Interleukin-13 (P35225); Interleukin-16 (Q14005); L1 cell adhesion molecule (P32004); Lactate dehydrogenase (P00338); Leucine Aminopeptidase (P28838); Meprin A-alpha subunit (Q16819); Meprin A-beta subunit (Q16820); Midkine (P21741); MIP2-alpha (CXCL2, P19875); MMP-2 (P08253); MMP-9 (P14780); Netrin-1 (095631); Neutral endopeptidase (P08473); Osteopontin (P10451); Renal papillary antigen 1 (RPA1); Renal papillary antigen 2 (RPA2); Retinol binding protein (P09455); Ribonuclease; S100 calcium-binding protein A6 (P06703); Serum Amyloid P Component (P02743); Sodium/Hydrogen exchanger isoform (NHE3, P48764); Spermidine/spermine N1-acetyltransferase (P21673); TGF-Beta1 (P01137); Transferrin (P02787); Trefoil factor 3 (TFF3, Q07654); Toll-Like protein 4 (000206); Total protein; Tubulointerstitial nephritis antigen (Q9UJW2); Uromodulin (Tamm-Horsfall protein, P07911).

(48) For purposes of risk stratification, Adiponectin (Q15848); Alkaline phosphatase (P05186); Aminopeptidase N (P15144); CalbindinD28k (P05937); Cystatin C (P01034); 8 subunit of FIFO ATPase (P03928); Gamma-glutamyltransferase (P19440); GSTa (alpha-glutathione-S-transferase, P08263); GSTpi (Glutathione-S-transferase P; GST class-pi; P09211); IGFBP-1 (P08833); IGFBP-2 (P18065); IGFBP-6 (P24592); Integral membrane protein 1 (Itm1, P46977); Interleukin-6 (P05231); Interleukin-8 (P10145); Interleukin-18 (Q14116); IP-10 (10 kDa interferon-gamma-induced protein, P02778); IRPR (IFRD1, O00458); Isovaleryl-CoA dehydrogenase (IVD, P26440); I-TAC/CXCL11 (O14625); Keratin 19 (P08727); Kim-1 (Hepatitis A virus cellular receptor 1, 043656); L-arginine:glycine amidinotransferase (P50440); Leptin (P41159); Lipocalin2 (NGAL, P80188); MCP-1 (P13500); MIG (Gamma-interferon-induced monokine Q07325); MIP-la (P10147); MIP-3a (P78556); MIP-1beta (P13236); MIP-1d (Q16663); NAG (N-acetyl-beta-D-glucosaminidase, P54802); Organic ion transporter (OCT2, O15244); Osteoprotegerin (O14788); P8 protein (O60356); Plasminogen activator inhibitor 1 (PAI-1, P05121); ProANP(1-98) (P01160); Protein phosphatase 1-beta (PPI-beta, P62140); Rab GDI-beta (P50395); Renal kallikrein (Q86U61); RT1.B-1 (alpha) chain of the integral membrane protein (Q5Y7A8); Soluble tumor necrosis factor receptor superfamily member 1A (sTNFR-I, P19438); Soluble tumor necrosis factor receptor superfamily member 1B (sTNFR-II, P20333); Tissue inhibitor of metalloproteinases 3 (TIMP-3, P35625); uPAR (Q03405) may be combined with the kidney injury marker assay result(s) of the present invention.

(49) Other clinical indicia which may be combined with the kidney injury marker assay result(s) of the present invention includes demographic information (e.g., weight, sex, age, race), medical history (e.g., family history, type of surgery, pre-existing disease such as aneurism, congestive heart failure, preeclampsia, eclampsia, diabetes mellitus, hypertension, coronary artery disease, proteinuria, renal insufficiency, or sepsis, type of toxin exposure such as NSAIDs, cyclosporines, tacrolimus, aminoglycosides, foscarnet, ethylene glycol, hemoglobin, myoglobin, ifosfamide, heavy metals, methotrexate, radiopaque contrast agents, or streptozotocin), clinical variables (e.g., blood pressure, temperature, respiration rate), risk scores (APACHE score, PREDICT score, TIMI Risk Score for UA/NSTEMI, Framingham Risk Score), a urine total protein measurement, a glomerular filtration rate, an estimated glomerular filtration rate, a urine production rate, a serum or plasma creatinine concentration, a renal papillary antigen 1 (RPA1) measurement; a renal papillary antigen 2 (RPA2) measurement; a urine creatinine concentration, a fractional excretion of sodium, a urine sodium concentration, a urine creatinine to serum or plasma creatinine ratio, a urine specific gravity, a urine osmolality, a urine urea nitrogen to plasma urea nitrogen ratio, a plasma BUN to creatnine ratio, and/or a renal failure index calculated as urine sodium/(urine creatinine/plasma creatinine). Other measures of renal function which may be combined with the kidney injury marker assay result(s) are described hereinafter and in Harrison's Principles of Internal Medicine, 17.sup.th Ed., McGraw Hill, New York, pages 1741-1830, and Current Medical Diagnosis & Treatment 2008, 47.sup.th Ed, McGraw Hill, New York, pages 785-815, each of which are hereby incorporated by reference in their entirety.

(50) Combining assay results/clinical indicia in this manner can comprise the use of multivariate logistical regression, loglinear modeling, neural network analysis, n-of-m analysis, decision tree analysis, etc. This list is not meant to be limiting.

(51) Diagnosis of Acute Renal Failure

(52) As noted above, the terms acute renal (or kidney) injury and acute renal (or kidney) failure as used herein are defined in part in terms of changes in serum creatinine from a baseline value. Most definitions of ARF have common elements, including the use of serum creatinine and, often, urine output. Patients may present with renal dysfunction without an available baseline measure of renal function for use in this comparison. In such an event, one may estimate a baseline serum creatinine value by assuming the patient initially had a normal GFR. Glomerular filtration rate (GFR) is the volume of fluid filtered from the renal (kidney) glomerular capillaries into the Bowman's capsule per unit time. Glomerular filtration rate (GFR) can be calculated by measuring any chemical that has a steady level in the blood, and is freely filtered but neither reabsorbed nor secreted by the kidneys. GFR is typically expressed in units of ml/min:

(53) GFR = Urine Concentration Urine Flow Plasma Concentration

(54) By normalizing the GFR to the body surface area, a GFR of approximately 75-100 ml/min per 1.73 m.sup.2 can be assumed. The rate therefore measured is the quantity of the substance in the urine that originated from a calculable volume of blood.

(55) There are several different techniques used to calculate or estimate the glomerular filtration rate (GFR or eGFR). In clinical practice, however, creatinine clearance is used to measure GFR. Creatinine is produced naturally by the body (creatinine is a metabolite of creatine, which is found in muscle). It is freely filtered by the glomerulus, but also actively secreted by the renal tubules in very small amounts such that creatinine clearance overestimates actual GFR by 10-20%. This margin of error is acceptable considering the ease with which creatinine clearance is measured.

(56) Creatinine clearance (CCr) can be calculated if values for creatinine's urine concentration (U.sub.Cr), urine flow rate (V), and creatinine's plasma concentration (P.sub.Cr) are known. Since the product of urine concentration and urine flow rate yields creatinine's excretion rate, creatinine clearance is also said to be its excretion rate (U.sub.CrV) divided by its plasma concentration. This is commonly represented mathematically as:

(57) C Cr = U Cr V P Cr
Commonly a 24 hour urine collection is undertaken, from empty-bladder one morning to the contents of the bladder the following morning, with a comparative blood test then taken:

(58) C Cr = U Cr 24 - hour volume P Cr 24 60 mins
To allow comparison of results between people of different sizes, the CCr is often corrected for the body surface area (BSA) and expressed compared to the average sized man as ml/min/1.73 m2. While most adults have a BSA that approaches 1.7 (1.6-1.9), extremely obese or slim patients should have their CCr corrected for their actual BSA:

(59) C Cr - corrected = C Cr 1.73 BSA

(60) The accuracy of a creatinine clearance measurement (even when collection is complete) is limited because as glomerular filtration rate (GFR) falls creatinine secretion is increased, and thus the rise in serum creatinine is less. Thus, creatinine excretion is much greater than the filtered load, resulting in a potentially large overestimation of the GFR (as much as a twofold difference). However, for clinical purposes it is important to determine whether renal function is stable or getting worse or better. This is often determined by monitoring serum creatinine alone. Like creatinine clearance, the serum creatinine will not be an accurate reflection of GFR in the non-steady-state condition of ARF. Nonetheless, the degree to which serum creatinine changes from baseline will reflect the change in GFR. Serum creatinine is readily and easily measured and it is specific for renal function.

(61) For purposes of determining urine output on a mL/kg/hr basis, hourly urine collection and measurement is adequate. In the case where, for example, only a cumulative 24-h output was available and no patient weights are provided, minor modifications of the RIFLE urine output criteria have been described. For example, Bagshaw et al., Nephrol. Dial. Transplant. 23: 1203-1210, 2008, assumes an average patient weight of 70 kg, and patients are assigned a RIFLE classification based on the following: <35 mL/h (Risk), <21 mL/h (Injury) or <4 mL/h (Failure).

(62) Selecting a Treatment Regimen

(63) Once a diagnosis is obtained, the clinician can readily select a treatment regimen that is compatible with the diagnosis, such as initiating renal replacement therapy, withdrawing delivery of compounds that are known to be damaging to the kidney, kidney transplantation, delaying or avoiding procedures that are known to be damaging to the kidney, modifying diuretic administration, initiating goal directed therapy, etc. The skilled artisan is aware of appropriate treatments for numerous diseases discussed in relation to the methods of diagnosis described herein. See, e.g., Merck Manual of Diagnosis and Therapy, 17th Ed. Merck Research Laboratories, Whitehouse Station, N J, 1999. In addition, since the methods and compositions described herein provide prognostic information, the markers of the present invention may be used to monitor a course of treatment. For example, improved or worsened prognostic state may indicate that a particular treatment is or is not efficacious.

(64) One skilled in the art readily appreciates that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention.

EXAMPLE 1

Contrast-Induced Nephropathy Sample Collection

(65) The objective of this sample collection study is to collect samples of plasma and urine and clinical data from patients before and after receiving intravascular contrast media. Approximately 250 adults undergoing radiographic/angiographic procedures involving intravascular administration of iodinated contrast media are enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

(66) Inclusion Criteria

(67) males and females 18 years of age or older; undergoing a radiographic/angiographic procedure (such as a CT scan or coronary intervention) involving the intravascular administration of contrast media; expected to be hospitalized for at least 48 hours after contrast administration. able and willing to provide written informed consent for study participation and to comply with all study procedures.
Exclusion Criteria renal transplant recipients; acutely worsening renal function prior to the contrast procedure; already receiving dialysis (either acute or chronic) or in imminent need of dialysis at enrollment;
expected to undergo a major surgical procedure (such as involving cardiopulmonary bypass) or an additional imaging procedure with contrast media with significant risk for further renal insult within the 48 hrs following contrast administration;
participation in an interventional clinical study with an experimental therapy within the previous 30 days;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus.

(68) Immediately prior to the first contrast administration (and after any pre-procedure hydration), an EDTA anti-coagulated blood sample (10 mL) and a urine sample (10 mL) are collected from each patient. Blood and urine samples are then collected at 4 (0.5), 8 (1), 24 (2) 48 (2), and 72 (2) hrs following the last administration of contrast media during the index contrast procedure. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are processed to plasma at the clinical site, frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

(69) Serum creatinine is assessed at the site immediately prior to the first contrast administration (after any pre-procedure hydration) and at 4 (0.5), 8 (1), 24 (2) and 48 (2)), and 72 (2) hours following the last administration of contrast (ideally at the same time as the study samples are obtained). In addition, each patient's status is evaluated through day 30 with regard to additional serum and urine creatinine measurements, a need for dialysis, hospitalization status, and adverse clinical outcomes (including mortality).

(70) Prior to contrast administration, each patient is assigned a risk based on the following assessment: systolic blood pressure <80 mm Hg=5 points; intra-arterial balloon pump=5 points; congestive heart failure (Class III-IV or history of pulmonary edema)=5 points; age >75 yrs=4 points; hematocrit level <39% for men, <35% for women=3 points; diabetes=3 points; contrast media volume=1 point for each 100 mL; serum creatinine level >1.5 g/dL=4 points OR estimated GFR 40-60 mL/min/1.73 m.sup.2=2 points, 20-40 mL/min/1.73 m.sup.2=4 points, <20 mL/min/1.73 m.sup.2=6 points. The risks assigned are as follows: risk for CIN and dialysis: 5 or less total points=risk of CIN7.5%, risk of dialysis0.04%; 6-10 total points=risk of CIN14%, risk of dialysis0.12%; 11-16 total points=risk of CIN26.1%, risk of dialysis1.09%; >16 total points=risk of CIN57.3%, risk of dialysis12.8%.

EXAMPLE 2

Cardiac Surgery Sample Collection

(71) The objective of this sample collection study is to collect samples of plasma and urine and clinical data from patients before and after undergoing cardiovascular surgery, a procedure known to be potentially damaging to kidney function. Approximately 900 adults undergoing such surgery are enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

(72) Inclusion Criteria

(73) males and females 18 years of age or older; undergoing cardiovascular surgery; Toronto/Ottawa Predictive Risk Index for Renal Replacement risk score of at least 2 (Wijeysundera et al., JAMA 297: 1801-9, 2007); and able and willing to provide written informed consent for study participation and to comply with all study procedures.
Exclusion Criteria known pregnancy; previous renal transplantation; acutely worsening renal function prior to enrollment (e.g., any category of RIFLE criteria); already receiving dialysis (either acute or chronic) or in imminent need of dialysis at enrollment; currently enrolled in another clinical study or expected to be enrolled in another clinical study within 7 days of cardiac surgery that involves drug infusion or a therapeutic intervention for AKI;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus.

(74) Within 3 hours prior to the first incision (and after any pre-procedure hydration), an EDTA anti-coagulated blood sample (10 mL), whole blood (3 mL), and a urine sample (35 mL) are collected from each patient. Blood and urine samples are then collected at 3 (0.5), 6 (0.5), 12 (1), 24 (2) and 48 (2) hrs following the procedure and then daily on days 3 through 7 if the subject remains in the hospital. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

EXAMPLE 3

Acutely Ill Subject Sample Collection

(75) The objective of this study is to collect samples from acutely ill patients. Approximately 1900 adults expected to be in the ICU for at least 48 hours will be enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

(76) Inclusion Criteria

(77) males and females 18 years of age or older;
Study population 1: approximately 300 patients that have at least one of: shock (SBP<90 mmHg and/or need for vasopressor support to maintain MAP>60 mmHg and/or documented drop in SBP of at least 40 mmHg); and sepsis;
Study population 2: approximately 300 patients that have at least one of: IV antibiotics ordered in computerized physician order entry (CPOE) within 24 hours of enrollment; contrast media exposure within 24 hours of enrollment; increased Intra-Abdominal Pressure with acute decompensated heart failure; and severe trauma as the primary reason for ICU admission and likely to be hospitalized in the ICU for 48 hours after enrollment;
Study population 3: approximately 300 patients expected to be hospitalized through acute care setting (ICU or ED) with a known risk factor for acute renal injury (e.g. sepsis, hypotension/shock (Shock=systolic BP<90 mmHg and/or the need for vasopressor support to maintain a MAP>60 mmHg and/or a documented drop in SBP>40 mmHg), major trauma, hemorrhage, or major surgery); and/or expected to be hospitalized to the ICU for at least 24 hours after enrollment;
Study population 4: approximately 1000 patients that are 21 years of age or older, within 24 hours of being admitted into the ICU, expected to have an indwelling urinary catheter for at least 48 hours after enrollment, and have at least one of the following acute conditions within 24 hours prior to enrollment: (i) respiratory SOFA score of 2 (PaO2/FiO2<300), (ii) cardiovascular SOFA score of 1 (MAP<70 mm Hg and/or any vasopressor required).
Exclusion Criteria known pregnancy; institutionalized individuals; previous renal transplantation; known acutely worsening renal function prior to enrollment (e.g., any category of RIFLE criteria); received dialysis (either acute or chronic) within 5 days prior to enrollment or in imminent need of dialysis at the time of enrollment; known infection with human immunodeficiency virus (HIV) or a hepatitis virus; meets any of the following: (i) active bleeding with an anticipated need for >4 units PRBC in a day; (ii) hemoglobin <7 g/dL; (iii) any other condition that in the physician's opinion would contraindicate drawing serial blood samples for clinical study purposes; meets only the SBP<90 mmHg inclusion criterion set forth above, and does not have shock in the attending physician's or principal investigator's opinion;

(78) After obtaining informed consent, an EDTA anti-coagulated blood sample (10 mL), a serum blood sample (0-3 mL) and a urine sample (25-50 mL) are collected from each patient. Blood and urine samples are then collected at 4 (0.5) and 8 (1) hours after contrast administration (if applicable); at 12 (1), 24 (2), 36 (2), 48 (2), 60 (2), 72 (2), and 84 (2) hours after enrollment, and thereafter daily up to day 7 or day 14 while the subject is hospitalized. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are processed to plasma and serum at the clinical site, frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

EXAMPLE 4

Immunoassay Format

(79) Analytes are measured using standard sandwich enzyme immunoassay techniques. A first antibody which binds the analyte was immobilized on a nitrocellulose test strip. A fluorescently-conjugated second antibody which binds the analyte was added to the test sample, and the mixture allowed to traverse the nitrocellulose strip in a lateral flow fashion, thereby forming sandwich complexes with the analyte (if present) and the first antibody. Fluorescence in proportion to the amount of analyte present in the sample was detected using a fluorometer. An analyte concentration was assigned to the test sample by comparison to a standard curve determined from the analyte standards.

(80) Units for the concentrations reported in the following data tables are as follows: Insulin-like growth factor-binding protein 7-ng/mL, Metalloproteinase inhibitor 2-ng/mL.

(81) In the case of those kidney injury markers which are membrane proteins as described herein, the assays used in these examples detect soluble forms thereof.

EXAMPLE 5

Apparently Healthy Donor and Chronic Disease Patient Samples

(82) Human urine samples from donors with no known chronic or acute disease (Apparently Healthy Donors) were purchased from two vendors (Golden West Biologicals, Inc., 27625 Commerce Center Dr., Temecula, Calif. 92590 and Virginia Medical Research, Inc., 915 First Colonial Rd., Virginia Beach, Va. 23454). The urine samples were shipped and stored frozen at less than 20 C. The vendors supplied demographic information for the individual donors including gender, race (Black/White), smoking status and age.

(83) Human urine samples from donors with various chronic diseases (Chronic Disease Patients) including congestive heart failure, coronary artery disease, chronic kidney disease, chronic obstructive pulmonary disease, diabetes mellitus and hypertension were purchased from Virginia Medical Research, Inc., 915 First Colonial Rd., Virginia Beach, Va. 23454. The urine samples were shipped and stored frozen at less than 20 degrees centigrade. The vendor provided a case report form for each individual donor with age, gender, race (Black/White), smoking status and alcohol use, height, weight, chronic disease(s) diagnosis, current medications and previous surgeries.

EXAMPLE 6

Use of Kidney Injury Markers for Evaluating Renal Status in Patients

(84) Patients from the intensive care unit (ICU) were enrolled in the following study. Each patient was classified by kidney status as non-injury (0), risk of injury (R), injury (I), and failure (F) according to the maximum stage reached within 7 days of enrollment as determined by the RIFLE criteria. EDTA anti-coagulated blood samples (10 mL), serum blood samples (3 mL), and urine samples (25-30 mL) were collected from each patient at enrollment, 4 (0.5) and 8 (1) hours after contrast administration (if applicable); at 12 (1), 24 (2), 36 (2), 48 (2), 60 (2), 72 (2), and 84 (2) hours after enrollment hours after enrollment, and thereafter daily up to day 7 to day 14 while the subject is hospitalized. Insulin-like growth factor-binding protein 7 and Metalloproteinase inhibitor 2 were each measured by the NephroCheck Test (Astute Medical, Inc., San Diego, Calif.) in the urine samples. Serum samples were shipped to an independent laboratory for creatinine analysis using methods based on the Jaffe reaction. Serum creatinine is reported in units of mg/dL in the tables below. Urine flow and patient weight were recorded at the clinical sites. Weight adjusted urine output is reported in units of mL/kg/h for the time of sample collection.

(85) Two cohorts were defined to represent a diseased and a normal population. While these terms are used for convenience, diseased and normal simply represent two cohorts for comparison (say RIFLE 0 vs RIFLE R, I and F; RIFLE 0 vs RIFLE R; RIFLE 0 and R vs RIFLE I and F; etc.). The time prior max stage represents the time at which a sample is collected, relative to the time a particular patient reaches the lowest disease stage as defined for that cohort, binned into three groups which are +/12 hours. For example, 24 hr prior which uses 0 vs R, I, F as the two cohorts would mean 24 hr (+/12 hours) prior to reaching stage R (or I if no sample at R, or F if no sample at R or I).

(86) A receiver operating characteristic (ROC) curve was generated for each biomarker measured and the area under each ROC curve (AUC) is determined. Patients in Cohort 2 were also separated according to the reason for adjudication to cohort 2 as being based on serum creatinine measurements (sCr), being based on urine output (UO), or being based on either serum creatinine measurements or urine output. Using the same example discussed above (0 vs R, I, F), for those patients adjudicated to stage R, I, or F on the basis of serum creatinine measurements alone, the stage 0 cohort may include patients adjudicated to stage R, I, or F on the basis of urine output; for those patients adjudicated to stage R, I, or F on the basis of urine output alone, the stage 0 cohort may include patients adjudicated to stage R, I, or F on the basis of serum creatinine measurements; and for those patients adjudicated to stage R, I, or F on the basis of serum creatinine measurements or urine output, the stage 0 cohort contains only patients in stage 0 for both serum creatinine measurements and urine output. Also, in the data for patients adjudicated on the basis of serum creatinine measurements or urine output, the adjudication method which yielded the most severe RIFLE stage is used.

(87) The ability to distinguish cohort 1 from Cohort 2 was determined using ROC analysis. SE is the standard error of the AUC, n is the number of sample or individual patients (pts, as indicated). Standard errors are calculated as described in Hanley, J. A., and McNeil, B. J., The meaning and use of the area under a receiver operating characteristic (ROC) curve. Radiology (1982) 143: 29-36; p values are calculated with a two-tailed Z-test. An AUC<0.5 is indicative of a negative going marker for the comparison, and an AUC>0.5 is indicative of a positive going marker for the comparison.

(88) Various threshold (or cutoff) concentrations were selected, and the associated sensitivity and specificity for distinguishing cohort 1 from cohort 2 are determined. OR is the odds ratio calculated for the particular cutoff concentration, and 95% CI is the confidence interval for the odds ratio.

(89) TABLE-US-00006 TABLE 1 Comparison of marker levels in samples collected from Cohort 1 (patients that did not progress beyond RIFLE stage 0) and in samples collected from subjects at 0, 24 hours, and 48 hours prior to reaching stage R, I or F in Cohort 2. Insulin-like growth factor- binding protein 7 and Metalloproteinase inhibitor 2 were measured in urine. Insulin-like growth factor-binding protein 7 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 62.9 119 62.9 76.6 62.9 79.1 Average 76.7 143 76.7 94.7 76.7 84.9 Stdev 54.3 98.4 54.3 72.8 54.3 49.5 p (t-test) 5.2E84 3.0E6 0.12 Min 10.0 20.0 10.0 20.0 10.0 20.0 Max 600 600 600 564 600 234 n (Samp) 2484 415 2484 233 2484 112 n (Patient) 275 415 275 233 275 112 sCr only Median 72.2 131 72.2 91.2 72.2 81.8 Average 86.5 159 86.5 130 86.5 103 Stdev 60.6 114 60.6 111 60.6 64.0 p (t-test) 1.8E43 7.5E12 0.025 Min 10.0 20.0 10.0 20.0 10.0 20.0 Max 600 545 600 600 600 323 n (Samp) 4526 154 4526 99 4526 72 n (Patient) 518 154 518 99 518 72 UO only Median 63.6 121 63.6 77.7 63.6 81.8 Average 77.2 148 77.2 99.7 77.2 90.7 Stdev 55.2 98.2 55.2 80.2 55.2 62.5 p (t-test) 1.9E90 1.8E8 0.015 Min 10.0 20.0 10.0 20.0 10.0 20.0 Max 600 600 600 564 600 383 n (Samp) 2968 372 2968 223 2968 103 n (Patient) 331 372 331 223 331 103 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.73 0.71 0.75 0.58 0.62 0.59 0.56 0.58 0.57 SE 0.015 0.024 0.015 0.020 0.030 0.021 0.029 0.036 0.030 p 0 0 0 1.3E4 7.2E5 2.0E5 0.025 0.017 0.024 nCohort 1 2484 4526 2968 2484 4526 2968 2484 4526 2968 nCohort 2 415 154 372 233 99 223 112 72 103 Cutoff 1 80.8 88.7 85.3 53.4 60.7 53.4 51.8 61.9 47.7 Sens 1 70% 70% 70% 70% 71% 70% 71% 71% 71% Spec 1 64% 62% 67% 40% 41% 40% 39% 42% 34% Cutoff 2 63.2 56.8 71.4 42.7 53.2 42.4 37.8 50.2 31.9 Sens 2 80% 81% 80% 80% 81% 80% 80% 81% 81% Spec 2 50% 37% 56% 29% 34% 28% 24% 31% 17% Cutoff 3 38.6 35.6 45.6 30.7 36.8 30.8 28.3 33.0 26.4 Sens 3 90% 90% 90% 90% 91% 90% 90% 90% 90% Spec 3 24% 18% 32% 17% 19% 17% 15% 16% 12% Cutoff 4 90.2 102 89.9 90.2 102 89.9 90.2 102 89.9 Sens 4 66% 65% 68% 37% 44% 40% 38% 40% 44% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 109 124 109 109 124 109 109 124 109 Sens 5 54% 53% 56% 30% 38% 32% 26% 31% 32% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 145 166 146 145 166 146 145 166 146 Sens 6 38% 35% 39% 17% 23% 17% 14% 17% 17% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.1 1.0 1.1 1.3 1.9 1.1 0.71 1.6 0.44 p Value 0.75 1.0 0.62 0.20 0.073 0.58 0.28 0.26 0.018 95% CI of 0.70 0.53 0.70 0.86 0.94 0.73 0.38 0.72 0.22 OR Quart 2 1.6 1.9 1.8 2.0 3.7 1.8 1.3 3.3 0.87 OR Quart 3 2.4 1.5 3.0 1.5 1.7 1.5 1.3 1.7 0.96 p Value 2.4E6 0.19 1.7E7 0.063 0.13 0.049 0.28 0.15 0.89 95% CI of 1.7 0.82 2.0 0.98 0.86 1.0 0.79 0.82 0.56 OR Quart 3 3.5 2.7 4.6 2.2 3.4 2.3 2.3 3.7 1.7 OR Quart 4 7.0 4.9 8.6 2.1 3.1 2.2 1.5 2.3 1.4 p Value 0 5.1E10 0 2.7E4 3.7E4 7.1E5 0.15 0.022 0.17 95% CI of 4.9 3.0 5.9 1.4 1.7 1.5 0.87 1.1 0.86 OR Quart 4 9.8 8.1 13 3.1 5.9 3.3 2.5 4.7 2.4 Metalloproteinase inhibitor 2 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 3.09 5.19 3.09 3.34 3.09 3.91 Average 3.72 7.09 3.72 4.34 3.72 5.28 Stdev 2.77 10.4 2.77 3.73 2.77 12.0 p (t-test) 1.7E40 0.0015 1.1E5 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 56.2 182 56.2 34.4 56.2 128 n (Samp) 2484 415 2484 233 2484 112 n (Patient) 275 415 275 233 275 112 sCr only Median 3.48 5.50 3.48 4.12 3.48 4.04 Average 4.23 8.18 4.23 5.79 4.23 5.54 Stdev 3.32 16.0 3.32 5.37 3.32 5.50 p (t-test) 4.8E28 5.8E6 0.0011 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 56.2 182 56.2 23.9 56.2 34.4 n (Samp) 4526 154 4526 99 4526 72 n (Patient) 518 154 518 99 518 72 UO only Median 3.06 5.52 3.06 3.58 3.06 3.83 Average 3.74 7.26 3.74 4.84 3.74 6.92 Stdev 2.92 9.84 2.92 5.83 2.92 19.0 p (t-test) 6.4E49 7.8E7 2.1E12 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 56.2 171 56.2 71.7 56.2 150 n (Samp) 2968 372 2968 223 2968 103 n (Patient) 331 372 331 223 331 103 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.66 0.74 0.55 0.57 0.58 0.57 0.57 0.57 SE 0.015 0.024 0.015 0.020 0.030 0.021 0.029 0.035 0.030 p 0 3.5E11 0 0.014 0.031 1.9E4 0.014 0.065 0.015 nCohort 1 2484 4526 2968 2484 4526 2968 2484 4526 2968 nCohort 2 415 154 372 233 99 223 112 72 103 Cutoff 1 3.73 3.63 3.94 2.44 2.63 2.60 2.55 2.86 2.52 Sens 1 70% 70% 70% 70% 71% 70% 71% 71% 71% Spec 1 61% 52% 65% 38% 35% 42% 40% 39% 40% Cutoff 2 3.03 2.65 3.35 2.00 2.04 2.17 1.98 2.13 1.79 Sens 2 80% 81% 80% 80% 81% 80% 80% 81% 81% Spec 2 49% 35% 55% 28% 24% 32% 27% 25% 23% Cutoff 3 2.02 1.76 2.28 1.32 1.33 1.51 1.49 1.34 1.45 Sens 3 90% 90% 90% 90% 91% 90% 90% 90% 90% Spec 3 29% 19% 35% 13% 11% 17% 17% 11% 16% Cutoff 4 4.36 4.83 4.33 4.36 4.83 4.33 4.36 4.83 4.33 Sens 4 60% 55% 63% 33% 42% 37% 42% 39% 41% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 5.28 5.96 5.23 5.28 5.96 5.23 5.28 5.96 5.23 Sens 5 49% 45% 53% 26% 28% 29% 23% 33% 26% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 6.79 7.76 6.81 6.79 7.76 6.81 6.79 7.76 6.81 Sens 6 35% 28% 38% 14% 19% 16% 13% 18% 17% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.4 1.3 1.7 1.6 0.82 1.8 0.95 1.3 0.85 p Value 0.097 0.45 0.041 0.020 0.53 0.011 0.88 0.48 0.62 95% CI of 0.94 0.69 1.0 1.1 0.45 1.1 0.52 0.64 0.45 OR Quart 2 2.2 2.3 2.7 2.4 1.5 2.7 1.8 2.6 1.6 OR Quart 3 2.9 1.5 3.8 1.5 0.96 1.7 1.4 1.1 1.2 p Value 3.4E8 0.16 3.9E9 0.063 0.88 0.014 0.26 0.85 0.55 95% CI of 2.0 0.85 2.4 0.98 0.53 1.1 0.79 0.52 0.66 OR Quart 3 4.2 2.7 5.8 2.2 1.7 2.7 2.4 2.2 2.2 OR Quart 4 6.8 4.2 9.9 1.8 1.5 2.3 1.8 1.8 1.9 p Value 0 1.9E8 0 0.0060 0.11 1.0E4 0.028 0.080 0.020 95% CI of 4.8 2.5 6.6 1.2 0.90 1.5 1.1 0.93 1.1 OR Quart 4 9.7 6.8 15 2.6 2.6 3.5 3.1 3.5 3.3 Weight Adjusted Urine Output 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 1.08 0.402 1.08 0.710 1.08 0.927 Average 1.56 0.712 1.56 1.06 1.56 1.33 Stdev 1.60 1.14 1.60 1.21 1.60 1.42 p (t-test) 6.9E24 8.2E6 0.15 Min 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 Max 21.5 10.6 21.5 11.1 21.5 7.59 n (Samp) 2076 408 2076 224 2076 107 n (Patient) 273 408 273 224 273 107 sCr only Median 0.833 0.559 0.833 0.659 0.833 0.715 Average 1.27 0.969 1.27 1.01 1.27 0.994 Stdev 1.43 1.27 1.43 1.48 1.43 1.06 p (t-test) 0.012 0.083 0.13 Min 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 Max 21.5 8.93 21.5 11.1 21.5 5.87 n (Samp) 3878 145 3878 94 3878 61 n (Patient) 515 145 515 94 515 61 UO only Median 1.07 0.359 1.07 0.674 1.07 0.933 Average 1.57 0.568 1.57 0.982 1.57 1.43 Stdev 1.65 0.945 1.65 0.942 1.65 1.64 p (t-test) 2.2E29 3.0E7 0.40 Min 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 Max 21.5 10.6 21.5 6.61 21.5 9.82 n (Samp) 2518 371 2518 216 2518 100 n (Patient) 331 371 331 216 331 100 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.19 0.38 0.14 0.35 0.41 0.33 0.42 0.43 0.44 SE 0.013 0.025 0.013 0.021 0.031 0.021 0.029 0.038 0.030 p 0 1.7E6 0 1.5E13 0.0048 2.2E16 0.0094 0.071 0.035 nCohort 1 2076 3878 2518 2076 3878 2518 2076 3878 2518 nCohort 2 408 145 371 224 94 216 107 61 100 Cutoff 1 0.291 0.392 0.266 0.503 0.472 0.498 0.623 0.487 0.632 Sens 1 70% 70% 70% 70% 70% 71% 70% 70% 70% Spec 1 3% 16% 3% 13% 23% 12% 21% 24% 22% Cutoff 2 0.236 0.309 0.214 0.406 0.327 0.406 0.497 0.368 0.510 Sens 2 80% 80% 80% 80% 81% 80% 80% 80% 80% Spec 2 3% 10% 2% 8% 11% 8% 12% 14% 13% Cutoff 3 0.147 0.209 0.125 0.256 0.240 0.256 0.342 0.211 0.342 Sens 3 90% 90% 90% 90% 90% 90% 91% 90% 90% Spec 3 1% 5% 1% 3% 6% 3% 5% 5% 5% Cutoff 4 1.65 1.32 1.64 1.65 1.32 1.64 1.65 1.32 1.64 Sens 4 8% 17% 5% 17% 19% 15% 18% 25% 20% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 2.12 1.78 2.13 2.12 1.78 2.13 2.12 1.78 2.13 Sens 5 7% 12% 5% 12% 10% 11% 12% 8% 13% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 3.07 2.63 3.07 3.07 2.63 3.07 3.07 2.63 3.07 Sens 6 4% 7% 2% 5% 3% 5% 8% 7% 10% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.90 1.1 0.83 1.0 1.5 1.0 2.2 1.4 2.1 p Value 0.69 0.77 0.60 1.0 0.25 0.89 0.013 0.41 0.018 95% CI of 0.53 0.61 0.42 0.61 0.76 0.62 1.2 0.62 1.1 OR Quart 2 1.5 1.9 1.7 1.6 2.9 1.7 4.1 3.2 4.0 OR Quart 3 2.3 1.7 2.9 1.8 1.6 1.8 1.7 1.7 1.5 p Value 2.9E4 0.054 1.9E4 0.012 0.15 0.017 0.11 0.18 0.25 95% CI of 1.5 0.99 1.6 1.1 0.84 1.1 0.89 0.78 0.76 OR Quart 3 3.5 2.8 4.9 2.8 3.1 2.8 3.3 3.8 2.9 OR Quart 4 16 2.7 26 3.5 2.2 3.9 2.4 2.0 2.2 p Value 0 8.8E5 0 1.7E9 0.010 2.2E10 0.0048 0.071 0.013 95% CI of 11 1.6 16 2.3 1.2 2.6 1.3 0.94 1.2 OR Quart 4 24 4.4 43 5.3 4.2 6.0 4.5 4.3 4.1 Insulin-like growth factor-binding protein 7/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 59.4 298 59.4 106 59.4 92.9 Average 52600 397000 52600 214000 52600 172000 Stdev 638000 2620000 638000 1960000 638000 1250000 p (t-test) 1.7E7 0.0078 0.077 Min 0.929 1.89 0.929 2.22 0.929 3.01 Max 1.26E7 2.66E7 1.26E7 2.15E7 1.26E7 9700000 n (Samp) 2069 408 2069 223 2069 107 n (Patient) 273 408 273 223 273 107 sCr only Median 87.7 259 87.7 154 87.7 127 Average 79400 420000 79400 767000 79400 497000 Stdev 922000 3270000 922000 4670000 922000 2730000 p (t-test) 2.5E4 1.6E8 9.2E4 Min 0.929 2.58 0.929 2.22 0.929 4.41 Max 2.49E7 2.88E7 2.49E7 3.83E7 2.49E7 1.67E7 n (Samp) 3862 145 3862 93 3862 61 n (Patient) 515 145 515 93 515 61 UO only Median 60.7 333 60.7 116 60.7 90.4 Average 53800 608000 53800 122000 53800 184000 Stdev 637000 4150000 637000 1360000 637000 1300000 p (t-test) 5.8E10 0.18 0.058 Min 0.929 1.89 0.929 4.75 0.929 3.01 Max 1.26E7 6.00E7 1.26E7 1.85E7 1.26E7 9700000 n (Samp) 2509 370 2509 215 2509 100 n (Patient) 331 370 331 215 331 100 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.82 0.69 0.85 0.64 0.62 0.65 0.59 0.59 0.57 SE 0.013 0.025 0.013 0.021 0.031 0.021 0.030 0.039 0.030 p 0 6.7E15 0 2.9E11 1.6E4 2.6E13 0.0032 0.018 0.017 nCohort 1 2069 3862 2509 2069 3862 2509 2069 3862 2509 nCohort 2 408 145 370 223 93 215 107 61 100 Cutoff 1 161 116 207 56.4 68.0 60.0 50.1 75.1 40.9 Sens 1 70% 70% 70% 70% 71% 70% 70% 70% 70% Spec 1 81% 59% 86% 48% 43% 50% 44% 46% 37% Cutoff 2 104 69.8 141 37.5 44.3 39.7 24.3 51.9 24.0 Sens 2 80% 80% 80% 80% 81% 80% 80% 80% 80% Spec 2 69% 44% 77% 35% 31% 36% 25% 35% 24% Cutoff 3 58.2 36.4 77.2 23.9 28.0 24.0 15.1 20.0 15.1 Sens 3 90% 90% 90% 90% 90% 90% 91% 90% 90% Spec 3 49% 26% 59% 25% 21% 24% 17% 16% 16% Cutoff 4 110 168 111 110 168 111 110 168 111 Sens 4 79% 58% 85% 48% 46% 51% 42% 41% 43% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 152 248 154 152 248 154 152 248 154 Sens 5 71% 50% 78% 38% 30% 39% 35% 25% 32% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 244 412 248 244 412 248 244 412 248 Sens 6 58% 28% 65% 21% 19% 25% 16% 15% 16% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.3 1.7 1.1 1.8 1.1 1.6 0.86 1.8 0.86 p Value 0.34 0.13 0.73 0.023 0.86 0.059 0.63 0.20 0.63 95% CI of 0.76 0.85 0.57 1.1 0.52 0.98 0.46 0.73 0.46 OR Quart 2 2.3 3.4 2.2 2.9 2.2 2.7 1.6 4.2 1.6 OR Quart 3 3.5 2.8 3.6 2.3 1.8 2.5 1.1 2.4 0.95 p Value 1.8E7 0.0020 8.1E6 6.4E4 0.065 2.0E4 0.76 0.039 0.88 95% CI of 2.2 1.4 2.1 1.4 0.96 1.5 0.61 1.0 0.52 OR Quart 3 5.7 5.2 6.4 3.7 3.4 4.0 2.0 5.5 1.8 OR Quart 4 20 6.1 28 3.9 2.4 4.0 2.0 2.5 1.8 p Value 0 2.3E9 0 2.8E9 0.0054 1.9E9 0.011 0.027 0.037 95% CI of 13 3.4 17 2.5 1.3 2.6 1.2 1.1 1.0 OR Quart 4 31 11 47 6.0 4.4 6.4 3.4 5.8 3.0 Metalloproteinase inhibitor 2/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 2.93 13.4 2.93 4.94 2.93 4.32 Average 2710 18000 2710 9590 2710 6780 Stdev 32700 121000 32700 92800 32700 50800 p (t-test) 1.0E6 0.021 0.22 Min 0.0558 0.114 0.0558 0.120 0.0558 0.181 Max 579000 1340000 579000 1210000 579000 449000 n (Samp) 2069 408 2069 223 2069 107 n (Patient) 273 408 273 223 273 107 sCr only Median 4.13 9.42 4.13 6.64 4.13 6.00 Average 3940 29600 3940 36300 3940 15300 Stdev 45700 247000 45700 213000 45700 87100 p (t-test) 3.2E6 3.1E8 0.060 Min 0.0558 0.134 0.0558 0.120 0.0558 0.228 Max 1210000 2680000 1210000 1560000 1210000 601000 n (Samp) 3862 145 3862 93 3862 61 n (Patient) 515 145 515 93 515 61 UO only Median 2.97 15.8 2.97 5.35 2.97 4.30 Average 2710 65900 2710 7190 2710 7260 Stdev 32100 897000 32100 85600 32100 52500 p (t-test) 4.5E4 0.11 0.18 Min 0.0558 0.114 0.0558 0.182 0.0558 0.181 Max 579000 1.71E7 579000 1210000 579000 449000 n (Samp) 2509 370 2509 215 2509 100 n (Patient) 331 370 331 215 331 100 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.81 0.67 0.85 0.63 0.60 0.65 0.59 0.59 0.58 SE 0.013 0.025 0.013 0.021 0.031 0.021 0.030 0.039 0.030 p 0 2.7E11 0 3.3E10 0.0021 3.3E13 0.0015 0.016 0.0053 nCohort 1 2069 3862 2509 2069 3862 2509 2069 3862 2509 nCohort 2 408 145 370 223 93 215 107 61 100 Cutoff 1 6.99 4.71 9.51 2.76 2.90 3.17 2.27 3.56 1.98 Sens 1 70% 70% 70% 70% 71% 70% 70% 70% 70% Spec 1 78% 54% 87% 48% 39% 53% 42% 45% 38% Cutoff 2 4.98 3.14 6.50 1.85 1.87 2.17 1.34 2.76 1.20 Sens 2 80% 80% 80% 80% 81% 80% 80% 80% 80% Spec 2 69% 41% 76% 36% 28% 41% 28% 38% 25% Cutoff 3 2.13 1.54 3.54 0.972 1.16 0.977 0.795 0.726 0.795 Sens 3 90% 90% 90% 90% 90% 90% 91% 90% 90% Spec 3 40% 23% 57% 21% 18% 21% 17% 11% 17% Cutoff 4 5.20 8.12 5.27 5.20 8.12 5.27 5.20 8.12 5.27 Sens 4 79% 53% 85% 48% 45% 51% 43% 44% 45% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 7.52 11.3 7.57 7.52 11.3 7.57 7.52 11.3 7.57 Sens 5 69% 45% 76% 33% 33% 36% 33% 31% 34% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 11.1 19.6 11.2 11.1 19.6 11.2 11.1 19.6 11.2 Sens 6 57% 25% 64% 23% 15% 27% 21% 20% 23% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.6 1.5 1.3 1.3 1.00 1.4 1.2 1.6 0.95 p Value 0.090 0.21 0.40 0.23 1.00 0.25 0.63 0.30 0.87 95% CI of 0.93 0.80 0.68 0.83 0.51 0.81 0.62 0.67 0.51 OR Quart 2 2.7 2.9 2.6 2.2 2.0 2.3 2.2 3.6 1.8 OR Quart 3 3.6 2.1 4.3 2.0 1.2 2.5 1.4 1.8 0.95 p Value 1.2E7 0.016 5.5E7 0.0020 0.52 9.6E5 0.29 0.17 0.87 95% CI of 2.2 1.1 2.4 1.3 0.65 1.6 0.76 0.79 0.51 OR Quart 3 5.7 3.8 7.7 3.1 2.4 4.0 2.5 4.1 1.8 OR Quart 4 19 4.8 29 3.1 2.3 3.6 2.2 2.5 1.9 p Value 0 2.5E8 0 2.0E7 0.0052 1.8E8 0.0060 0.023 0.019 95% CI of 12 2.8 17 2.0 1.3 2.3 1.3 1.1 1.1 OR Quart 4 29 8.3 49 4.7 4.1 5.6 3.8 5.4 3.3 Insulin-like growth factor-binding protein 7 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 42.6 111 42.6 65.8 42.6 57.8 Average 57.1 165 57.1 90.6 57.1 73.5 Stdev 56.2 177 56.2 94.3 56.2 59.2 p (t-test) 6.2E112 1.7E15 0.0028 Min 2.00 9.20 2.00 9.29 2.00 12.8 Max 765 1820 765 845 765 337 n (Samp) 2355 411 2355 230 2355 110 n (Patient) 274 411 274 230 274 110 sCr only Median 51.2 176 51.2 102 51.2 74.2 Average 71.3 238 71.3 154 71.3 110 Stdev 73.0 234 73.0 172 73.0 88.1 p (t-test) 7.1E121 6.0E26 1.7E5 Min 2.00 9.20 2.00 11.0 2.00 14.9 Max 973 1820 973 1020 973 453 n (Samp) 4314 152 4314 99 4314 68 n (Patient) 517 152 517 99 517 68 UO only Median 44.5 111 44.5 68.3 44.5 58.2 Average 60.4 170 60.4 100 60.4 95.0 Stdev 60.9 187 60.9 119 60.9 102 p (t-test) 2.6E109 2.0E17 4.4E8 Min 2.00 10.0 2.00 9.29 2.00 12.8 Max 869 1820 869 991 869 589 n (Samp) 2822 370 2822 220 2822 103 n (Patient) 330 370 330 220 330 103 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.79 0.83 0.78 0.65 0.71 0.65 0.61 0.67 0.61 SE 0.014 0.021 0.015 0.020 0.030 0.021 0.029 0.036 0.030 p 0 0 0 1.2E13 1.4E12 1.3E13 1.6E4 2.3E6 2.8E4 nCohort 1 2355 4314 2822 2355 4314 2822 2355 4314 2822 nCohort 2 411 152 370 230 99 220 110 68 103 Cutoff 1 67.0 105 68.4 42.1 65.7 44.4 37.5 53.6 35.4 Sens 1 70% 70% 70% 70% 71% 70% 70% 71% 71% Spec 1 72% 82% 71% 49% 63% 50% 44% 52% 39% Cutoff 2 52.8 74.4 54.8 32.7 44.2 35.0 30.3 44.3 27.3 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 61% 68% 61% 38% 43% 38% 34% 43% 28% Cutoff 3 35.0 46.3 35.5 24.5 28.2 24.5 21.2 34.6 18.1 Sens 3 90% 90% 90% 90% 91% 90% 90% 91% 90% Spec 3 41% 45% 39% 26% 25% 24% 20% 32% 15% Cutoff 4 63.3 77.4 66.3 63.3 77.4 66.3 63.3 77.4 66.3 Sens 4 73% 78% 72% 51% 65% 52% 45% 47% 48% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 80.5 99.6 85.3 80.5 99.6 85.3 80.5 99.6 85.3 Sens 5 65% 74% 62% 40% 51% 40% 30% 37% 35% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 112 145 118 112 145 118 112 145 118 Sens 6 49% 58% 47% 25% 30% 25% 18% 24% 22% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.6 1.9 1.6 2.1 1.2 1.7 1.6 3.8 1.0 p Value 0.067 0.19 0.092 0.0032 0.67 0.039 0.15 0.018 1.0 95% CI of 0.97 0.74 0.93 1.3 0.52 1.0 0.84 1.3 0.53 OR Quart 2 2.6 4.7 2.6 3.5 2.8 2.8 3.1 11 1.9 OR Quart 3 3.5 2.6 3.5 2.4 2.2 2.1 2.1 5.3 1.3 p Value 3.8E8 0.033 1.7E7 4.6E4 0.037 0.0022 0.025 0.0022 0.36 95% CI of 2.2 1.1 2.2 1.5 1.0 1.3 1.1 1.8 0.72 OR Quart 3 5.5 6.2 5.6 3.9 4.7 3.4 3.9 16 2.4 OR Quart 4 14 18 13 4.9 5.7 4.2 2.9 7.2 2.2 p Value 0 1.6E13 0 1.6E11 4.7E7 3.1E10 6.5E4 2.4E4 0.0064 95% CI of 9.5 8.4 8.5 3.1 2.9 2.7 1.6 2.5 1.2 OR Quart 4 22 39 20 7.7 11 6.5 5.2 20 3.8 Metalloproteinase inhibitor 2 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 2.03 4.93 2.03 2.77 2.03 2.61 Average 2.75 8.66 2.75 4.40 2.75 5.64 Stdev 2.93 20.8 2.93 7.30 2.93 22.4 p (t-test) 3.9E38 1.7E11 7.7E8 Min 0.120 0.481 0.120 0.414 0.120 0.671 Max 51.2 374 51.2 79.4 51.2 236 n (Samp) 2355 411 2355 230 2355 110 n (Patient) 274 411 274 230 274 110 sCr only Median 2.46 6.76 2.46 4.83 2.46 3.30 Average 3.53 13.3 3.53 6.73 3.53 6.12 Stdev 4.37 32.8 4.37 7.55 4.37 10.0 p (t-test) 5.2E56 2.1E12 2.6E6 Min 0.120 0.762 0.120 0.523 0.120 0.600 Max 69.5 374 69.5 46.8 69.5 79.4 n (Samp) 4314 152 4314 99 4314 68 n (Patient) 517 152 517 99 517 68 UO only Median 2.09 5.26 2.09 3.18 2.09 2.89 Average 2.91 8.01 2.91 5.18 2.91 10.5 Stdev 3.28 9.48 3.28 10.6 3.28 42.2 p (t-test) 6.0E89 3.3E14 1.5E18 Min 0.120 0.481 0.120 0.414 0.120 0.600 Max 51.2 69.5 51.2 118 51.2 348 n (Samp) 2822 370 2822 220 2822 103 n (Patient) 330 370 330 220 330 103 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.78 0.80 0.78 0.63 0.67 0.65 0.61 0.63 0.62 SE 0.014 0.022 0.015 0.020 0.030 0.021 0.029 0.037 0.030 p 0 0 0 3.1E10 1.9E8 9.9E13 9.4E5 2.7E4 4.4E5 nCohort 1 2355 4314 2822 2355 4314 2822 2355 4314 2822 nCohort 2 411 152 370 230 99 220 110 68 103 Cutoff 1 3.19 4.37 3.33 1.89 2.40 2.18 1.87 2.23 1.87 Sens 1 70% 70% 70% 70% 71% 70% 70% 71% 71% Spec 1 73% 77% 73% 46% 49% 52% 46% 45% 44% Cutoff 2 2.44 3.05 2.50 1.55 1.81 1.70 1.44 1.73 1.56 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 60% 60% 59% 37% 35% 39% 32% 33% 35% Cutoff 3 1.67 2.24 1.68 1.08 1.05 1.22 1.10 1.38 1.07 Sens 3 90% 90% 90% 90% 91% 90% 90% 91% 90% Spec 3 39% 45% 38% 21% 15% 24% 21% 24% 19% Cutoff 4 3.03 3.67 3.12 3.03 3.67 3.12 3.03 3.67 3.12 Sens 4 72% 76% 72% 47% 59% 52% 44% 46% 47% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 3.79 4.75 3.93 3.79 4.75 3.93 3.79 4.75 3.93 Sens 5 62% 67% 62% 37% 52% 40% 31% 38% 34% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 5.20 6.62 5.54 5.20 6.62 5.54 5.20 6.62 5.54 Sens 6 49% 51% 48% 21% 32% 20% 24% 26% 27% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.4 1.9 1.6 1.6 1.5 1.6 1.9 1.9 1.7 p Value 0.14 0.19 0.072 0.037 0.27 0.081 0.071 0.12 0.14 95% CI of 0.88 0.74 0.96 1.0 0.72 0.95 0.95 0.84 0.85 OR Quart 2 2.3 4.7 2.7 2.6 3.1 2.6 3.7 4.3 3.3 OR Quart 3 3.4 3.6 3.5 2.3 1.3 2.4 2.7 1.4 2.1 p Value 3.8E8 0.0027 1.7E7 3.7E4 0.56 3.3E4 0.0026 0.39 0.023 95% CI of 2.2 1.6 2.2 1.4 0.58 1.5 1.4 0.62 1.1 OR Quart 3 5.2 8.4 5.6 3.5 2.7 3.8 5.2 3.4 4.0 OR Quart 4 13 17 13 3.2 4.7 4.0 3.1 3.3 2.7 p Value 0 6.7E13 0 8.8E8 1.7E6 9.5E10 4.6E4 0.0020 0.0016 95% CI of 8.7 7.8 8.5 2.1 2.5 2.6 1.7 1.5 1.5 OR Quart 4 20 36 20 5.0 8.8 6.3 5.9 7.0 5.1 Insulin-like growth factor-binding protein 7 X Serum Creatinine/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 38.2 262 38.2 93.5 38.2 66.9 Average 38600 340000 38600 177000 38600 122000 Stdev 470000 2410000 470000 1840000 470000 882000 p (t-test) 2.9E7 0.0074 0.095 Min 0.318 1.35 0.318 1.84 0.318 1.69 Max 1.01E7 3.25E7 1.01E7 2.56E7 1.01E7 6960000 n (Samp) 2003 404 2003 221 2003 105 n (Patient) 272 404 272 221 272 105 sCr only Median 62.8 320 62.8 158 62.8 109 Average 60200 859000 60200 745000 60200 516000 Stdev 670000 8160000 670000 4330000 670000 3160000 p (t-test) 3.4E8 5.2E12 6.8E6 Min 0.318 2.35 0.318 1.84 0.318 5.29 Max 1.52E7 9.50E7 1.52E7 3.10E7 1.52E7 2.34E7 n (Samp) 3742 143 3742 93 3742 59 n (Patient) 514 143 514 93 514 59 UO only Median 41.1 303 41.1 113 41.1 66.9 Average 43800 469000 43800 63700 43800 129000 Stdev 528000 2900000 528000 657000 528000 908000 p (t-test) 7.0E11 0.61 0.13 Min 0.318 1.35 0.318 3.49 0.318 1.69 Max 1.05E7 3.25E7 1.05E7 7390000 1.05E7 6960000 n (Samp) 2428 368 2428 213 2428 99 n (Patient) 330 368 330 213 330 99 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.85 0.77 0.86 0.67 0.67 0.69 0.61 0.64 0.61 SE 0.012 0.023 0.012 0.021 0.031 0.021 0.030 0.039 0.031 p 0 0 0 0 9.0E8 0 1.2E4 3.0E4 5.7E4 nCohort 1 2003 3742 2428 2003 3742 2428 2003 3742 2428 nCohort 2 404 143 368 221 93 213 105 59 99 Cutoff 1 139 137 179 44.2 71.5 52.3 38.1 67.5 30.2 Sens 1 70% 71% 70% 70% 71% 70% 70% 71% 71% Spec 1 85% 72% 88% 54% 54% 57% 50% 52% 41% Cutoff 2 95.1 100.0 111 25.2 36.7 30.0 21.8 50.6 18.8 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 76% 63% 78% 37% 37% 41% 33% 44% 28% Cutoff 3 48.2 42.4 68.9 15.8 21.9 17.8 11.8 25.6 10.7 Sens 3 90% 90% 90% 90% 90% 90% 90% 92% 91% Spec 3 57% 40% 65% 26% 25% 27% 20% 28% 18% Cutoff 4 77.4 130 81.0 77.4 130 81.0 77.4 130 81.0 Sens 4 85% 73% 86% 53% 57% 58% 46% 47% 47% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 112 199 119 112 199 119 112 199 119 Sens 5 76% 59% 79% 47% 40% 47% 36% 34% 37% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 188 364 202 188 364 202 188 364 202 Sens 6 61% 47% 64% 27% 25% 28% 18% 17% 21% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.3 1.8 1.3 1.6 1.6 1.7 0.64 2.4 0.89 p Value 0.35 0.20 0.46 0.070 0.24 0.058 0.22 0.098 0.73 95% CI of 0.72 0.74 0.63 0.96 0.73 0.98 0.32 0.85 0.46 OR Quart 2 2.5 4.2 2.7 2.7 3.6 3.0 1.3 6.9 1.7 OR Quart 3 4.4 4.0 4.5 2.3 2.2 2.3 1.5 4.1 1.00 p Value 4.2E8 5.5E4 1.5E6 8.3E4 0.037 0.0016 0.19 0.0052 1.00 95% CI of 2.6 1.8 2.4 1.4 1.0 1.4 0.82 1.5 0.52 OR Quart 3 7.5 8.7 8.3 3.8 4.7 3.9 2.6 11 1.9 OR Quart 4 30 12 36 5.2 4.7 6.1 2.3 4.5 2.4 p Value 0 1.5E11 0 2.0E12 1.3E5 1.8E13 0.0035 0.0026 0.0017 95% CI of 18 5.9 20 3.3 2.3 3.8 1.3 1.7 1.4 OR Quart 4 49 25 63 8.3 9.3 9.8 3.9 12 4.2 Metalloproteinase inhibitor 2 X Serum Creatinine/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 1.91 12.1 1.91 4.27 1.91 3.02 Average 1990 16000 1990 6600 1990 4680 Stdev 24600 119000 24600 60100 24600 33800 p (t-test) 1.8E6 0.031 0.29 Min 0.0191 0.0807 0.0191 0.110 0.0191 0.0985 Max 548000 1740000 548000 707000 548000 270000 n (Samp) 2003 404 2003 221 2003 105 n (Patient) 272 404 272 221 272 105 sCr only Median 2.99 12.3 2.99 7.27 2.99 4.15 Average 3040 71600 3040 35600 3040 17200 Stdev 34700 745000 34700 203000 34700 111000 p (t-test) 4.2E8 2.7E11 0.0037 Min 0.0191 0.122 0.0191 0.110 0.0191 0.221 Max 748000 8840000 748000 1340000 748000 842000 n (Samp) 3742 143 3742 93 3742 59 n (Patient) 514 143 514 93 514 59 UO only Median 2.01 14.5 2.01 4.82 2.01 3.54 Average 2180 35400 2180 3530 2180 4960 Stdev 26400 353000 26400 37800 26400 34800 p (t-test) 5.2E6 0.49 0.31 Min 0.0191 0.0807 0.0191 0.133 0.0191 0.0985 Max 548000 6330000 548000 485000 548000 270000 n (Samp) 2428 368 2428 213 2428 99 n (Patient) 330 368 330 213 330 99 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.84 0.75 0.86 0.66 0.65 0.68 0.62 0.63 0.61 SE 0.013 0.024 0.012 0.021 0.031 0.021 0.030 0.039 0.031 p 0 0 0 2.2E15 2.5E6 0 8.3E5 0.0010 3.1E4 nCohort 1 2003 3742 2428 2003 3742 2428 2003 3742 2428 nCohort 2 404 143 368 221 93 213 105 59 99 Cutoff 1 5.97 5.48 7.88 1.99 3.02 2.54 1.60 2.82 1.45 Sens 1 70% 71% 70% 70% 71% 70% 70% 71% 71% Spec 1 83% 67% 87% 51% 50% 58% 44% 48% 40% Cutoff 2 4.44 3.87 5.45 1.23 1.34 1.59 1.18 2.33 1.04 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 75% 57% 79% 37% 29% 43% 36% 44% 32% Cutoff 3 2.01 1.98 2.94 0.627 0.847 0.698 0.540 1.01 0.540 Sens 3 90% 90% 90% 90% 90% 90% 90% 92% 91% Spec 3 52% 39% 62% 22% 21% 23% 19% 24% 18% Cutoff 4 3.67 6.11 3.82 3.67 6.11 3.82 3.67 6.11 3.82 Sens 4 84% 65% 87% 54% 54% 57% 45% 44% 47% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 5.38 9.09 5.63 5.38 9.09 5.63 5.38 9.09 5.63 Sens 5 75% 55% 79% 43% 42% 47% 35% 36% 37% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 8.42 17.4 9.23 8.42 17.4 9.23 8.42 17.4 9.23 Sens 6 61% 39% 65% 29% 24% 27% 23% 17% 25% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.4 1.8 1.5 1.4 0.75 1.4 1.1 2.2 1.1 p Value 0.29 0.16 0.29 0.17 0.45 0.23 0.74 0.12 0.87 95% CI of 0.76 0.79 0.72 0.86 0.35 0.81 0.58 0.83 0.56 OR Quart 2 2.5 4.1 3.0 2.3 1.6 2.3 2.1 5.8 2.0 OR Quart 3 4.8 3.4 5.0 1.9 1.3 2.1 1.5 2.7 0.94 p Value 2.5E9 0.0014 2.6E7 0.0081 0.41 0.0035 0.22 0.039 0.86 95% CI of 2.9 1.6 2.7 1.2 0.68 1.3 0.79 1.1 0.49 OR Quart 3 8.0 7.2 9.1 3.1 2.5 3.4 2.7 6.9 1.8 OR Quart 4 26 11 34 4.3 2.8 4.7 2.4 4.1 2.3 p Value 0 2.1E11 0 6.1E11 4.3E4 1.4E11 0.0027 0.0022 0.0033 95% CI of 16 5.3 19 2.8 1.6 3.0 1.4 1.7 1.3 OR Quart 4 43 21 61 6.6 5.1 7.4 4.2 10 4.0 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.199 0.617 0.199 0.254 0.199 0.295 Average 0.388 1.40 0.388 0.578 0.388 0.632 Stdev 0.631 2.94 0.631 1.03 0.631 2.20 p (t-test) 1.1E50 4.1E5 1.0E3 Min 0.0240 0.0240 0.0240 0.0240 0.0240 0.0240 Max 13.2 39.1 13.2 8.59 13.2 23.3 n (Samp) 2484 415 2484 233 2484 112 n (Patient) 275 415 275 233 275 112 sCr only Median 0.253 0.727 0.253 0.429 0.253 0.342 Average 0.507 1.78 0.507 1.20 0.507 0.708 Stdev 0.852 4.21 0.852 2.14 0.852 0.871 p (t-test) 2.9E42 3.2E14 0.048 Min 0.0240 0.0240 0.0240 0.0240 0.0240 0.0252 Max 16.4 39.1 16.4 11.9 16.4 4.49 n (Samp) 4526 154 4526 99 4526 72 n (Patient) 518 154 518 99 518 72 UO only Median 0.196 0.672 0.196 0.275 0.196 0.296 Average 0.390 1.59 0.390 0.787 0.390 0.968 Stdev 0.640 5.56 0.640 2.77 0.640 3.47 p (t-test) 8.8E29 2.7E9 1.2E10 Min 0.0240 0.0240 0.0240 0.0240 0.0240 0.0240 Max 13.2 103 13.2 39.1 13.2 26.8 n (Samp) 2968 372 2968 223 2968 103 n (Patient) 331 372 331 223 331 103 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.73 0.70 0.76 0.57 0.60 0.59 0.57 0.58 0.57 SE 0.015 0.024 0.015 0.020 0.030 0.021 0.029 0.035 0.030 p 0 4.4E16 0 9.7E4 0.0012 2.9E5 0.014 0.018 0.013 nCohort 1 2484 4526 2968 2484 4526 2968 2484 4526 2968 nCohort 2 415 154 372 233 99 223 112 72 103 Cutoff 1 0.332 0.333 0.375 0.141 0.156 0.159 0.146 0.166 0.124 Sens 1 70% 70% 70% 70% 71% 70% 71% 71% 71% Spec 1 66% 58% 69% 41% 37% 44% 41% 38% 37% Cutoff 2 0.191 0.159 0.238 0.0908 0.103 0.103 0.0788 0.128 0.0676 Sens 2 80% 81% 80% 80% 81% 80% 80% 81% 81% Spec 2 49% 37% 56% 29% 27% 32% 26% 32% 22% Cutoff 3 0.0835 0.0769 0.118 0.0497 0.0610 0.0507 0.0448 0.0507 0.0369 Sens 3 90% 90% 90% 90% 91% 90% 90% 90% 90% Spec 3 27% 21% 36% 17% 17% 17% 15% 14% 12% Cutoff 4 0.386 0.488 0.381 0.386 0.488 0.381 0.386 0.488 0.381 Sens 4 66% 59% 70% 36% 47% 40% 39% 39% 45% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.556 0.702 0.554 0.556 0.702 0.554 0.556 0.702 0.554 Sens 5 53% 53% 57% 27% 34% 28% 27% 36% 29% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 0.919 1.20 0.938 0.919 1.20 0.938 0.919 1.20 0.938 Sens 6 38% 35% 39% 15% 23% 17% 13% 19% 16% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.3 1.5 1.6 1.4 1.2 1.3 0.95 1.3 0.69 p Value 0.18 0.22 0.071 0.095 0.63 0.27 0.88 0.45 0.26 95% CI of 0.88 0.80 0.96 0.94 0.62 0.83 0.52 0.63 0.36 OR Quart 2 2.0 2.8 2.5 2.2 2.2 2.0 1.8 2.8 1.3 OR Quart 3 2.4 1.7 3.4 1.5 1.1 1.8 1.5 1.5 1.1 p Value 3.6E6 0.077 5.9E8 0.063 0.74 0.0081 0.17 0.27 0.77 95% CI of 1.7 0.94 2.2 0.98 0.59 1.2 0.85 0.72 0.61 OR Quart 3 3.6 3.2 5.2 2.2 2.1 2.7 2.6 3.1 1.9 OR Quart 4 7.2 5.2 9.9 2.0 2.3 2.2 1.7 2.2 1.7 p Value 0 1.1E9 0 8.8E4 0.0044 2.0E4 0.048 0.026 0.041 95% CI of 5.1 3.1 6.6 1.3 1.3 1.4 1.0 1.1 1.0 OR Quart 4 10 8.8 15 2.9 4.0 3.2 3.0 4.4 2.9 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.127 0.571 0.127 0.212 0.127 0.221 Average 0.291 1.78 0.291 0.593 0.291 0.764 Stdev 0.597 5.15 0.597 1.41 0.597 4.10 p (t-test) 1.3E40 7.6E10 3.3E6 Min 0.00240 0.0120 0.00240 0.0116 0.00240 0.0182 Max 14.6 64.2 14.6 12.9 14.6 43.1 n (Samp) 2355 411 2355 230 2355 110 n (Patient) 274 411 274 230 274 110 sCr only Median 0.181 0.931 0.181 0.404 0.181 0.233 Average 0.443 2.88 0.443 1.47 0.443 0.814 Stdev 1.05 7.80 1.05 3.15 1.05 1.46 p (t-test) 5.1E61 1.3E18 0.0041 Min 0.00240 0.0152 0.00240 0.0185 0.00240 0.0178 Max 31.2 64.2 31.2 20.2 31.2 10.4 n (Samp) 4314 152 4314 99 4314 68 n (Patient) 517 152 517 99 517 68 UO only Median 0.133 0.610 0.133 0.233 0.133 0.239 Average 0.309 1.70 0.309 0.935 0.309 1.60 Stdev 0.658 3.51 0.658 4.52 0.658 7.48 p (t-test) 8.8E74 7.8E11 7.8E17 Min 0.00240 0.0120 0.00240 0.0116 0.00240 0.0182 Max 14.6 38.0 14.6 64.1 14.6 62.2 n (Samp) 2822 370 2822 220 2822 103 n (Patient) 330 370 330 220 330 103 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.78 0.78 0.79 0.62 0.66 0.63 0.60 0.63 0.60 SE 0.014 0.022 0.014 0.020 0.030 0.021 0.029 0.037 0.030 p 0 0 0 1.7E8 2.0E7 2.5E10 6.3E4 3.9E4 6.1E4 nCohort 1 2355 4314 2822 2355 4314 2822 2355 4314 2822 nCohort 2 411 152 370 230 99 220 110 68 103 Cutoff 1 0.285 0.392 0.319 0.113 0.193 0.125 0.108 0.153 0.104 Sens 1 70% 70% 70% 70% 71% 70% 70% 71% 71% Spec 1 72% 73% 74% 46% 52% 48% 45% 45% 42% Cutoff 2 0.180 0.195 0.213 0.0738 0.0885 0.0895 0.0686 0.115 0.0614 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 59% 52% 63% 34% 31% 38% 32% 38% 28% Cutoff 3 0.0763 0.123 0.0921 0.0372 0.0514 0.0446 0.0335 0.0686 0.0280 Sens 3 90% 90% 90% 90% 91% 90% 90% 91% 90% Spec 3 35% 40% 38% 19% 21% 22% 17% 26% 13% Cutoff 4 0.257 0.361 0.265 0.257 0.361 0.265 0.257 0.361 0.265 Sens 4 73% 71% 75% 45% 55% 48% 42% 47% 46% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.384 0.533 0.399 0.384 0.533 0.399 0.384 0.533 0.399 Sens 5 62% 65% 63% 33% 42% 36% 33% 38% 35% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 0.648 0.930 0.689 0.648 0.930 0.689 0.648 0.930 0.689 Sens 6 47% 50% 45% 21% 28% 22% 18% 26% 19% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 2.1 1.8 1.7 2.0 0.93 2.1 1.2 3.2 0.95 p Value 0.0037 0.13 0.049 0.0029 0.85 0.0037 0.63 0.013 0.87 95% CI of 1.3 0.83 1.0 1.3 0.45 1.3 0.62 1.3 0.50 OR Quart 2 3.4 3.9 2.9 3.2 1.9 3.4 2.2 8.0 1.8 OR Quart 3 3.8 1.8 3.8 2.1 1.5 2.3 1.8 2.4 1.2 p Value 8.8E9 0.13 5.6E8 0.0012 0.25 5.6E4 0.046 0.081 0.64 95% CI of 2.4 0.83 2.4 1.4 0.76 1.4 1.0 0.90 0.63 OR Quart 3 6.1 3.9 6.2 3.4 2.9 3.8 3.3 6.1 2.1 OR Quart 4 15 12 15 3.3 3.3 3.9 2.2 4.9 2.1 p Value 0 2.1E13 0 1.1E7 6.6E5 5.1E9 0.0055 4.0E4 0.0072 95% CI of 9.8 6.0 9.3 2.1 1.8 2.5 1.3 2.0 1.2 OR Quart 4 23 22 23 5.0 5.9 6.1 4.0 12 3.6 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.179 1.57 0.179 0.359 0.179 0.385 Average 207 3180 207 1690 207 633 Stdev 2830 27400 2830 17300 2830 4790 p (t-test) 1.7E6 4.7E4 0.15 Min 0.00112 0.00227 0.00112 0.00266 0.00112 0.00361 Max 73000 344000 73000 224000 73000 43600 n (Samp) 2069 408 2069 223 2069 107 n (Patient) 273 408 273 223 273 107 sCr only Median 0.311 1.29 0.311 0.686 0.311 0.625 Average 412 7810 412 9330 412 2380 Stdev 6490 70000 6490 64900 6490 14000 p (t-test) 3.0E9 7.0E13 0.022 Min 0.00112 0.00310 0.00112 0.00266 0.00112 0.00529 Max 247000 772000 247000 600000 247000 100000 n (Samp) 3862 145 3862 93 3862 61 n (Patient) 515 145 515 93 515 61 UO only Median 0.184 1.94 0.184 0.441 0.184 0.387 Average 203 31300 203 1160 203 677 Stdev 2730 534000 2730 15400 2730 4960 p (t-test) 0.0036 0.0075 0.10 Min 0.00112 0.00227 0.00112 0.00570 0.00112 0.00361 Max 73000 1.03E7 73000 224000 73000 43600 n (Samp) 2509 370 2509 215 2509 100 n (Patient) 331 370 331 215 331 100 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.81 0.70 0.84 0.62 0.60 0.64 0.59 0.60 0.58 SE 0.014 0.025 0.013 0.021 0.031 0.021 0.030 0.039 0.030 p 0 1.3E15 0 1.7E8 9.0E4 8.9E11 0.0017 0.012 0.0066 nCohort 1 2069 3862 2509 2069 3862 2509 2069 3862 2509 nCohort 2 408 145 370 223 93 215 107 61 100 Cutoff 1 0.632 0.427 0.888 0.143 0.179 0.182 0.135 0.212 0.109 Sens 1 70% 70% 70% 70% 71% 70% 70% 70% 70% Spec 1 77% 57% 83% 45% 39% 50% 43% 42% 38% Cutoff 2 0.354 0.248 0.507 0.0822 0.0794 0.0934 0.0522 0.156 0.0432 Sens 2 80% 80% 80% 80% 81% 80% 80% 80% 80% Spec 2 65% 45% 72% 33% 25% 35% 26% 36% 23% Cutoff 3 0.137 0.0797 0.208 0.0448 0.0512 0.0435 0.0205 0.0240 0.0217 Sens 3 90% 90% 90% 90% 90% 90% 91% 90% 90% Spec 3 44% 25% 52% 24% 20% 23% 14% 12% 15% Cutoff 4 0.438 0.791 0.446 0.438 0.791 0.446 0.438 0.791 0.446 Sens 4 77% 60% 82% 46% 45% 49% 43% 44% 43% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.754 1.33 0.752 0.754 1.33 0.752 0.754 1.33 0.752 Sens 5 68% 50% 73% 31% 30% 33% 30% 31% 31% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 1.39 2.74 1.42 1.39 2.74 1.42 1.39 2.74 1.42 Sens 6 54% 34% 59% 20% 20% 23% 18% 16% 19% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.4 1.4 1.4 1.7 0.83 1.6 0.71 1.9 0.60 p Value 0.25 0.32 0.28 0.028 0.60 0.084 0.31 0.15 0.14 95% CI of 0.81 0.72 0.76 1.1 0.42 0.94 0.36 0.80 0.31 OR Quart 2 2.3 2.7 2.6 2.7 1.7 2.6 1.4 4.5 1.2 OR Quart 3 3.3 2.2 3.7 2.2 1.5 2.4 1.5 2.1 1.1 p Value 2.1E7 0.014 1.9E6 8.9E4 0.23 1.9E4 0.20 0.077 0.77 95% CI of 2.1 1.2 2.1 1.4 0.79 1.5 0.82 0.92 0.61 OR Quart 3 5.2 4.0 6.3 3.4 2.7 3.9 2.6 5.0 1.9 OR Quart 4 16 5.5 23 3.1 1.9 3.5 2.0 2.7 1.7 p Value 0 2.8E9 0 4.5E7 0.027 5.5E8 0.010 0.019 0.052 95% CI of 11 3.1 14 2.0 1.1 2.2 1.2 1.2 1.00 OR Quart 4 25 9.6 37 4.7 3.4 5.4 3.5 6.0 2.9 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.126 1.45 0.126 0.295 0.126 0.245 Average 148 2900 148 1190 148 433 Stdev 2040 27600 2040 11900 2040 3150 p (t-test) 1.0E5 5.3E4 0.18 Min 0.000381 0.00161 0.000381 0.00221 0.000381 0.00257 Max 58400 435000 58400 152000 58400 26200 n (Samp) 2003 404 2003 221 2003 105 n (Patient) 272 404 272 221 272 105 sCr only Median 0.218 1.62 0.218 0.723 0.218 0.422 Average 292 20000 292 8510 292 2780 Stdev 4050 214000 4050 54800 4050 18500 p (t-test) 2.1E8 9.5E17 4.3E5 Min 0.000381 0.00282 0.000381 0.00221 0.000381 0.00635 Max 151000 2550000 151000 486000 151000 141000 n (Samp) 3742 143 3742 93 3742 59 n (Patient) 514 143 514 93 514 59 UO only Median 0.133 1.63 0.133 0.379 0.133 0.266 Average 157 13600 157 517 157 460 Stdev 2080 200000 2080 6290 2080 3250 p (t-test) 9.4E4 0.060 0.17 Min 0.000381 0.00161 0.000381 0.00419 0.000381 0.00257 Max 58400 3800000 58400 89500 58400 26200 n (Samp) 2428 368 2428 213 2428 99 n (Patient) 330 368 330 213 330 99 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.84 0.76 0.85 0.65 0.64 0.67 0.61 0.62 0.60 SE 0.013 0.024 0.013 0.021 0.031 0.021 0.030 0.039 0.031 p 0 0 0 1.2E12 3.9E6 3.3E15 1.6E4 0.0015 7.3E4 nCohort 1 2003 3742 2428 2003 3742 2428 2003 3742 2428 nCohort 2 404 143 368 221 93 213 105 59 99 Cutoff 1 0.571 0.515 0.776 0.0983 0.186 0.161 0.0975 0.203 0.0762 Sens 1 70% 71% 70% 70% 71% 70% 70% 71% 71% Spec 1 83% 67% 86% 45% 47% 55% 45% 48% 39% Cutoff 2 0.339 0.337 0.482 0.0605 0.0725 0.0728 0.0394 0.140 0.0333 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 71% 58% 78% 35% 30% 37% 29% 41% 25% Cutoff 3 0.151 0.122 0.189 0.0271 0.0356 0.0323 0.0180 0.0307 0.0173 Sens 3 90% 90% 90% 90% 90% 90% 90% 92% 91% Spec 3 55% 38% 59% 23% 20% 24% 18% 19% 17% Cutoff 4 0.309 0.573 0.333 0.309 0.573 0.333 0.309 0.573 0.333 Sens 4 81% 69% 84% 49% 57% 53% 45% 44% 45% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.492 1.01 0.525 0.492 1.01 0.525 0.492 1.01 0.525 Sens 5 75% 57% 79% 42% 39% 45% 32% 37% 36% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 0.994 2.27 1.13 0.994 2.27 1.13 0.994 2.27 1.13 Sens 6 58% 46% 61% 25% 22% 24% 22% 24% 24% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.1 1.3 1.1 1.5 1.4 1.4 0.89 2.4 0.80 p Value 0.77 0.53 0.73 0.086 0.35 0.19 0.73 0.081 0.51 95% CI of 0.61 0.57 0.57 0.94 0.68 0.84 0.46 0.90 0.42 OR Quart 2 2.0 3.0 2.2 2.5 3.0 2.4 1.7 6.2 1.5 OR Quart 3 4.1 3.1 4.0 2.1 1.9 2.4 1.6 2.7 1.00 p Value 1.3E8 0.0023 1.3E6 0.0018 0.066 5.3E4 0.11 0.039 1.00 95% CI of 2.5 1.5 2.3 1.3 0.96 1.5 0.90 1.1 0.54 OR Quart 3 6.7 6.3 7.0 3.4 3.9 3.8 2.9 6.9 1.8 OR Quart 4 22 9.8 28 3.9 3.5 4.4 2.1 3.9 2.0 p Value 0 1.2E11 0 1.4E9 1.5E4 2.0E10 0.0081 0.0031 0.014 95% CI of 14 5.1 16 2.5 1.8 2.8 1.2 1.6 1.1 OR Quart 4 35 19 46 6.0 6.7 6.9 3.7 9.6 3.4 Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.670 0.950 0.670 0.840 0.670 0.800 Average 0.737 1.10 0.737 0.947 0.737 0.856 Stdev 0.364 0.629 0.364 0.492 0.364 0.349 p (t-test) 1.3E60 3.4E16 5.4E4 Min 0.100 0.200 0.100 0.260 0.100 0.270 Max 3.42 5.30 3.42 4.10 3.42 1.88 n (Samp) 2530 421 2530 239 2530 118 n (Patient) 275 421 275 239 275 118 sCr only Median 0.700 1.38 0.700 1.02 0.700 1.00 Average 0.805 1.50 0.805 1.13 0.805 1.06 Stdev 0.439 0.796 0.439 0.643 0.439 0.642 p (t-test) 4.0E77 2.5E13 9.5E7 Min 0.100 0.380 0.100 0.260 0.100 0.270 Max 5.50 5.30 5.50 4.21 5.50 4.14 n (Samp) 4713 157 4713 104 4713 72 n (Patient) 518 157 518 104 518 72 UO only Median 0.700 0.900 0.700 0.895 0.700 0.815 Average 0.774 1.10 0.774 0.990 0.774 0.972 Stdev 0.403 0.688 0.403 0.536 0.403 0.540 p (t-test) 6.1E41 4.8E14 7.5E7 Min 0.100 0.200 0.100 0.300 0.100 0.300 Max 3.42 5.30 3.42 4.10 3.42 3.98 n (Samp) 3041 378 3041 226 3041 108 n (Patient) 331 378 331 226 331 108 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.82 0.67 0.65 0.70 0.64 0.62 0.66 0.63 SE 0.015 0.021 0.016 0.020 0.029 0.020 0.028 0.035 0.029 p 0 0 0 8.4E15 1.4E11 1.6E12 2.9E5 5.3E6 8.5E6 nCohort 1 2530 4713 3041 2530 4713 3041 2530 4713 3041 nCohort 2 421 157 378 239 104 226 118 72 108 Cutoff 1 0.700 0.990 0.690 0.670 0.790 0.670 0.660 0.740 0.690 Sens 1 70% 73% 73% 71% 70% 71% 71% 71% 72% Spec 1 58% 76% 49% 50% 59% 47% 50% 55% 49% Cutoff 2 0.610 0.890 0.590 0.590 0.690 0.590 0.560 0.650 0.590 Sens 2 80% 82% 83% 83% 81% 85% 81% 81% 81% Spec 2 45% 68% 36% 38% 45% 36% 36% 42% 36% Cutoff 3 0.490 0.690 0.490 0.490 0.490 0.490 0.400 0.470 0.460 Sens 3 93% 91% 92% 91% 93% 92% 92% 90% 92% Spec 3 24% 45% 22% 24% 19% 22% 15% 17% 19% Cutoff 4 0.820 0.900 0.870 0.820 0.900 0.870 0.820 0.900 0.870 Sens 4 60% 78% 53% 52% 61% 51% 45% 56% 44% Spec 4 70% 73% 70% 70% 73% 70% 70% 73% 70% Cutoff 5 0.940 1.02 1.00 0.940 1.02 1.00 0.940 1.02 1.00 Sens 5 50% 69% 42% 38% 50% 34% 33% 42% 33% Spec 5 80% 80% 81% 80% 80% 81% 80% 80% 81% Cutoff 6 1.20 1.30 1.26 1.20 1.30 1.26 1.20 1.30 1.26 Sens 6 32% 54% 30% 19% 25% 20% 15% 17% 19% Spec 6 91% 91% 90% 91% 91% 90% 91% 91% 90% OR Quart 2 1.5 1.3 1.7 1.7 0.50 2.2 1.1 1.1 1.1 p Value 0.061 0.64 0.0069 0.033 0.11 0.0013 0.87 0.83 0.86 95% CI of 0.98 0.49 1.2 1.0 0.21 1.4 0.55 0.47 0.52 OR Quart 2 2.2 3.2 2.6 2.7 1.2 3.7 2.0 2.6 2.2 OR Quart 3 2.3 3.0 2.2 2.5 1.3 2.5 2.3 1.4 2.3 p Value 1.0E5 0.0067 3.0E5 8.0E5 0.41 2.7E4 0.0040 0.41 0.0073 95% CI of 1.6 1.4 1.5 1.6 0.68 1.5 1.3 0.62 1.3 OR Quart 3 3.3 6.8 3.3 3.9 2.5 4.0 4.1 3.2 4.3 OR Quart 4 6.4 16 5.0 4.0 3.8 4.2 2.4 3.8 3.0 p Value 0 6.8E14 0 5.4E10 2.5E6 7.5E10 0.0029 2.1E4 3.5E4 95% CI of 4.5 7.7 3.6 2.6 2.2 2.7 1.3 1.9 1.6 OR Quart 4 8.9 32 7.2 6.1 6.7 6.7 4.2 7.6 5.4 Serum Creatinine/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.600 2.37 0.600 1.19 0.600 0.923 Average 588 2480 588 1080 588 1330 Stdev 7100 15000 7100 9960 7100 9710 p (t-test) 1.0E4 0.35 0.30 Min 0.0159 0.0673 0.0159 0.0760 0.0159 0.0645 Max 154000 130000 154000 119000 154000 80000 n (Samp) 2010 404 2010 222 2010 105 n (Patient) 272 404 272 222 272 105 sCr only Median 0.863 2.17 0.863 1.54 0.863 1.31 Average 767 3560 767 3300 767 3260 Stdev 8440 29400 8440 18500 8440 19300 p (t-test) 0.0011 0.0060 0.029 Min 0.0159 0.102 0.0159 0.0920 0.0159 0.170 Max 180000 330000 180000 119000 180000 140000 n (Samp) 3758 143 3758 94 3758 59 n (Patient) 514 143 514 94 514 59 UO only Median 0.616 2.53 0.616 1.33 0.616 1.03 Average 687 3150 687 563 687 1420 Stdev 8520 18600 8520 6100 8520 10000 p (t-test) 2.5E5 0.83 0.41 Min 0.0159 0.0673 0.0159 0.0760 0.0159 0.0645 Max 230000 214000 230000 80000 230000 80000 n (Samp) 2437 369 2437 214 2437 99 n (Patient) 330 369 330 214 330 99 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.84 0.74 0.85 0.69 0.65 0.70 0.62 0.63 0.62 SE 0.013 0.024 0.013 0.020 0.031 0.021 0.030 0.039 0.031 p 0 0 0 0 1.2E6 0 1.1E4 9.0E4 1.1E4 nCohort 1 2010 3758 2437 2010 3758 2437 2010 3758 2437 nCohort 2 404 143 369 222 94 214 105 59 99 Cutoff 1 1.47 1.36 1.60 0.677 0.884 0.786 0.589 0.839 0.600 Sens 1 70% 71% 70% 70% 70% 70% 70% 71% 71% Spec 1 83% 68% 84% 55% 51% 60% 49% 49% 49% Cutoff 2 1.12 0.906 1.20 0.494 0.569 0.537 0.408 0.643 0.403 Sens 2 80% 80% 80% 80% 81% 80% 80% 81% 81% Spec 2 75% 52% 76% 42% 35% 44% 34% 40% 32% Cutoff 3 0.705 0.559 0.869 0.334 0.423 0.358 0.260 0.377 0.258 Sens 3 90% 90% 90% 90% 90% 90% 90% 92% 91% Spec 3 57% 35% 64% 27% 26% 28% 19% 22% 18% Cutoff 4 0.975 1.46 1.02 0.975 1.46 1.02 0.975 1.46 1.02 Sens 4 83% 68% 86% 60% 52% 64% 47% 37% 51% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 1.30 1.99 1.37 1.30 1.99 1.37 1.30 1.99 1.37 Sens 5 75% 54% 76% 45% 38% 47% 30% 29% 32% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 1.96 3.20 2.07 1.96 3.20 2.07 1.96 3.20 2.07 Sens 6 59% 37% 62% 28% 22% 29% 16% 20% 21% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.77 1.6 0.86 2.1 2.0 1.9 1.4 2.0 1.0 p Value 0.42 0.26 0.70 0.0075 0.087 0.024 0.30 0.16 1.0 95% CI of 0.41 0.72 0.41 1.2 0.90 1.1 0.72 0.75 0.50 OR Quart 2 1.5 3.3 1.8 3.6 4.5 3.3 2.9 5.4 2.0 OR Quart 3 4.0 2.7 4.9 2.4 2.9 2.3 2.4 3.6 1.9 p Value 1.5E8 0.0056 4.3E8 0.0011 0.0056 0.0028 0.0060 0.0064 0.052 95% CI of 2.5 1.3 2.8 1.4 1.4 1.3 1.3 1.4 1.00 OR Quart 3 6.4 5.4 8.7 4.1 6.3 3.9 4.6 8.9 3.4 OR Quart 4 22 8.5 29 6.3 4.7 6.6 2.8 3.4 2.5 p Value 0 4.0E11 0 6.3E14 2.9E5 4.0E14 0.0011 0.0092 0.0030 95% CI of 14 4.5 17 3.9 2.3 4.0 1.5 1.4 1.4 OR Quart 4 34 16 50 10 9.8 11 5.3 8.5 4.5

(90) TABLE-US-00007 TABLE 2 Comparison of marker levels in samples collected from Cohort 1 (patients that did not progress beyond RIFLE stage 0 or R) and in samples collected from subjects at 0, 24 hours, and 48 hours prior to reaching stage I or F in Cohort 2. Insulin-like growth factor-binding protein 7 and Metalloproteinase inhibitor 2 were measured in urine. Insulin-like growth factor-binding protein 7 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 69.6 152 69.6 101 69.6 84.4 Average 82.8 177 82.8 128 82.8 116 Stdev 56.8 114 56.8 102 56.8 95.5 p (t-test) 4.3E95 4.9E20 9.2E8 Min 10.0 20.0 10.0 20.0 10.0 20.0 Max 600 600 600 600 600 564 n (Samp) 4360 193 4360 146 4360 89 n (Patient) 495 193 495 146 495 89 sCr only Median 73.5 127 73.5 145 73.5 122 Average 88.0 182 88.0 170 88.0 154 Stdev 61.6 135 61.6 131 61.6 115 p (t-test) 4.9E31 4.1E22 3.9E12 Min 10.0 22.5 10.0 20.0 10.0 24.6 Max 600 600 600 600 600 564 n (Samp) 5431 61 5431 56 5431 44 n (Patient) 621 61 621 56 621 44 UO only Median 70.5 153 70.5 86.3 70.5 81.2 Average 85.4 176 85.4 120 85.4 98.3 Stdev 62.6 112 62.6 89.6 62.6 73.0 p (t-test) 5.2E68 1.5E9 0.083 Min 10.0 20.0 10.0 20.0 10.0 20.0 Max 600 600 600 600 600 438 n (Samp) 4633 165 4633 127 4633 72 n (Patient) 526 165 526 127 526 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.79 0.73 0.78 0.65 0.71 0.64 0.60 0.69 0.56 SE 0.020 0.037 0.021 0.025 0.039 0.027 0.032 0.045 0.035 p 0 9.8E10 0 5.9E10 1.2E7 1.9E7 0.0013 3.0E5 0.100 nCohort 1 4360 5431 4633 4360 5431 4633 4360 5431 4633 nCohort 2 193 61 165 146 56 127 89 44 72 Cutoff 1 102 97.7 99.6 68.3 76.1 70.3 64.0 73.5 56.8 Sens 1 70% 70% 70% 71% 71% 70% 71% 70% 71% Spec 1 72% 67% 70% 49% 52% 50% 46% 50% 39% Cutoff 2 78.4 57.3 78.4 57.0 57.5 57.2 50.8 62.6 48.8 Sens 2 80% 80% 80% 80% 80% 80% 81% 82% 81% Spec 2 57% 37% 57% 39% 37% 39% 33% 41% 31% Cutoff 3 56.9 41.4 62.4 45.4 45.4 45.2 29.7 44.4 29.7 Sens 3 90% 90% 90% 90% 91% 91% 91% 91% 90% Spec 3 39% 23% 44% 28% 26% 28% 14% 25% 14% Cutoff 4 97.9 103 99.6 97.9 103 99.6 97.9 103 99.6 Sens 4 72% 67% 70% 51% 62% 46% 40% 55% 35% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 118 127 121 118 127 121 118 127 121 Sens 5 62% 51% 62% 42% 57% 39% 31% 48% 22% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 158 168 162 158 168 162 158 168 162 Sens 6 48% 46% 48% 22% 36% 20% 21% 34% 14% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.5 1.0 2.0 3.0 2.2 2.9 0.87 2.5 1.0 p Value 0.27 1.0 0.088 0.0012 0.14 0.0029 0.71 0.12 1.0 95% CI of 0.72 0.35 0.90 1.5 0.77 1.4 0.42 0.79 0.47 OR Quart 2 3.1 2.9 4.5 5.8 6.4 5.7 1.8 8.0 2.1 OR Quart 3 3.2 1.4 3.6 2.7 1.4 2.9 1.7 1.8 1.7 p Value 6.1E4 0.47 6.9E4 0.0034 0.57 0.0029 0.094 0.37 0.11 95% CI of 1.6 0.54 1.7 1.4 0.44 1.4 0.91 0.51 0.89 OR Quart 3 6.1 3.8 7.6 5.3 4.4 5.7 3.2 6.0 3.4 OR Quart 4 12 5.4 13 5.9 6.7 5.1 2.0 5.8 1.4 p Value 8.9E16 4.6E5 3.0E13 2.2E8 7.5E5 1.0E6 0.022 0.0012 0.30 95% CI of 6.4 2.4 6.5 3.2 2.6 2.7 1.1 2.0 0.72 OR Quart 4 21 12 25 11 17 9.8 3.7 17 2.9 Metalloproteinase inhibitor 2 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 3.37 6.98 3.37 4.29 3.37 3.76 Average 4.03 9.91 4.03 7.65 4.03 6.12 Stdev 2.96 16.8 2.96 17.1 2.96 13.5 p (t-test) 2.9E68 4.3E24 2.1E8 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 56.2 182 56.2 189 56.2 128 n (Samp) 4360 193 4360 146 4360 89 n (Patient) 495 193 495 146 495 89 sCr only Median 3.52 6.77 3.52 6.29 3.52 5.20 Average 4.30 13.4 4.30 12.7 4.30 6.16 Stdev 3.41 28.4 3.41 27.0 3.41 4.83 p (t-test) 1.7E54 1.5E46 3.2E4 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 56.2 182 56.2 189 56.2 26.8 n (Samp) 5431 61 5431 56 5431 44 n (Patient) 621 61 621 56 621 44 UO only Median 3.39 7.42 3.39 4.17 3.39 3.47 Average 4.32 9.44 4.32 6.77 4.32 6.23 Stdev 6.58 14.1 6.58 11.6 6.58 14.9 p (t-test) 2.8E20 6.0E5 0.018 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 225 171 225 117 225 128 n (Samp) 4633 165 4633 127 4633 72 n (Patient) 526 165 526 127 526 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.78 0.73 0.78 0.61 0.69 0.61 0.56 0.63 0.53 SE 0.020 0.037 0.021 0.025 0.040 0.027 0.032 0.045 0.035 p 0 2.9E10 0 5.1E6 2.3E6 4.1E5 0.057 0.0031 0.45 nCohort 1 4360 5431 4633 4360 5431 4633 4360 5431 4633 nCohort 2 193 61 165 146 56 127 89 44 72 Cutoff 1 4.57 4.24 4.58 3.12 3.77 3.14 2.76 3.41 2.71 Sens 1 70% 70% 70% 71% 71% 70% 71% 70% 71% Spec 1 69% 61% 68% 45% 54% 46% 39% 48% 38% Cutoff 2 3.88 2.96 3.90 2.39 2.21 2.64 2.17 2.55 2.05 Sens 2 80% 80% 80% 80% 80% 80% 81% 82% 81% Spec 2 59% 40% 58% 32% 26% 37% 28% 33% 25% Cutoff 3 2.88 2.28 2.90 1.73 1.73 1.87 0 1.63 0 Sens 3 90% 90% 90% 91% 93% 91% 100% 91% 100% Spec 3 41% 28% 41% 19% 18% 21% 0% 16% 0% Cutoff 4 4.66 4.88 4.73 4.66 4.88 4.73 4.66 4.88 4.73 Sens 4 68% 66% 68% 42% 59% 40% 38% 50% 31% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 5.69 5.98 5.80 5.69 5.98 5.80 5.69 5.98 5.80 Sens 5 63% 61% 62% 32% 52% 30% 30% 43% 21% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 7.33 7.82 7.63 7.33 7.82 7.63 7.33 7.82 7.63 Sens 6 48% 41% 48% 21% 43% 17% 20% 20% 17% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.9 1.2 3.0 1.4 0.60 1.8 1.6 1.5 1.5 p Value 0.098 0.78 0.019 0.21 0.32 0.071 0.15 0.44 0.24 95% CI of 0.89 0.39 1.2 0.82 0.22 0.95 0.84 0.53 0.76 OR Quart 2 4.1 3.5 7.7 2.5 1.6 3.3 3.1 4.2 3.0 OR Quart 3 3.8 1.5 5.5 1.8 1.1 2.2 1.3 1.2 1.3 p Value 2.1E4 0.44 1.5E4 0.036 0.83 0.0087 0.40 0.78 0.48 95% CI of 1.9 0.53 2.3 1.0 0.47 1.2 0.68 0.39 0.64 OR Quart 3 7.7 4.2 13 3.1 2.6 4.0 2.6 3.5 2.6 OR Quart 4 14 6.7 20 2.9 2.9 3.1 2.0 3.7 1.4 p Value 1.3E15 1.7E5 1.3E12 4.9E5 0.0035 1.1E4 0.027 0.0046 0.38 95% CI of 7.4 2.8 8.7 1.7 1.4 1.7 1.1 1.5 0.68 OR Quart 4 27 16 45 4.7 6.1 5.5 3.8 9.2 2.7 Weight Adjusted Urine Output 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.924 0.308 0.924 0.568 0.924 0.717 Average 1.38 0.504 1.38 0.885 1.38 1.14 Stdev 1.48 1.28 1.48 1.46 1.48 1.24 p (t-test) 9.9E16 1.1E4 0.13 Min 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 Max 21.5 16.7 21.5 15.8 21.5 6.00 n (Samp) 3701 193 3701 140 3701 88 n (Patient) 491 193 491 140 491 88 sCr only Median 0.820 0.505 0.820 0.500 0.820 0.637 Average 1.25 1.05 1.25 0.642 1.25 0.851 Stdev 1.41 2.29 1.41 0.542 1.41 1.05 p (t-test) 0.27 0.0013 0.069 Min 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 Max 21.5 16.7 21.5 3.00 21.5 6.00 n (Samp) 4661 58 4661 55 4661 41 n (Patient) 617 58 617 55 617 41 UO only Median 0.919 0.270 0.919 0.538 0.919 0.719 Average 1.39 0.333 1.39 0.890 1.39 1.19 Stdev 1.54 0.414 1.54 1.55 1.54 1.24 p (t-test) 3.1E18 4.8E4 0.28 Min 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 1.00E5 Max 21.5 4.67 21.5 15.8 21.5 5.71 n (Samp) 3986 164 3986 121 3986 73 n (Patient) 525 164 525 121 525 73 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.15 0.34 0.10 0.32 0.32 0.32 0.42 0.36 0.43 SE 0.017 0.039 0.016 0.025 0.040 0.027 0.032 0.047 0.035 p 0 3.5E5 0 4.8E12 7.8E6 2.2E11 0.0097 0.0038 0.048 nCohort 1 3701 4661 3986 3701 4661 3986 3701 4661 3986 nCohort 2 193 58 164 140 55 121 88 41 73 Cutoff 1 0.215 0.282 0.196 0.423 0.376 0.391 0.551 0.344 0.505 Sens 1 70% 71% 70% 70% 71% 70% 70% 71% 71% Spec 1 4% 9% 3% 14% 15% 12% 23% 13% 20% Cutoff 2 0.133 0.214 0.119 0.339 0.291 0.323 0.445 0.240 0.424 Sens 2 80% 81% 80% 80% 80% 80% 81% 80% 81% Spec 2 2% 5% 2% 8% 9% 7% 15% 6% 14% Cutoff 3 0.0977 0.108 0.0943 0.243 0.104 0.240 0.249 0.146 0.260 Sens 3 90% 91% 90% 90% 91% 90% 91% 90% 90% Spec 3 1% 2% 1% 4% 2% 4% 4% 3% 5% Cutoff 4 1.42 1.29 1.41 1.42 1.29 1.41 1.42 1.29 1.41 Sens 4 4% 19% 1% 11% 7% 12% 22% 12% 26% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 1.88 1.74 1.88 1.88 1.74 1.88 1.88 1.74 1.88 Sens 5 3% 10% 1% 7% 4% 7% 14% 10% 18% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 2.78 2.58 2.78 2.78 2.58 2.78 2.78 2.58 2.78 Sens 6 2% 5% 1% 4% 2% 3% 8% 7% 10% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.1 0.89 2.0 2.3 3.4 2.6 1.0 1.4 0.81 p Value 0.79 0.81 0.42 0.022 0.067 0.016 1.00 0.56 0.58 95% CI of 0.41 0.34 0.37 1.1 0.92 1.2 0.50 0.44 0.39 OR Quart 2 3.2 2.3 11 4.7 12 5.6 2.0 4.4 1.7 OR Quart 3 2.6 1.4 5.0 3.3 5.4 2.9 1.8 2.2 1.2 p Value 0.033 0.39 0.037 6.9E4 0.0075 0.0056 0.070 0.14 0.61 95% CI of 1.1 0.62 1.1 1.6 1.6 1.4 0.95 0.77 0.61 OR Quart 3 6.3 3.4 23 6.5 19 6.3 3.3 6.4 2.3 OR Quart 4 27 3.2 86 6.7 8.8 7.4 1.8 3.6 1.6 p Value 0 0.0028 4.2E10 6.9E9 3.6E4 2.5E8 0.070 0.011 0.16 95% CI of 13 1.5 21 3.5 2.7 3.7 0.95 1.3 0.84 OR Quart 4 58 6.7 350 13 29 15 3.3 9.8 3.0 Insulin-like growth factor-binding protein 7/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 74.3 450 74.3 182 74.3 119 Average 76700 1180000 76700 242000 76700 416000 Stdev 902000 7480000 902000 2330000 902000 2920000 p (t-test) 3.0E15 0.053 0.0017 Min 0.929 1.80 0.929 2.93 0.929 3.66 Max 2.49E7 6.00E7 2.49E7 2.66E7 2.49E7 2.50E7 n (Samp) 3691 191 3691 139 3691 87 n (Patient) 491 191 491 139 491 87 sCr only Median 90.2 270 90.2 211 90.2 203 Average 74300 1690000 74300 624000 74300 1640000 Stdev 884000 8750000 884000 3730000 884000 7400000 p (t-test) 1.3E20 3.2E5 5.4E19 Min 0.929 1.80 0.929 17.5 0.929 4.09 Max 2.49E7 6.00E7 2.49E7 2.66E7 2.49E7 3.83E7 n (Samp) 4641 57 4641 54 4641 41 n (Patient) 617 57 617 54 617 41 UO only Median 75.9 560 75.9 168 75.9 111 Average 83100 1390000 83100 58400 83100 502000 Stdev 984000 8090000 984000 639000 984000 3210000 p (t-test) 4.0E18 0.78 9.4E4 Min 0.929 4.28 0.929 2.93 0.929 3.66 Max 2.66E7 6.00E7 2.66E7 7020000 2.66E7 2.50E7 n (Samp) 3970 163 3970 121 3970 72 n (Patient) 525 163 525 121 525 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.87 0.71 0.89 0.69 0.72 0.68 0.60 0.68 0.56 SE 0.017 0.039 0.017 0.025 0.040 0.027 0.032 0.046 0.035 p 0 4.3E8 0 2.1E14 2.0E8 1.1E11 0.0019 7.6E5 0.072 nCohort 1 3691 4641 3970 3691 4641 3970 3691 4641 3970 nCohort 2 191 57 163 139 54 121 87 41 72 Cutoff 1 270 148 324 94.7 138 94.7 69.2 100 59.7 Sens 1 70% 70% 71% 71% 70% 70% 70% 71% 71% Spec 1 87% 66% 89% 57% 63% 56% 48% 53% 42% Cutoff 2 189 74.2 226 63.8 69.8 66.1 32.7 87.1 27.6 Sens 2 80% 81% 80% 81% 81% 80% 80% 80% 81% Spec 2 78% 45% 82% 45% 43% 45% 27% 49% 23% Cutoff 3 128 35.9 155 34.4 55.0 40.2 18.3 25.4 17.5 Sens 3 90% 91% 90% 91% 91% 90% 91% 90% 90% Spec 3 67% 25% 72% 28% 36% 31% 16% 19% 15% Cutoff 4 142 171 146 142 171 146 142 171 146 Sens 4 88% 65% 91% 55% 65% 54% 44% 56% 36% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 204 254 209 204 254 209 204 254 209 Sens 5 77% 54% 82% 46% 48% 45% 32% 46% 28% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 330 428 344 330 428 344 330 428 344 Sens 6 62% 35% 66% 25% 33% 25% 18% 29% 14% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 2.0 1.6 1.5 2.3 3.4 2.0 0.64 1.00 0.75 p Value 0.26 0.41 0.66 0.027 0.067 0.088 0.26 1.00 0.45 95% CI of 0.60 0.52 0.25 1.1 0.92 0.90 0.30 0.29 0.35 OR Quart 2 6.7 4.9 9.0 4.9 12 4.5 1.4 3.5 1.6 OR Quart 3 6.1 2.4 10 3.4 4.4 3.9 1.6 2.2 1.3 p Value 8.2E4 0.099 0.0018 8.1E4 0.022 3.4E4 0.13 0.14 0.41 95% CI of 2.1 0.85 2.4 1.7 1.2 1.8 0.87 0.77 0.68 OR Quart 3 18 6.9 44 6.9 15 8.1 3.0 6.4 2.5 OR Quart 4 46 6.5 79 7.8 9.5 7.0 1.9 4.0 1.4 p Value 5.4E14 9.9E5 8.8E10 1.6E9 2.1E4 6.4E8 0.033 0.0053 0.26 95% CI of 17 2.5 20 4.0 2.9 3.5 1.1 1.5 0.76 OR Quart 4 120 17 320 15 31 14 3.5 11 2.8 Metalloproteinase inhibitor 2/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 3.67 21.1 3.67 8.56 3.67 5.06 Average 4040 135000 4040 32600 4040 20500 Stdev 48800 1300000 48800 295000 48800 151000 p (t-test) 1.5E9 7.5E6 0.0044 Min 0.0558 0.0718 0.0558 0.156 0.0558 0.210 Max 1220000 1.71E7 1220000 3240000 1220000 1340000 n (Samp) 3691 191 3691 139 3691 87 n (Patient) 491 191 491 139 491 87 sCr only Median 4.27 11.7 4.27 10.9 4.27 9.27 Average 3820 344000 3820 83900 3820 104000 Stdev 46500 2280000 46500 472000 46500 479000 p (t-test) 1.2E23 1.2E17 5.7E23 Min 0.0558 0.0718 0.0558 0.670 0.0558 0.248 Max 1220000 1.71E7 1220000 3240000 1220000 2680000 n (Samp) 4641 57 4641 54 4641 41 n (Patient) 617 57 617 54 617 41 UO only Median 3.73 24.7 3.73 8.20 3.73 4.87 Average 4260 159000 4260 26800 4260 24800 Stdev 51700 1410000 51700 295000 51700 166000 p (t-test) 9.2E12 6.7E4 0.0020 Min 0.0558 0.257 0.0558 0.156 0.0558 0.210 Max 1290000 1.71E7 1290000 3240000 1290000 1340000 n (Samp) 3970 163 3970 121 3970 72 n (Patient) 525 163 525 121 525 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.87 0.72 0.89 0.67 0.71 0.67 0.58 0.65 0.56 SE 0.017 0.039 0.017 0.026 0.040 0.027 0.032 0.047 0.035 p 0 1.3E8 0 7.4E12 2.8E7 4.6E10 0.011 9.9E4 0.100 nCohort 1 3691 4641 3970 3691 4641 3970 3691 4641 3970 nCohort 2 191 57 163 139 54 121 87 41 72 Cutoff 1 12.2 6.56 15.7 3.92 5.25 3.99 2.95 4.92 2.69 Sens 1 70% 70% 71% 71% 70% 70% 70% 71% 71% Spec 1 86% 63% 90% 52% 56% 52% 43% 54% 40% Cutoff 2 9.47 4.67 10.9 2.78 3.66 2.88 1.62 3.00 1.30 Sens 2 80% 81% 80% 81% 81% 80% 80% 80% 81% Spec 2 80% 53% 82% 41% 45% 41% 27% 39% 22% Cutoff 3 6.00 1.46 7.55 1.38 1.87 1.65 0.726 0.726 0.719 Sens 3 90% 91% 90% 91% 91% 90% 91% 90% 90% Spec 3 66% 22% 72% 23% 27% 27% 12% 11% 12% Cutoff 4 6.85 8.25 7.03 6.85 8.25 7.03 6.85 8.25 7.03 Sens 4 87% 63% 92% 54% 61% 52% 37% 56% 33% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 9.50 11.6 9.84 9.50 11.6 9.84 9.50 11.6 9.84 Sens 5 80% 53% 84% 45% 46% 41% 31% 39% 29% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 15.2 19.7 16.0 15.2 19.7 16.0 15.2 19.7 16.0 Sens 6 64% 37% 69% 26% 37% 26% 21% 24% 19% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.66 0.57 1.0 1.5 2.2 2.0 1.00 1.00 1.00 p Value 0.53 0.37 1.0 0.25 0.14 0.059 1.00 1.00 1.00 95% CI of 0.19 0.17 0.14 0.76 0.77 0.97 0.50 0.29 0.49 OR Quart 2 2.4 2.0 7.1 2.9 6.4 4.2 2.0 3.5 2.1 OR Quart 3 4.4 1.9 9.7 2.1 1.8 2.6 1.6 2.6 1.3 p Value 0.0011 0.18 0.0023 0.019 0.29 0.0081 0.16 0.068 0.40 95% CI of 1.8 0.74 2.2 1.1 0.60 1.3 0.84 0.93 0.68 OR Quart 3 11 4.7 42 3.9 5.4 5.2 3.0 7.4 2.6 OR Quart 4 31 4.8 81 5.0 5.9 5.7 1.9 3.6 1.5 p Value 2.2E16 1.7E4 7.6E10 2.1E8 2.5E4 1.4E7 0.040 0.011 0.25 95% CI of 13 2.1 20 2.9 2.3 3.0 1.0 1.3 0.76 OR Quart 4 69 11 330 8.8 15 11 3.5 9.8 2.9 Insulin-like growth factor-binding protein 7 X Serum Creatinine 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 49.1 167 49.1 96.5 49.1 78.1 Average 66.8 246 66.8 156 66.8 125 Stdev 63.6 242 63.6 214 63.6 146 p (t-test) 3.7E181 1.3E45 3.9E16 Min 2.00 14.0 2.00 9.20 2.00 14.1 Max 769 1630 769 1820 769 845 n (Samp) 4155 190 4155 144 4155 87 n (Patient) 494 190 494 144 494 87 sCr only Median 54.1 249 54.1 165 54.1 123 Average 76.1 349 76.1 255 76.1 201 Stdev 77.6 300 77.6 234 77.6 200 p (t-test) 2.0E133 2.9E58 5.6E25 Min 2.00 42.1 2.00 9.20 2.00 14.9 Max 973 1180 973 1020 973 950 n (Samp) 5178 61 5178 55 5178 44 n (Patient) 620 61 620 55 620 44 UO only Median 50.3 156 50.3 86.3 50.3 66.7 Average 74.2 234 74.2 141 74.2 103 Stdev 90.4 229 90.4 205 90.4 111 p (t-test) 3.8E87 1.3E14 0.0080 Min 2.00 14.0 2.00 15.2 2.00 14.1 Max 1150 1630 1150 1820 1150 744 n (Samp) 4425 162 4425 125 4425 70 n (Patient) 525 162 525 125 525 70 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.85 0.88 0.83 0.72 0.81 0.70 0.67 0.78 0.62 SE 0.018 0.028 0.020 0.024 0.035 0.027 0.032 0.042 0.036 p 0 0 0 0 0 6.0E14 2.6E7 2.8E11 6.2E4 nCohort 1 4155 5178 4425 4155 5178 4425 4155 5178 4425 nCohort 2 190 61 162 144 55 125 87 44 70 Cutoff 1 100 142 101 62.2 114 60.2 53.9 94.2 51.4 Sens 1 70% 70% 70% 70% 71% 70% 70% 70% 70% Spec 1 82% 88% 80% 62% 82% 59% 55% 75% 51% Cutoff 2 69.7 91.2 70.3 45.5 73.5 45.4 42.5 70.9 42.2 Sens 2 80% 80% 80% 81% 80% 80% 80% 82% 80% Spec 2 67% 74% 66% 46% 65% 45% 42% 63% 41% Cutoff 3 55.6 62.3 52.1 34.9 52.8 33.6 28.4 37.5 28.4 Sens 3 90% 90% 90% 90% 91% 90% 91% 91% 90% Spec 3 56% 57% 52% 34% 49% 32% 26% 33% 26% Cutoff 4 74.4 82.5 76.9 74.4 82.5 76.9 74.4 82.5 76.9 Sens 4 78% 85% 78% 61% 76% 58% 52% 75% 44% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 96.0 107 99.7 96.0 107 99.7 96.0 107 99.7 Sens 5 71% 75% 70% 50% 73% 44% 34% 55% 27% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 135 156 145 135 156 145 135 156 145 Sens 6 57% 69% 54% 35% 55% 27% 23% 41% 19% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 4.7 >3.0 4.4 3.3 0.50 4.1 2.0 1.00 1.9 p Value 0.015 <0.34 0.022 0.0055 0.42 0.0022 0.13 1.00 0.19 95% CI of 1.4 >0.31 1.2 1.4 0.091 1.7 0.81 0.20 0.74 OR Quart 2 16 na 15 7.8 2.7 10.0 5.0 5.0 4.7 OR Quart 3 11 >10 9.2 5.4 2.0 5.6 4.2 2.3 3.9 p Value 9.8E5 <0.028 2.8E4 4.4E5 0.26 1.1E4 6.6E4 0.22 0.0013 95% CI of 3.2 >1.3 2.8 2.4 0.60 2.4 1.8 0.60 1.7 OR Quart 3 35 na 30 12 6.7 14 9.7 9.1 9.0 OR Quart 4 54 >50 44 12 11 11 5.4 11 3.3 p Value 8.8E12 <1.1E4 1.0E10 5.5E10 7.3E6 2.8E8 4.4E5 1.0E4 0.0055 95% CI of 17 >6.9 14 5.4 3.8 4.7 2.4 3.2 1.4 OR Quart 4 170 na 140 26 30 25 12 35 7.8 Metalloproteinase inhibitor 2 X Serum Creatinine 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 2.35 7.48 2.35 4.24 2.35 3.25 Average 3.24 14.8 3.24 9.27 3.24 7.53 Stdev 3.35 33.8 3.35 21.1 3.35 25.3 p (t-test) 8.1E86 5.8E44 7.3E16 Min 0.120 0.840 0.120 0.481 0.120 0.516 Max 51.2 374 51.2 189 51.2 236 n (Samp) 4155 190 4155 144 4155 87 n (Patient) 494 190 494 144 494 87 sCr only Median 2.60 12.3 2.60 8.26 2.60 5.40 Average 3.74 27.2 3.74 16.7 3.74 8.58 Stdev 4.54 57.8 4.54 30.0 4.54 13.2 p (t-test) 1.3E118 5.7E67 9.5E12 Min 0.120 1.40 0.120 0.534 0.120 0.600 Max 69.5 374 69.5 189 69.5 88.4 n (Samp) 5178 61 5178 55 5178 44 n (Patient) 620 61 620 55 620 44 UO only Median 2.40 7.35 2.40 3.93 2.40 3.17 Average 4.04 11.8 4.04 8.75 4.04 7.98 Stdev 14.6 11.8 14.6 21.9 14.6 28.2 p (t-test) 3.2E11 4.8E4 0.028 Min 0.120 0.840 0.120 0.481 0.120 0.516 Max 549 63.3 549 213 549 236 n (Samp) 4425 162 4425 125 4425 70 n (Patient) 525 162 525 125 525 70 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.84 0.88 0.83 0.69 0.79 0.67 0.64 0.74 0.60 SE 0.018 0.029 0.020 0.025 0.036 0.027 0.032 0.043 0.036 p 0 0 0 3.6E14 1.1E15 2.9E10 1.6E5 2.6E8 0.0042 nCohort 1 4155 5178 4425 4155 5178 4425 4155 5178 4425 nCohort 2 190 61 162 144 55 125 87 44 70 Cutoff 1 4.62 6.62 4.58 2.63 4.72 2.54 2.49 3.37 2.34 Sens 1 70% 70% 70% 70% 71% 70% 70% 70% 70% Spec 1 81% 88% 79% 55% 78% 53% 53% 63% 49% Cutoff 2 3.29 5.39 3.28 1.87 3.22 1.87 1.68 2.57 1.63 Sens 2 80% 80% 80% 81% 80% 80% 80% 82% 80% Spec 2 66% 82% 65% 39% 61% 38% 33% 50% 31% Cutoff 3 2.47 3.16 2.47 1.55 1.91 1.55 1.44 1.73 1.44 Sens 3 90% 90% 90% 90% 91% 90% 91% 91% 90% Spec 3 52% 60% 51% 30% 35% 30% 26% 31% 26% Cutoff 4 3.56 3.92 3.64 3.56 3.92 3.64 3.56 3.92 3.64 Sens 4 78% 87% 77% 56% 76% 54% 41% 68% 36% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 4.53 5.07 4.71 4.53 5.07 4.71 4.53 5.07 4.71 Sens 5 71% 82% 69% 46% 62% 42% 37% 61% 29% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 6.31 7.11 6.73 6.31 7.11 6.73 6.31 7.11 6.73 Sens 6 56% 66% 56% 28% 55% 24% 21% 34% 16% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 5.1 4.0 7.6 2.6 1.0 2.6 2.6 1.2 2.2 p Value 0.011 0.21 0.0072 0.0081 1.0 0.0097 0.033 0.74 0.095 95% CI of 1.5 0.45 1.7 1.3 0.25 1.3 1.1 0.33 0.88 OR Quart 2 18 36 33 5.2 4.0 5.5 6.2 4.7 5.3 OR Quart 3 12 5.0 15 3.0 2.0 3.1 3.9 1.3 3.6 p Value 3.7E5 0.14 1.9E4 0.0020 0.26 0.0024 0.0013 0.74 0.0027 95% CI of 3.7 0.58 3.7 1.5 0.60 1.5 1.7 0.34 1.6 OR Quart 3 39 43 64 5.9 6.7 6.3 9.1 4.7 8.4 OR Quart 4 52 53 64 7.0 10 6.2 5.1 7.6 3.3 p Value 1.5E11 8.5E5 6.1E9 2.2E9 1.2E5 1.3E7 8.6E5 1.4E4 0.0055 95% CI of 17 7.3 16 3.7 3.6 3.1 2.3 2.7 1.4 OR Quart 4 160 380 260 13 28 12 12 22 7.8 Insulin-like growth factor-binding protein 7 X Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 54.6 527 54.6 181 54.6 116 Average 58700 1510000 58700 253000 58700 474000 Stdev 666000 1.25E7 666000 2180000 666000 3610000 p (t-test) 1.5E11 0.0041 1.0E5 Min 0.318 3.00 0.318 2.32 0.318 2.46 Max 1.52E7 1.63E8 1.52E7 2.26E7 1.52E7 3.25E7 n (Samp) 3574 187 3574 137 3574 85 n (Patient) 490 187 490 137 490 85 sCr only Median 67.7 430 67.7 317 67.7 229 Average 59500 2770000 59500 641000 59500 3080000 Stdev 687000 1.59E7 687000 3450000 687000 1.55E7 p (t-test) 1.4E26 5.1E8 2.0E32 Min 0.318 3.73 0.318 12.7 0.318 4.75 Max 1.52E7 1.18E8 1.52E7 2.26E7 1.52E7 9.50E7 n (Samp) 4492 57 4492 54 4492 41 n (Patient) 616 57 616 54 616 41 UO only Median 56.8 638 56.8 177 56.8 108 Average 66200 1740000 66200 101000 66200 576000 Stdev 769000 1.35E7 769000 1090000 769000 3980000 p (t-test) 1.3E13 0.63 5.3E6 Min 0.318 3.00 0.318 2.32 0.318 2.46 Max 2.26E7 1.63E8 2.26E7 1.19E7 2.26E7 3.25E7 n (Samp) 3847 159 3847 119 3847 70 n (Patient) 524 159 524 119 524 70 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.90 0.81 0.91 0.74 0.79 0.72 0.65 0.73 0.61 SE 0.015 0.035 0.016 0.025 0.037 0.027 0.033 0.045 0.036 p 0 0 0 0 2.9E15 6.7E16 8.7E6 2.5E7 0.0019 nCohort 1 3574 4492 3847 3574 4492 3847 3574 4492 3847 nCohort 2 187 57 159 137 54 119 85 41 70 Cutoff 1 305 200 370 100 168 95.6 62.3 97.7 45.5 Sens 1 70% 70% 70% 70% 70% 71% 71% 71% 70% Spec 1 91% 79% 92% 68% 74% 65% 54% 61% 44% Cutoff 2 182 109 203 58.3 128 54.9 32.2 74.6 25.7 Sens 2 80% 81% 81% 80% 81% 81% 80% 80% 80% Spec 2 83% 63% 83% 52% 68% 49% 36% 53% 30% Cutoff 3 111 52.0 139 24.6 25.3 24.2 14.8 41.1 14.8 Sens 3 90% 91% 91% 91% 91% 91% 91% 90% 90% Spec 3 71% 43% 75% 30% 26% 29% 20% 37% 20% Cutoff 4 108 140 114 108 140 114 108 140 114 Sens 4 91% 74% 93% 69% 78% 65% 52% 56% 49% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 164 212 174 164 212 174 164 212 174 Sens 5 82% 67% 86% 55% 61% 50% 34% 51% 30% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 272 390 307 272 390 307 272 390 307 Sens 6 72% 56% 73% 31% 46% 24% 25% 41% 21% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 2.5 3.0 2.0 2.4 0.50 1.8 1.4 1.0 1.6 p Value 0.27 0.18 0.57 0.039 0.42 0.17 0.41 1.0 0.30 95% CI of 0.49 0.61 0.18 1.0 0.091 0.79 0.62 0.20 0.67 OR Quart 2 13 15 22 5.5 2.7 4.1 3.2 5.0 3.6 OR Quart 3 11 4.5 15 3.2 3.3 2.8 2.4 4.4 2.1 p Value 0.0011 0.054 0.0085 0.0047 0.038 0.0080 0.019 0.022 0.063 95% CI of 2.6 0.98 2.0 1.4 1.1 1.3 1.2 1.2 0.96 OR Quart 3 48 21 120 7.1 10 6.1 5.1 15 4.7 OR Quart 4 95 21 160 12 9.0 8.2 3.8 7.5 3.2 p Value 1.8E10 3.0E5 3.9E7 5.1E11 3.4E5 4.3E9 2.0E4 0.0011 0.0028 95% CI of 23 5.0 23 5.6 3.2 4.0 1.9 2.2 1.5 OR Quart 4 380 86 1200 24 25 16 7.7 25 6.8 Metalloproteinase inhibitor 2 X Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 2.57 24.5 2.57 7.60 2.57 4.97 Average 3180 85900 3180 48200 3180 24200 Stdev 39700 610000 39700 479000 39700 192000 p (t-test) 6.8E15 2.2E7 9.0E5 Min 0.0191 0.149 0.0191 0.124 0.0191 0.0903 Max 1340000 6330000 1340000 5510000 1340000 1740000 n (Samp) 3574 187 3574 137 3574 85 n (Patient) 490 187 490 137 490 85 sCr only Median 3.21 18.8 3.21 14.8 3.21 9.46 Average 3150 286000 3150 122000 3150 247000 Stdev 39200 1490000 39200 762000 39200 1390000 p (t-test) 4.5E35 1.7E21 1.3E29 Min 0.0191 0.149 0.0191 0.418 0.0191 0.221 Max 1340000 9440000 1340000 5510000 1340000 8840000 n (Samp) 4492 57 4492 54 4492 41 n (Patient) 616 57 616 54 616 41 UO only Median 2.66 29.7 2.66 7.01 2.66 5.01 Average 3450 101000 3450 46300 3450 29300 Stdev 42800 660000 42800 505000 42800 211000 p (t-test) 3.4E18 2.0E6 2.5E5 Min 0.0191 0.180 0.0191 0.124 0.0191 0.0903 Max 1340000 6330000 1340000 5510000 1340000 1740000 n (Samp) 3847 159 3847 119 3847 70 n (Patient) 524 159 524 119 524 70 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.90 0.81 0.91 0.71 0.78 0.70 0.63 0.71 0.61 SE 0.015 0.035 0.016 0.025 0.038 0.027 0.033 0.046 0.036 p 0 0 0 0 1.3E13 3.0E13 7.8E5 6.4E6 0.0035 nCohort 1 3574 4492 3847 3574 4492 3847 3574 4492 3847 nCohort 2 187 57 159 137 54 119 85 41 70 Cutoff 1 13.4 8.23 15.4 4.28 7.88 4.13 2.80 4.11 1.97 Sens 1 70% 70% 70% 70% 70% 71% 71% 71% 70% Spec 1 90% 76% 90% 65% 75% 63% 52% 57% 41% Cutoff 2 8.84 4.92 9.79 2.39 4.28 2.39 1.45 3.03 1.21 Sens 2 80% 81% 81% 80% 81% 81% 80% 80% 80% Spec 2 84% 62% 84% 48% 58% 47% 34% 48% 29% Cutoff 3 5.36 3.10 6.44 1.08 1.84 1.14 0.721 1.88 0.721 Sens 3 90% 91% 91% 91% 91% 91% 91% 90% 90% Spec 3 71% 49% 74% 27% 35% 28% 19% 36% 19% Cutoff 4 5.15 6.69 5.47 5.15 6.69 5.47 5.15 6.69 5.47 Sens 4 91% 74% 94% 65% 74% 61% 48% 56% 44% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 7.55 9.91 8.10 7.55 9.91 8.10 7.55 9.91 8.10 Sens 5 83% 68% 87% 50% 57% 46% 39% 46% 34% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 13.4 17.9 15.0 13.4 17.9 15.0 13.4 17.9 15.0 Sens 6 70% 51% 70% 31% 46% 29% 22% 34% 17% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.5 2.0 2.0 1.7 0.60 2.1 1.5 1.3 1.3 p Value 0.66 0.42 0.57 0.16 0.48 0.063 0.32 0.74 0.53 95% CI of 0.25 0.37 0.18 0.82 0.14 0.96 0.67 0.34 0.57 OR Quart 2 9.0 11 22 3.5 2.5 4.7 3.4 4.7 3.0 OR Quart 3 12 5.5 14 2.4 1.8 3.3 2.4 2.3 1.9 p Value 8.5E4 0.026 0.010 0.013 0.29 0.0019 0.019 0.18 0.098 95% CI of 2.8 1.2 1.9 1.2 0.60 1.5 1.2 0.69 0.89 OR Quart 3 50 25 110 4.7 5.4 7.0 5.1 7.4 4.1 OR Quart 4 95 21 170 6.9 7.6 7.3 3.7 5.8 2.8 p Value 1.7E10 3.0E5 3.7E7 7.7E10 2.2E5 3.4E8 2.8E4 0.0012 0.0048 95% CI of 24 5.0 23 3.7 3.0 3.6 1.8 2.0 1.4 OR Quart 4 390 86 1200 13 19 15 7.5 17 5.9 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.235 1.06 0.235 0.471 0.235 0.331 Average 0.447 2.47 0.447 1.53 0.447 1.07 Stdev 0.662 6.91 0.662 4.49 0.662 2.76 p (t-test) 1.6E67 9.0E35 2.2E14 Min 0.0240 0.0240 0.0240 0.0240 0.0240 0.0240 Max 13.2 83.9 13.2 39.1 13.2 23.3 n (Samp) 4360 193 4360 146 4360 89 n (Patient) 495 193 495 146 495 89 sCr only Median 0.258 1.14 0.258 0.894 0.258 0.740 Average 0.521 3.77 0.521 3.14 0.521 1.34 Stdev 0.864 11.4 0.864 6.98 0.864 1.92 p (t-test) 1.2E64 1.7E67 6.2E10 Min 0.0240 0.0270 0.0240 0.0331 0.0240 0.0357 Max 16.4 83.9 16.4 39.1 16.4 8.59 n (Samp) 5431 61 5431 56 5431 44 n (Patient) 621 61 621 56 621 44 UO only Median 0.239 1.06 0.239 0.446 0.239 0.304 Average 0.526 2.54 0.526 1.47 0.526 0.978 Stdev 1.63 8.41 1.63 6.42 1.63 2.91 p (t-test) 1.3E29 4.8E8 0.021 Min 0.0240 0.0240 0.0240 0.0240 0.0240 0.0240 Max 80.6 103 80.6 70.5 80.6 23.3 n (Samp) 4633 165 4633 127 4633 72 n (Patient) 526 165 526 127 526 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.80 0.74 0.79 0.65 0.71 0.64 0.59 0.67 0.55 SE 0.019 0.037 0.021 0.025 0.039 0.027 0.032 0.045 0.035 p 0 3.3E11 0 6.6E9 1.1E7 5.0E7 0.0060 1.8E4 0.20 nCohort 1 4360 5431 4633 4360 5431 4633 4360 5431 4633 nCohort 2 193 61 165 146 56 127 89 44 72 Cutoff 1 0.528 0.450 0.546 0.199 0.382 0.214 0.159 0.303 0.155 Sens 1 70% 70% 70% 71% 71% 70% 71% 70% 71% Spec 1 74% 67% 74% 45% 62% 47% 39% 55% 38% Cutoff 2 0.342 0.174 0.342 0.160 0.126 0.169 0.127 0.160 0.105 Sens 2 80% 80% 80% 80% 80% 80% 81% 82% 81% Spec 2 61% 38% 61% 39% 31% 40% 33% 36% 29% Cutoff 3 0.179 0.101 0.188 0.0769 0.0769 0.0954 0.0392 0.0549 0.0392 Sens 3 90% 90% 90% 90% 91% 91% 91% 91% 90% Spec 3 42% 26% 43% 22% 20% 27% 11% 15% 11% Cutoff 4 0.448 0.504 0.468 0.448 0.504 0.468 0.448 0.504 0.468 Sens 4 74% 67% 73% 52% 62% 48% 44% 55% 35% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.647 0.716 0.686 0.647 0.716 0.686 0.647 0.716 0.686 Sens 5 63% 61% 61% 37% 55% 31% 30% 50% 19% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 1.09 1.22 1.17 1.09 1.22 1.17 1.09 1.22 1.17 Sens 6 50% 48% 48% 23% 43% 21% 19% 30% 15% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 3.0 1.3 4.3 2.3 1.1 2.8 1.3 1.2 1.3 p Value 0.0067 0.59 0.0037 0.0064 0.80 0.0024 0.50 0.78 0.48 95% CI of 1.4 0.46 1.6 1.3 0.41 1.4 0.65 0.39 0.64 OR Quart 2 6.8 3.9 11 4.1 3.2 5.4 2.4 3.5 2.6 OR Quart 3 3.6 1.5 5.7 1.8 1.3 2.5 1.4 1.2 1.5 p Value 0.0016 0.44 3.5E4 0.071 0.62 0.0095 0.33 0.78 0.24 95% CI of 1.6 0.53 2.2 0.95 0.48 1.2 0.72 0.39 0.76 OR Quart 3 7.9 4.2 15 3.3 3.5 4.8 2.6 3.5 3.0 OR Quart 4 19 6.5 24 4.3 4.7 4.6 2.0 4.1 1.4 p Value 1.3E15 2.2E5 3.6E12 2.1E7 2.4E4 2.4E6 0.030 0.0023 0.38 95% CI of 9.1 2.7 9.9 2.5 2.0 2.4 1.1 1.7 0.68 OR Quart 4 38 15 60 7.5 11 8.6 3.6 9.9 2.7 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.165 1.19 0.165 0.409 0.165 0.303 Average 0.366 3.80 0.366 2.00 0.366 1.40 Stdev 0.694 12.6 0.694 6.72 0.694 4.99 p (t-test) 6.0E63 2.7E42 5.1E22 Min 0.00240 0.0168 0.00240 0.0152 0.00240 0.0169 Max 15.7 156 15.7 64.1 15.7 43.1 n (Samp) 4155 190 4155 144 4155 87 n (Patient) 494 190 494 144 494 87 sCr only Median 0.193 1.93 0.193 0.980 0.193 0.634 Average 0.475 7.40 0.475 4.19 0.475 1.96 Stdev 1.10 21.6 1.10 9.87 1.10 4.23 p (t-test) 3.0E94 7.3E74 3.8E17 Min 0.00240 0.0747 0.00240 0.0152 0.00240 0.0178 Max 31.2 156 31.2 64.1 31.2 25.5 n (Samp) 5178 61 5178 55 5178 44 n (Patient) 620 61 620 55 620 44 UO only Median 0.171 1.18 0.171 0.387 0.171 0.275 Average 0.552 2.85 0.552 2.16 0.552 1.32 Stdev 3.66 4.83 3.66 11.7 3.66 5.36 p (t-test) 1.2E14 1.6E5 0.086 Min 0.00240 0.0168 0.00240 0.0208 0.00240 0.0169 Max 197 38.0 197 128 197 43.1 n (Samp) 4425 162 4425 125 4425 70 n (Patient) 525 162 525 125 525 70 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.84 0.84 0.83 0.69 0.77 0.67 0.63 0.73 0.59 SE 0.018 0.032 0.020 0.025 0.037 0.027 0.032 0.044 0.036 p 0 0 0 5.4E14 2.9E13 3.0E10 4.1E5 1.4E7 0.011 nCohort 1 4155 5178 4425 4155 5178 4425 4155 5178 4425 nCohort 2 190 61 162 144 55 125 87 44 70 Cutoff 1 0.486 0.460 0.544 0.187 0.466 0.187 0.145 0.320 0.134 Sens 1 70% 70% 70% 70% 71% 70% 70% 70% 70% Spec 1 80% 75% 81% 53% 75% 53% 46% 65% 44% Cutoff 2 0.307 0.289 0.336 0.119 0.229 0.119 0.114 0.153 0.110 Sens 2 80% 80% 80% 81% 80% 80% 80% 82% 80% Spec 2 68% 62% 69% 41% 55% 40% 39% 43% 38% Cutoff 3 0.170 0.243 0.170 0.0773 0.0984 0.0773 0.0404 0.105 0.0400 Sens 3 90% 90% 90% 90% 91% 90% 91% 91% 90% Spec 3 51% 57% 50% 30% 31% 29% 17% 33% 17% Cutoff 4 0.332 0.386 0.348 0.332 0.386 0.348 0.332 0.386 0.348 Sens 4 78% 72% 80% 56% 73% 54% 44% 66% 37% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.487 0.580 0.518 0.487 0.580 0.518 0.487 0.580 0.518 Sens 5 69% 69% 70% 44% 64% 38% 33% 52% 29% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 0.831 0.998 0.934 0.831 0.998 0.934 0.831 0.998 0.934 Sens 6 59% 62% 57% 28% 49% 23% 21% 39% 16% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 5.7 >6.0 4.7 2.5 1.8 2.7 1.7 2.3 1.7 p Value 0.0054 <0.097 0.015 0.011 0.37 0.012 0.15 0.22 0.18 95% CI of 1.7 >0.72 1.3 1.2 0.51 1.2 0.82 0.60 0.78 OR Quart 2 20 na 16 5.0 6.0 5.8 3.7 9.1 3.7 OR Quart 3 11 >13 8.5 3.3 1.5 4.2 2.0 2.7 2.0 p Value 6.0E5 <0.013 4.8E4 7.1E4 0.53 1.2E4 0.058 0.15 0.072 95% CI of 3.5 >1.7 2.6 1.6 0.42 2.0 0.98 0.71 0.94 OR Quart 3 37 na 28 6.4 5.3 8.8 4.2 10 4.3 OR Quart 4 52 >43 45 6.8 9.7 6.4 3.3 8.8 2.3 p Value 1.5E11 <2.0E4 9.4E11 4.2E9 1.6E5 3.2E7 7.1E4 3.7E4 0.027 95% CI of 17 >6.0 14 3.6 3.5 3.1 1.6 2.7 1.1 OR Quart 4 160 na 140 13 27 13 6.4 29 4.9 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.256 3.58 0.256 0.795 0.256 0.425 Average 423 75600 423 4110 423 4420 Stdev 6850 780000 6850 34800 6850 36200 p (t-test) 4.9E9 6.2E6 2.3E5 Min 0.00112 0.00216 0.00112 0.00726 0.00112 0.00439 Max 247000 1.03E7 247000 344000 247000 335000 n (Samp) 3691 191 3691 139 3691 87 n (Patient) 491 191 491 139 491 87 sCr only Median 0.324 1.94 0.324 1.61 0.324 0.883 Average 395 191000 395 10600 395 33500 Stdev 6320 1360000 6320 55600 6320 151000 p (t-test) 8.6E22 8.2E18 2.3E42 Min 0.00112 0.00216 0.00112 0.0352 0.00112 0.00610 Max 247000 1.03E7 247000 344000 247000 772000 n (Samp) 4641 57 4641 54 4641 41 n (Patient) 617 57 617 54 617 41 UO only Median 0.266 4.40 0.266 0.649 0.266 0.375 Average 492 88600 492 1890 492 5340 Stdev 8570 844000 8570 20700 8570 39800 p (t-test) 4.9E11 0.099 4.7E5 Min 0.00112 0.00514 0.00112 0.00726 0.00112 0.00439 Max 344000 1.03E7 344000 228000 344000 335000 n (Samp) 3970 163 3970 121 3970 72 n (Patient) 525 163 525 121 525 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.86 0.74 0.88 0.68 0.71 0.67 0.59 0.67 0.56 SE 0.017 0.038 0.018 0.025 0.040 0.027 0.032 0.047 0.035 p 0 6.4E10 0 4.0E12 7.3E8 8.7E10 0.0055 2.2E4 0.12 nCohort 1 3691 4641 3970 3691 4641 3970 3691 4641 3970 nCohort 2 191 57 163 139 54 121 87 41 72 Cutoff 1 1.40 0.784 1.78 0.319 0.423 0.319 0.176 0.367 0.149 Sens 1 70% 70% 71% 71% 70% 70% 70% 71% 71% Spec 1 85% 69% 87% 55% 56% 54% 42% 53% 38% Cutoff 2 0.869 0.222 0.983 0.156 0.193 0.185 0.0830 0.179 0.0632 Sens 2 80% 81% 80% 81% 81% 80% 80% 80% 81% Spec 2 77% 42% 78% 39% 40% 43% 28% 38% 24% Cutoff 3 0.427 0.0632 0.488 0.0707 0.0797 0.0959 0.0220 0.0314 0.0220 Sens 3 90% 91% 90% 91% 91% 90% 91% 90% 90% Spec 3 62% 21% 63% 26% 24% 30% 12% 14% 12% Cutoff 4 0.628 0.800 0.669 0.628 0.800 0.669 0.628 0.800 0.669 Sens 4 85% 68% 88% 55% 63% 50% 44% 59% 38% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 1.04 1.36 1.14 1.04 1.36 1.14 1.04 1.36 1.14 Sens 5 77% 56% 79% 45% 54% 40% 32% 44% 28% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 2.07 2.81 2.24 2.07 2.81 2.24 2.07 2.81 2.24 Sens 6 59% 39% 62% 27% 44% 26% 21% 32% 17% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.4 1.00 2.0 1.7 1.5 1.9 1.1 1.2 1.1 p Value 0.57 1.00 0.42 0.14 0.44 0.080 0.73 0.76 0.86 95% CI of 0.44 0.32 0.37 0.85 0.53 0.92 0.57 0.37 0.52 OR Quart 2 4.4 3.1 11 3.2 4.2 4.0 2.2 3.9 2.2 OR Quart 3 6.2 1.0 13 2.5 1.5 3.1 1.4 2.2 1.3 p Value 1.8E4 1.0 4.3E4 0.0046 0.44 0.0014 0.33 0.14 0.40 95% CI of 2.4 0.32 3.2 1.3 0.53 1.5 0.72 0.77 0.68 OR Quart 3 16 3.1 56 4.7 4.2 6.1 2.7 6.4 2.6 OR Quart 4 35 6.7 75 5.1 5.1 5.3 2.0 3.8 1.4 p Value 7.5E15 1.6E5 1.5E9 3.5E8 2.9E4 5.1E7 0.030 0.0076 0.32 95% CI of 14 2.8 18 2.9 2.1 2.8 1.1 1.4 0.72 OR Quart 4 86 16 300 9.2 12 10 3.6 10 2.7 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.181 3.46 0.181 0.695 0.181 0.408 Average 311 45200 311 4960 311 5530 Stdev 4710 360000 4710 41300 4710 47300 p (t-test) 1.1E13 6.0E9 2.8E8 Min 0.000381 0.00360 0.000381 0.00574 0.000381 0.00295 Max 153000 3800000 153000 387000 153000 435000 n (Samp) 3574 187 3574 137 3574 85 n (Patient) 490 187 490 137 490 85 sCr only Median 0.240 3.00 0.240 2.12 0.240 1.32 Average 303 114000 303 12600 303 74000 Stdev 4470 607000 4470 65400 4470 403000 p (t-test) 8.7E36 1.1E26 2.7E34 Min 0.000381 0.00447 0.000381 0.0265 0.000381 0.00657 Max 153000 3800000 153000 387000 153000 2550000 n (Samp) 4492 57 4492 54 4492 41 n (Patient) 616 57 616 54 616 41 UO only Median 0.191 5.49 0.191 0.673 0.191 0.398 Average 378 53100 378 3260 378 6710 Stdev 6560 390000 6560 35500 6560 52100 p (t-test) 7.2E17 5.1E4 3.3E8 Min 0.000381 0.00360 0.000381 0.00574 0.000381 0.00295 Max 292000 3800000 292000 387000 292000 435000 n (Samp) 3847 159 3847 119 3847 70 n (Patient) 524 159 524 119 524 70 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.89 0.80 0.90 0.71 0.77 0.69 0.62 0.71 0.59 SE 0.016 0.035 0.017 0.025 0.038 0.027 0.033 0.046 0.036 p 0 0 0 4.4E16 1.3E12 3.5E12 1.5E4 4.6E6 0.010 nCohort 1 3574 4492 3847 3574 4492 3847 3574 4492 3847 nCohort 2 187 57 159 137 54 119 85 41 70 Cutoff 1 1.43 0.962 1.61 0.274 0.635 0.237 0.138 0.360 0.103 Sens 1 70% 70% 70% 70% 70% 71% 71% 71% 70% Spec 1 89% 78% 88% 59% 70% 55% 43% 58% 37% Cutoff 2 0.956 0.501 1.16 0.156 0.326 0.167 0.0763 0.229 0.0744 Sens 2 80% 81% 81% 80% 81% 81% 80% 80% 80% Spec 2 83% 65% 84% 47% 56% 47% 33% 49% 32% Cutoff 3 0.492 0.158 0.548 0.0537 0.0537 0.0719 0.0321 0.0926 0.0321 Sens 3 90% 91% 91% 91% 91% 91% 91% 90% 90% Spec 3 71% 41% 72% 28% 24% 31% 20% 32% 20% Cutoff 4 0.468 0.632 0.492 0.468 0.632 0.492 0.468 0.632 0.492 Sens 4 91% 75% 93% 62% 72% 58% 46% 56% 43% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 0.812 1.10 0.888 0.812 1.10 0.888 0.812 1.10 0.888 Sens 5 82% 67% 85% 48% 61% 44% 35% 56% 30% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 1.62 2.57 1.88 1.62 2.57 1.88 1.62 2.57 1.88 Sens 6 66% 54% 67% 29% 48% 24% 24% 37% 20% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 3.0 3.5 3.0 1.8 0.50 1.8 1.8 1.3 2.1 p Value 0.18 0.12 0.34 0.11 0.33 0.13 0.13 0.74 0.063 95% CI of 0.61 0.73 0.31 0.87 0.12 0.83 0.83 0.34 0.96 OR Quart 2 15 17 29 3.8 2.0 3.9 4.0 4.7 4.7 OR Quart 3 11 3.5 17 3.0 1.7 3.3 2.3 2.3 1.8 p Value 0.0011 0.12 0.0057 0.0020 0.32 0.0012 0.027 0.18 0.16 95% CI of 2.6 0.73 2.3 1.5 0.61 1.6 1.1 0.69 0.79 OR Quart 3 48 17 130 5.9 4.6 6.7 4.9 7.4 4.1 OR Quart 4 94 21 160 7.2 6.0 6.2 3.5 5.8 2.9 p Value 1.9E10 2.5E5 4.4E7 1.4E9 5.6E5 1.2E7 5.7E4 0.0012 0.0057 95% CI of 23 5.1 22 3.8 2.5 3.2 1.7 2.0 1.4 OR Quart 4 380 88 1100 14 14 12 7.1 17 6.3 Serum Creatinine 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.700 1.20 0.700 0.980 0.700 0.900 Average 0.797 1.34 0.797 1.15 0.797 1.04 Stdev 0.404 0.785 0.404 0.736 0.404 0.624 p (t-test) 9.9E68 1.7E23 1.4E8 Min 0.100 0.240 0.100 0.270 0.100 0.280 Max 3.42 4.30 3.42 5.30 3.42 4.14 n (Samp) 4509 205 4509 150 4509 92 n (Patient) 495 205 495 150 495 92 sCr only Median 0.730 1.94 0.730 1.48 0.730 1.18 Average 0.842 2.04 0.842 1.56 0.842 1.30 Stdev 0.459 1.05 0.459 0.867 0.459 0.790 p (t-test) 3.7E92 2.6E31 5.0E11 Min 0.100 0.240 0.100 0.370 0.100 0.400 Max 5.50 4.61 5.50 4.21 5.50 4.14 n (Samp) 5641 67 5641 58 5641 44 n (Patient) 621 67 621 58 621 44 UO only Median 0.710 1.12 0.710 0.910 0.710 0.900 Average 0.826 1.29 0.826 1.10 0.826 1.04 Stdev 0.463 0.790 0.463 0.693 0.463 0.623 p (t-test) 2.2E35 5.3E11 5.7E5 Min 0.100 0.260 0.100 0.270 0.100 0.280 Max 7.24 5.08 7.24 5.30 7.24 4.14 n (Samp) 4802 175 4802 130 4802 76 n (Patient) 526 175 526 130 526 76 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.73 0.87 0.70 0.67 0.78 0.64 0.64 0.73 0.62 SE 0.020 0.028 0.022 0.025 0.036 0.027 0.031 0.043 0.035 p 0 0 0 1.2E11 1.1E14 5.5E8 8.7E6 8.8E8 5.2E4 nCohort 1 4509 5641 4802 4509 5641 4802 4509 5641 4802 nCohort 2 205 67 175 150 58 130 92 44 76 Cutoff 1 0.770 1.39 0.690 0.720 0.980 0.690 0.690 0.890 0.690 Sens 1 70% 70% 76% 70% 71% 75% 72% 73% 71% Spec 1 57% 90% 44% 53% 72% 44% 45% 64% 44% Cutoff 2 0.660 1.09 0.640 0.590 0.820 0.590 0.590 0.760 0.590 Sens 2 80% 81% 81% 81% 81% 82% 83% 82% 82% Spec 2 43% 79% 40% 32% 61% 31% 32% 53% 31% Cutoff 3 0.540 0.790 0.530 0.490 0.490 0.490 0.490 0.660 0.490 Sens 3 90% 91% 91% 93% 93% 93% 91% 91% 92% Spec 3 28% 55% 26% 20% 17% 19% 20% 40% 19% Cutoff 4 0.900 0.930 0.900 0.900 0.930 0.900 0.900 0.930 0.900 Sens 4 64% 82% 62% 53% 72% 51% 49% 66% 47% Spec 4 73% 70% 71% 73% 70% 71% 73% 70% 71% Cutoff 5 1.02 1.10 1.08 1.02 1.10 1.08 1.02 1.10 1.08 Sens 5 59% 78% 55% 42% 62% 37% 40% 57% 36% Spec 5 80% 81% 80% 80% 81% 80% 80% 81% 80% Cutoff 6 1.30 1.39 1.35 1.30 1.39 1.35 1.30 1.39 1.35 Sens 6 41% 70% 35% 29% 55% 25% 23% 34% 25% Spec 6 91% 90% 90% 91% 90% 90% 91% 90% 90% OR Quart 2 2.6 1.5 2.4 1.5 0.33 1.2 1.6 0.75 1.7 p Value 0.0012 0.66 0.0046 0.18 0.18 0.64 0.21 0.71 0.18 95% CI of 1.5 0.25 1.3 0.83 0.067 0.63 0.77 0.17 0.78 OR Quart 2 4.7 9.0 4.3 2.8 1.6 2.2 3.3 3.4 3.7 OR Quart 3 1.6 4.0 1.5 1.7 2.2 1.6 1.6 2.8 1.6 p Value 0.16 0.079 0.21 0.084 0.12 0.12 0.21 0.082 0.24 95% CI of 0.84 0.85 0.80 0.93 0.82 0.89 0.77 0.88 0.73 OR Quart 3 3.0 19 2.9 3.0 5.7 2.8 3.3 8.7 3.6 OR Quart 4 8.5 28 6.6 4.4 6.3 3.2 3.6 6.6 3.4 p Value 2.2E15 3.8E6 5.4E12 2.8E8 3.1E5 1.2E5 1.1E4 4.6E4 8.5E4 95% CI of 5.0 6.8 3.8 2.6 2.7 1.9 1.9 2.3 1.6 OR Quart 4 14 120 11 7.4 15 5.4 6.9 19 6.9 Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior 24 hr prior 48 hr prior to AKI stage to AKI stage to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.761 3.55 0.761 1.70 0.761 1.29 Average 754 5140 754 1850 754 2300 Stdev 8280 29500 8280 16100 8280 15800 p (t-test) 1.8E8 0.15 0.095 Min 0.0159 0.124 0.0159 0.0498 0.0159 0.0753 Max 180000 280000 180000 170000 180000 130000 n (Samp) 3584 189 3584 138 3584 87 n (Patient) 490 189 490 138 490 87 sCr only Median 0.914 3.45 0.914 2.79 0.914 2.05 Average 758 11600 758 4640 758 10300 Stdev 8490 61600 8490 25400 8490 53400 p (t-test) 6.2E14 0.0013 1.0E9 Min 0.0159 0.124 0.0159 0.200 0.0159 0.184 Max 180000 421000 180000 170000 180000 330000 n (Samp) 4512 58 4512 55 4512 40 n (Patient) 616 58 616 55 616 40 UO only Median 0.784 4.30 0.784 1.60 0.784 1.19 Average 819 5610 819 1430 819 2780 Stdev 9040 29400 9040 15600 9040 17300 p (t-test) 2.4E8 0.48 0.075 Min 0.0159 0.150 0.0159 0.0498 0.0159 0.0753 Max 230000 280000 230000 170000 230000 130000 n (Samp) 3863 160 3863 119 3863 72 n (Patient) 524 160 524 119 524 72 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.88 0.79 0.90 0.73 0.78 0.71 0.64 0.72 0.62 SE 0.016 0.035 0.017 0.025 0.037 0.027 0.032 0.046 0.036 p 0 0 0 0 8.1E14 6.2E15 2.0E5 2.6E6 0.0011 nCohort 1 3584 4512 3863 3584 4512 3863 3584 4512 3863 nCohort 2 189 58 160 138 55 119 87 40 72 Cutoff 1 2.34 1.82 2.61 1.21 1.69 1.16 0.839 1.39 0.640 Sens 1 70% 71% 70% 70% 71% 71% 70% 70% 71% Spec 1 88% 75% 90% 69% 73% 66% 54% 66% 42% Cutoff 2 1.70 1.24 1.92 0.824 1.32 0.750 0.530 1.05 0.469 Sens 2 80% 81% 80% 80% 80% 81% 80% 80% 81% Spec 2 80% 62% 82% 53% 64% 49% 36% 55% 31% Cutoff 3 1.17 0.813 1.33 0.460 0.731 0.460 0.331 0.549 0.332 Sens 3 90% 91% 90% 91% 91% 91% 91% 90% 90% Spec 3 67% 46% 70% 31% 42% 30% 21% 32% 21% Cutoff 4 1.27 1.54 1.32 1.27 1.54 1.32 1.27 1.54 1.32 Sens 4 88% 74% 91% 69% 71% 66% 52% 65% 46% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 1.71 2.11 1.78 1.71 2.11 1.78 1.71 2.11 1.78 Sens 5 80% 60% 84% 49% 56% 48% 38% 50% 33% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 2.59 3.38 2.68 2.59 3.38 2.68 2.59 3.38 2.68 Sens 6 64% 52% 69% 28% 42% 25% 18% 35% 18% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.3 1.7 2.0 2.4 6.0 2.6 1.00 1.0 1.1 p Value 0.71 0.48 0.57 0.039 0.097 0.033 1.00 1.0 0.84 95% CI of 0.30 0.40 0.18 1.0 0.72 1.1 0.46 0.25 0.48 OR Quart 2 6.0 7.0 22 5.5 50 6.2 2.2 4.0 2.5 OR Quart 3 9.9 3.4 21 3.8 12 4.1 1.9 2.5 1.9 p Value 1.6E4 0.067 0.0028 7.8E4 0.017 9.2E4 0.073 0.12 0.080 95% CI of 3.0 0.92 2.9 1.8 1.6 1.8 0.94 0.79 0.92 OR Quart 3 33 12 160 8.4 93 9.4 3.7 8.0 4.0 OR Quart 4 61 14 160 11 37 10 2.9 5.6 2.6 p Value 2.3E12 1.2E5 4.9E7 1.4E10 3.7E4 8.5E9 0.0010 0.0016 0.0080 95% CI of 19 4.2 22 5.3 5.1 4.6 1.5 1.9 1.3 OR Quart 4 190 45 1100 23 270 22 5.5 16 5.2

(91) TABLE-US-00008 TABLE 3 Comparison of the maximum marker levels in samples collected from Cohort 1 (patients that did not progress beyond RIFLE stage 0) and the maximum values in samples collected from subjects between enrollment and 0, 24 hours, and 48 hours prior to reaching stage F in Cohort 2. Insulin-like growth factor-binding protein 7 and Metalloproteinase inhibitor 2 were measured in urine. Insulin-like growth factor-binding protein 7 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 128 248 128 205 128 168 Average 146 272 146 257 146 207 Stdev 78.5 149 78.5 145 78.5 111 p (t-test) 1.3E17 1.1E13 6.3E5 Min 32.1 70.2 32.1 70.2 32.1 23.7 Max 600 600 600 600 600 498 n (Samp) 275 53 275 48 275 33 n (Patient) 275 53 275 48 275 33 sCr only Median 146 220 146 202 146 194 Average 162 255 162 244 162 216 Stdev 82.1 141 82.1 127 82.1 110 p (t-test) 3.2E9 3.8E7 0.0018 Min 32.1 70.2 32.1 70.2 32.1 70.2 Max 600 600 600 600 600 498 n (Samp) 518 34 518 31 518 25 n (Patient) 518 34 518 31 518 25 UO only Median 130 272 130 215 130 168 Average 149 296 149 273 149 218 Stdev 82.6 160 82.6 163 82.6 134 p (t-test) 5.0E16 1.5E11 0.0014 Min 32.1 70.2 32.1 70.2 32.1 23.7 Max 600 600 600 595 600 498 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.78 0.71 0.79 0.77 0.71 0.74 0.68 0.65 0.66 SE 0.039 0.051 0.049 0.042 0.053 0.054 0.053 0.061 0.074 p 2.9E13 3.7E5 2.4E9 1.8E10 6.4E5 1.0E5 5.5E4 0.014 0.028 nCohort 1 275 518 331 275 518 331 275 518 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 165 162 201 167 167 142 134 151 134 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 71% 58% 80% 72% 61% 56% 53% 53% 52% Cutoff 2 130 129 134 134 151 120 118 124 118 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 51% 41% 52% 53% 53% 44% 45% 38% 44% Cutoff 3 118 114 118 118 118 97.1 94.1 94.1 68.2 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 45% 32% 44% 45% 36% 26% 25% 19% 11% Cutoff 4 165 193 167 165 193 167 165 193 167 Sens 4 72% 59% 74% 71% 58% 69% 55% 52% 53% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 194 224 201 194 224 201 194 224 201 Sens 5 62% 50% 71% 56% 42% 59% 42% 36% 41% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 239 278 247 239 278 247 239 278 247 Sens 6 51% 41% 58% 40% 32% 45% 30% 28% 35% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 3.2 1.7 2.6 2.4 2.0 1.7 1.3 1.3 1.5 p Value 0.086 0.48 0.27 0.21 0.42 0.47 0.73 0.71 0.65 95% CI of 0.85 0.40 0.48 0.60 0.37 0.40 0.33 0.29 0.25 OR Quart 2 12 7.2 14 9.7 11 7.4 4.9 6.1 9.3 OR Quart 3 2.8 3.1 1.0 4.0 6.5 1.3 2.1 2.4 2.0 p Value 0.13 0.091 1.0 0.038 0.016 0.70 0.24 0.21 0.42 95% CI of 0.73 0.83 0.14 1.1 1.4 0.29 0.61 0.60 0.37 OR Quart 3 11 12 7.3 15 30 6.2 7.3 9.4 11 OR Quart 4 18 6.3 14 13 7.0 6.8 4.8 3.9 4.3 p Value 5.0E6 0.0039 4.8E4 5.7E5 0.011 0.0031 0.0075 0.041 0.070 95% CI of 5.2 1.8 3.2 3.7 1.6 1.9 1.5 1.1 0.89 OR Quart 4 61 22 62 44 32 24 15 14 21 Metalloproteinase inhibitor 2 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 6.10 13.2 6.10 10.7 6.10 9.83 Average 7.10 28.6 7.10 25.6 7.10 19.4 Stdev 4.95 46.3 4.95 42.0 4.95 37.3 p (t-test) 4.4E13 1.0E11 4.8E7 Min 1.64 1.20 1.64 1.20 1.64 1.20 Max 56.2 225 56.2 189 56.2 189 n (Samp) 275 53 275 48 275 33 n (Patient) 275 53 275 48 275 33 sCr only Median 6.69 11.8 6.69 10.5 6.69 10.2 Average 7.98 33.7 7.98 31.6 7.98 23.0 Stdev 5.31 56.0 5.31 50.4 5.31 42.3 p (t-test) 1.6E21 1.7E21 3.4E12 Min 1.64 1.20 1.64 1.20 1.64 1.20 Max 56.2 225 56.2 189 56.2 189 n (Samp) 518 34 518 31 518 25 n (Patient) 518 34 518 31 518 25 UO only Median 6.07 16.6 6.07 13.9 6.07 10.3 Average 7.15 20.0 7.15 16.3 7.15 12.5 Stdev 5.03 16.1 5.03 14.8 5.03 8.78 p (t-test) 1.1E21 6.9E13 6.2E5 Min 1.62 3.76 1.62 3.76 1.62 1.20 Max 56.2 79.0 56.2 79.0 56.2 32.4 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.80 0.75 0.81 0.77 0.73 0.78 0.68 0.68 0.69 SE 0.038 0.049 0.048 0.042 0.052 0.052 0.054 0.060 0.073 p 4.0E15 3.1E7 4.6E11 1.4E10 8.4E6 1.1E7 7.9E4 0.0030 0.0083 nCohort 1 275 518 331 275 518 331 275 518 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 9.37 9.37 10.2 7.03 7.61 7.49 5.64 7.61 6.69 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 82% 73% 86% 63% 58% 67% 42% 58% 60% Cutoff 2 6.69 6.73 7.71 6.24 6.42 5.84 5.45 5.64 5.45 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 60% 50% 69% 53% 47% 46% 40% 35% 41% Cutoff 3 5.12 5.12 4.46 5.37 5.37 4.46 3.87 3.87 3.71 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 35% 27% 26% 39% 31% 26% 17% 12% 14% Cutoff 4 7.87 8.83 7.82 7.87 8.83 7.82 7.87 8.83 7.82 Sens 4 74% 71% 77% 62% 68% 66% 58% 60% 59% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 9.06 10.7 9.15 9.06 10.7 9.15 9.06 10.7 9.15 Sens 5 72% 50% 77% 62% 48% 66% 52% 40% 53% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 11.4 12.7 11.4 11.4 12.7 11.4 11.4 12.7 11.4 Sens 6 55% 50% 65% 48% 45% 55% 39% 36% 47% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.79 1.3 0.99 2.4 2.6 1.0 1.0 1.3 0.66 p Value 0.73 0.70 0.99 0.21 0.27 1.0 1.0 0.71 0.65 95% CI of 0.20 0.29 0.19 0.60 0.49 0.20 0.28 0.29 0.11 OR Quart 2 3.1 6.1 5.0 9.7 13 5.1 3.6 6.1 4.0 OR Quart 3 1.4 2.0 0.33 2.8 2.6 1.3 1.2 0.99 1.0 p Value 0.55 0.32 0.34 0.14 0.27 0.70 0.75 0.99 1.0 95% CI of 0.44 0.50 0.033 0.72 0.49 0.29 0.36 0.20 0.20 OR Quart 3 4.7 8.3 3.2 11 13 6.2 4.2 5.0 5.1 OR Quart 4 13 8.1 10 15 11 7.8 4.1 5.5 3.2 p Value 7.1E7 9.1E4 2.2E4 1.7E5 0.0016 0.0014 0.0090 0.0085 0.087 95% CI of 4.6 2.3 3.0 4.4 2.5 2.2 1.4 1.5 0.84 OR Quart 4 35 28 36 52 47 27 12 19 12 Weight Adjusted Urine Output 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 2.78 0.714 2.78 0.742 2.78 1.65 Average 3.61 2.07 3.61 2.14 3.61 2.84 Stdev 2.90 3.01 2.90 3.14 2.90 3.50 p (t-test) 4.8E4 0.0015 0.16 Min 0.333 0.0476 0.333 0.0476 0.333 1.00E5 Max 21.5 15.9 21.5 15.9 21.5 15.9 n (Samp) 273 53 273 48 273 33 n (Patient) 273 53 273 48 273 33 sCr only Median 2.29 1.04 2.29 1.15 2.29 1.65 Average 3.05 2.59 3.05 2.66 3.05 3.03 Stdev 2.62 3.50 2.62 3.65 2.62 3.90 p (t-test) 0.34 0.44 0.97 Min 0.168 0.0476 0.168 0.0366 0.168 1.00E5 Max 21.5 15.9 21.5 15.9 21.5 15.9 n (Samp) 515 34 515 31 515 25 n (Patient) 515 34 515 31 515 25 UO only Median 2.82 0.530 2.82 0.500 2.82 1.15 Average 3.67 1.27 3.67 1.31 3.67 2.06 Stdev 2.96 1.73 2.96 1.78 2.96 2.03 p (t-test) 1.2E5 3.0E5 0.027 Min 0.333 0.0476 0.333 0.0476 0.333 0.143 Max 21.5 6.05 21.5 6.05 21.5 6.05 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.24 0.34 0.16 0.24 0.34 0.17 0.34 0.39 0.28 SE 0.040 0.052 0.045 0.042 0.055 0.047 0.054 0.061 0.072 p 5.5E11 0.0027 2.3E14 1.7E9 0.0036 2.4E12 0.0026 0.067 0.0025 nCohort 1 273 515 331 273 515 331 273 515 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 0.500 0.609 0.275 0.463 0.541 0.235 0.542 0.547 0.532 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 0% 5% 0% 0% 3% 0% 1% 3% 1% Cutoff 2 0.333 0.532 0.235 0.244 0.524 0.112 0.521 0.541 0.442 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 0% 3% 0% 0% 3% 0% 1% 3% 0% Cutoff 3 0.117 0.450 0.0625 0.107 0.450 0.0952 0.442 0.460 0.143 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 0% 2% 0% 0% 2% 0% 0% 2% 0% Cutoff 4 4.00 3.50 4.00 4.00 3.50 4.00 4.00 3.50 4.00 Sens 4 17% 26% 10% 19% 29% 10% 24% 32% 18% Spec 4 72% 70% 71% 72% 70% 71% 72% 70% 71% Cutoff 5 5.20 4.28 5.30 5.20 4.28 5.30 5.20 4.28 5.30 Sens 5 13% 24% 10% 15% 26% 10% 18% 28% 18% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 7.06 6.20 7.18 7.06 6.20 7.18 7.06 6.20 7.18 Sens 6 4% 6% 0% 4% 6% 0% 6% 8% 0% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.53 0.36 1.0 0.42 0.12 1.0 0.61 0.27 0.66 p Value 0.28 0.14 0.99 0.17 0.047 1.0 0.40 0.11 0.65 95% CI of 0.17 0.094 0.20 0.12 0.015 0.20 0.19 0.056 0.11 OR Quart 2 1.7 1.4 5.1 1.4 0.97 5.1 1.9 1.3 4.0 OR Quart 3 0.42 0.49 0.33 0.42 0.61 0.33 0.35 0.56 0.66 p Value 0.16 0.25 0.34 0.17 0.40 0.34 0.13 0.36 0.65 95% CI of 0.12 0.14 0.033 0.12 0.19 0.033 0.089 0.16 0.11 OR Quart 3 1.4 1.7 3.2 1.4 1.9 3.2 1.4 2.0 4.0 OR Quart 4 6.2 2.6 11 5.1 2.3 9.4 2.5 1.8 3.6 p Value 1.4E5 0.029 1.9E4 1.2E4 0.062 4.3E4 0.050 0.24 0.057 95% CI of 2.7 1.1 3.1 2.2 0.96 2.7 1.0 0.68 0.96 OR Quart 4 14 6.2 37 12 5.5 33 6.2 4.7 14 Insulin-like growth factor-binding protein 7/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 224 889 224 713 224 425 Average 273000 5260000 273000 3380000 273000 1380000 Stdev 1470000 1.52E7 1470000 1.29E7 1470000 6740000 p (t-test) 2.0E7 1.3E4 0.022 Min 13.9 7.84 13.9 7.84 13.9 7.84 Max 1.26E7 6.00E7 1.26E7 5.86E7 1.26E7 3.83E7 n (Samp) 273 53 273 48 273 33 n (Patient) 273 53 273 48 273 33 sCr only Median 317 477 317 477 317 400 Average 516000 4770000 516000 2390000 516000 2970000 Stdev 2370000 1.34E7 2370000 8500000 2370000 9410000 p (t-test) 4.2E9 9.3E4 1.0E4 Min 13.9 80.5 13.9 103 13.9 66.2 Max 2.49E7 6.00E7 2.49E7 3.83E7 2.49E7 3.83E7 n (Samp) 515 34 515 31 515 25 n (Patient) 515 34 515 31 515 25 UO only Median 224 3430 224 1860 224 972 Average 304000 7390000 304000 5940000 304000 2670000 Stdev 1520000 1.67E7 1520000 1.63E7 1520000 9340000 p (t-test) 5.0E13 2.8E9 1.6E4 Min 14.1 7.84 14.1 7.84 14.1 7.84 Max 1.26E7 5.86E7 1.26E7 5.86E7 1.26E7 3.83E7 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.79 0.64 0.88 0.78 0.65 0.86 0.69 0.58 0.75 SE 0.039 0.053 0.041 0.041 0.055 0.045 0.053 0.061 0.070 p 1.5E13 0.0062 0 2.7E12 0.0047 1.3E15 4.5E4 0.20 3.3E4 nCohort 1 273 515 331 273 515 331 273 515 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 388 357 1580 398 365 834 270 271 451 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 77% 55% 95% 78% 57% 91% 62% 43% 80% Cutoff 2 344 208 917 282 271 487 155 181 208 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 73% 32% 92% 64% 43% 82% 34% 26% 47% Cutoff 3 142 142 434 150 155 208 107 142 109 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 31% 19% 80% 33% 21% 47% 19% 19% 18% Cutoff 4 326 558 315 326 558 315 326 558 315 Sens 4 81% 47% 90% 79% 48% 90% 64% 36% 71% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 426 859 445 426 859 445 426 859 445 Sens 5 68% 38% 87% 67% 39% 86% 48% 28% 71% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 791 1810 806 791 1810 806 791 1810 806 Sens 6 51% 24% 81% 46% 26% 72% 30% 16% 53% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.78 0.32 0.49 1.7 0.99 0.49 1.2 0.79 1.0 p Value 0.72 0.17 0.56 0.47 0.99 0.57 0.75 0.74 1.0 95% CI of 0.20 0.064 0.044 0.39 0.24 0.044 0.32 0.21 0.14 OR Quart 2 3.0 1.6 5.5 7.4 4.1 5.6 4.8 3.0 7.3 OR Quart 3 2.6 1.9 0.49 3.7 2.3 0.49 1.5 1.4 0.49 p Value 0.081 0.22 0.57 0.056 0.17 0.57 0.52 0.56 0.57 95% CI of 0.89 0.68 0.044 0.97 0.70 0.044 0.42 0.44 0.044 OR Quart 3 7.9 5.3 5.6 14 7.8 5.6 5.7 4.6 5.6 OR Quart 4 9.7 2.7 19 15 3.8 17 5.5 1.9 6.8 p Value 9.7E6 0.050 1.0E4 1.7E5 0.023 1.7E4 0.0033 0.28 0.014 95% CI of 3.6 1.0 4.3 4.4 1.2 3.9 1.8 0.61 1.5 OR Quart 4 27 7.1 81 52 12 74 17 5.7 31 Metalloproteinase inhibitor 2/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 10.3 43.9 10.3 37.1 10.3 22.0 Average 14600 696000 14600 242000 14600 146000 Stdev 77500 2570000 77500 957000 77500 619000 p (t-test) 1.5E5 1.3E4 9.9E4 Min 0.485 0.396 0.485 0.396 0.485 0.396 Max 579000 1.71E7 579000 5610000 579000 3240000 n (Samp) 273 53 273 48 273 33 n (Patient) 273 53 273 48 273 33 sCr only Median 14.7 26.1 14.7 25.4 14.7 21.5 Average 25900 789000 25900 242000 25900 299000 Stdev 118000 3000000 118000 782000 118000 863000 p (t-test) 1.2E8 1.1E7 1.2E9 Min 0.485 1.45 0.485 1.45 0.485 1.45 Max 1210000 1.71E7 1210000 3240000 1210000 3240000 n (Samp) 515 34 515 31 515 25 n (Patient) 515 34 515 31 515 25 UO only Median 10.1 204 10.1 122 10.1 35.9 Average 15700 650000 15700 414000 15700 283000 Stdev 77700 1450000 77700 1210000 77700 851000 p (t-test) 2.7E14 7.1E9 1.1E7 Min 0.846 0.396 0.846 0.396 0.846 0.396 Max 579000 5610000 579000 5610000 579000 3240000 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.79 0.66 0.86 0.77 0.66 0.84 0.69 0.58 0.77 SE 0.039 0.052 0.043 0.041 0.055 0.046 0.053 0.061 0.068 p 5.7E14 0.0021 0 3.8E11 0.0045 1.5E13 3.5E4 0.18 6.4E5 nCohort 1 273 515 331 273 515 331 273 515 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 19.5 18.5 95.7 19.5 18.5 33.1 11.3 11.3 19.3 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 81% 60% 95% 81% 60% 89% 56% 37% 80% Cutoff 2 11.5 11.3 48.2 11.3 11.3 22.9 6.22 8.38 16.5 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 57% 37% 93% 56% 37% 83% 30% 26% 74% Cutoff 3 6.00 5.99 9.98 5.99 5.99 6.54 5.18 5.18 6.22 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 27% 17% 49% 27% 17% 31% 23% 14% 30% Cutoff 4 15.0 25.7 15.0 15.0 25.7 15.0 15.0 25.7 15.0 Sens 4 79% 50% 87% 75% 48% 86% 67% 40% 82% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 19.1 38.7 19.3 19.1 38.7 19.3 19.1 38.7 19.3 Sens 5 72% 38% 84% 71% 42% 83% 58% 32% 71% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 33.8 88.5 37.9 33.8 88.5 37.9 33.8 88.5 37.9 Sens 6 58% 29% 81% 52% 32% 66% 36% 20% 41% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 0.64 0.49 3.0 0.79 0.79 3.1 1.2 0.79 2.0 p Value 0.50 0.32 0.34 0.73 0.73 0.34 0.75 0.74 0.57 95% CI of 0.17 0.12 0.31 0.20 0.21 0.31 0.32 0.21 0.18 OR Quart 2 2.4 2.0 30 3.1 3.0 30 4.8 3.0 23 OR Quart 3 1.2 1.5 1.0 1.2 1.4 1.0 1.0 1.4 2.0 p Value 0.77 0.43 1.0 0.76 0.56 1.0 1.0 0.56 0.57 95% CI of 0.38 0.53 0.062 0.36 0.44 0.062 0.24 0.44 0.18 OR Quart 3 3.7 4.4 16 4.2 4.6 16 4.2 4.6 23 OR Quart 4 9.8 2.9 36 10 3.2 32 6.3 1.9 14 p Value 1.9E6 0.034 5.4E4 5.7E6 0.028 7.7E4 0.0014 0.28 0.013 95% CI of 3.8 1.1 4.7 3.8 1.1 4.3 2.0 0.61 1.7 OR Quart 4 25 7.6 270 28 9.1 250 20 5.7 110 Insulin-like growth factor-binding protein 7 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 94.2 423 94.2 338 94.2 263 Average 123 510 123 435 123 269 Stdev 104 402 104 374 104 159 p (t-test) 1.7E34 3.6E26 6.4E12 Min 7.34 66.8 7.34 64.2 7.34 33.7 Max 765 1820 765 1820 765 687 n (Samp) 274 53 274 48 274 33 n (Patient) 274 53 274 48 274 33 sCr only Median 115 420 115 341 115 285 Average 150 490 150 419 150 314 Stdev 126 340 126 270 126 207 p (t-test) 5.4E34 5.6E24 1.6E9 Min 7.34 66.8 7.34 66.8 7.34 66.8 Max 973 1420 973 1100 973 950 n (Samp) 517 34 517 31 517 25 n (Patient) 517 34 517 31 517 25 UO only Median 99.8 446 99.8 386 99.8 247 Average 133 628 133 483 133 259 Stdev 115 576 115 442 115 171 p (t-test) 9.0E33 4.5E24 2.3E5 Min 7.34 97.4 7.34 64.2 7.34 33.7 Max 869 2490 869 1820 869 687 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.89 0.87 0.90 0.88 0.87 0.86 0.81 0.80 0.77 SE 0.030 0.040 0.038 0.033 0.042 0.045 0.047 0.054 0.068 p 0 0 0 0 0 1.1E15 4.8E11 4.1E8 6.9E5 nCohort 1 274 517 330 274 517 330 274 517 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 246 271 249 231 271 209 152 173 152 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 93% 90% 91% 91% 90% 86% 78% 74% 74% Cutoff 2 158 209 209 158 209 139 114 153 114 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 80% 82% 86% 80% 82% 70% 62% 65% 58% Cutoff 3 114 119 114 104 158 104 100 112 79.5 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 62% 52% 58% 58% 68% 54% 56% 48% 37% Cutoff 4 131 163 138 131 163 138 131 163 138 Sens 4 85% 85% 87% 85% 84% 83% 73% 72% 71% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 159 202 181 159 202 181 159 202 181 Sens 5 79% 82% 81% 79% 81% 76% 67% 64% 65% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 224 282 237 224 282 237 224 282 237 Sens 6 74% 68% 74% 71% 68% 66% 58% 52% 53% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 4.1 3.0 >2.0 0.99 2.0 0.99 2.0 2.0 0.99 p Value 0.21 0.34 <0.56 0.99 0.57 0.99 0.57 0.57 0.99 95% CI of 0.45 0.31 >0.18 0.14 0.18 0.061 0.18 0.18 0.061 OR Quart 2 38 29 na 7.2 22 16 23 22 16 OR Quart 3 7.5 2.0 >4.2 3.7 2.0 5.2 8.7 6.2 4.1 p Value 0.063 0.57 <0.20 0.11 0.57 0.14 0.044 0.092 0.21 95% CI of 0.90 0.18 >0.46 0.75 0.18 0.59 1.1 0.74 0.45 OR Quart 3 62 22 na 19 22 45 71 52 37 OR Quart 4 80 35 >34 33 32 28 30 18 12 p Value 2.1E5 5.5E4 <6.3E4 3.3E6 7.5E4 0.0012 0.0010 0.0055 0.018 95% CI of 11 4.6 >4.5 7.5 4.3 3.7 3.9 2.3 1.6 OR Quart 4 600 260 na 140 240 220 230 140 98 Metalloproteinase inhibitor 2 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 4.47 21.2 4.47 19.9 4.47 12.0 Average 5.78 51.0 5.78 40.8 5.78 26.2 Stdev 5.59 88.2 5.59 70.1 5.59 49.9 p (t-test) 9.8E16 6.7E15 3.0E10 Min 0.333 2.57 0.333 2.57 0.333 1.70 Max 51.2 549 51.2 374 51.2 236 n (Samp) 274 53 274 48 274 33 n (Patient) 274 53 274 48 274 33 sCr only Median 5.22 21.0 5.22 19.0 5.22 12.1 Average 7.32 62.4 7.32 52.7 7.32 33.4 Stdev 7.61 108 7.61 85.2 7.61 57.5 p (t-test) 5.4E27 1.2E27 5.4E18 Min 0.333 2.57 0.333 2.57 0.333 2.57 Max 69.5 549 69.5 374 69.5 236 n (Samp) 517 34 517 31 517 25 n (Patient) 517 34 517 31 517 25 UO only Median 4.63 24.7 4.63 20.8 4.63 12.7 Average 6.11 36.4 6.11 24.3 6.11 15.7 Stdev 5.99 28.6 5.99 17.3 5.99 13.6 p (t-test) 7.3E44 5.3E30 1.0E8 Min 0.333 2.74 0.333 2.74 0.333 1.70 Max 51.2 94.4 51.2 69.5 51.2 55.1 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.88 0.86 0.89 0.87 0.85 0.87 0.79 0.79 0.78 SE 0.031 0.041 0.038 0.034 0.044 0.043 0.048 0.055 0.068 p 0 0 0 0 1.8E15 0 2.8E9 2.2E7 4.8E5 nCohort 1 274 517 330 274 517 330 274 517 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 9.84 12.1 14.3 9.77 9.80 12.6 6.38 7.11 7.47 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 92% 90% 94% 92% 85% 94% 73% 68% 80% Cutoff 2 7.73 8.45 7.87 7.68 8.45 7.87 4.91 6.38 5.21 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 82% 76% 82% 82% 76% 82% 58% 61% 59% Cutoff 3 5.14 5.14 6.02 3.79 5.74 3.63 3.63 4.61 2.70 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 62% 49% 66% 41% 55% 35% 38% 42% 19% Cutoff 4 6.07 7.47 6.38 6.07 7.47 6.38 6.07 7.47 6.38 Sens 4 85% 85% 87% 83% 84% 86% 76% 68% 76% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 7.26 9.01 7.47 7.26 9.01 7.47 7.26 9.01 7.47 Sens 5 83% 79% 87% 81% 74% 86% 64% 64% 71% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 9.13 12.9 10.2 9.13 12.9 10.2 9.13 12.9 10.2 Sens 6 75% 68% 74% 73% 65% 76% 58% 48% 53% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.5 3.0 1.0 0.65 2.0 0.49 0.99 3.0 0.49 p Value 0.66 0.34 1.0 0.64 0.57 0.56 0.99 0.34 0.56 95% CI of 0.24 0.31 0.062 0.11 0.18 0.044 0.19 0.31 0.043 OR Quart 2 9.2 29 16 4.0 22 5.5 5.0 29 5.5 OR Quart 3 4.3 3.0 2.0 2.1 4.1 0.49 2.1 5.2 0.49 p Value 0.072 0.34 0.57 0.31 0.21 0.56 0.32 0.14 0.56 95% CI of 0.88 0.31 0.18 0.50 0.45 0.044 0.50 0.59 0.043 OR Quart 3 21 29 23 8.6 37 5.5 8.5 45 5.5 OR Quart 4 38 33 38 22 29 17 9.1 18 7.4 p Value 1.3E6 6.5E4 4.4E4 1.1E6 0.0011 1.8E4 5.8E4 0.0055 0.010 95% CI of 8.7 4.4 5.0 6.3 3.8 3.8 2.6 2.3 1.6 OR Quart 4 160 250 280 74 220 73 32 140 34 Insulin-like growth factor-binding protein 7 X Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 161 1380 161 1290 161 529 Average 198000 9150000 198000 5210000 198000 1300000 Stdev 1090000 3.05E7 1090000 2.45E7 1090000 5730000 p (t-test) 1.9E6 8.1E4 0.0051 Min 7.05 11.1 7.05 11.1 7.05 11.1 Max 1.01E7 1.63E8 1.01E7 1.63E8 1.01E7 3.10E7 n (Samp) 272 53 272 48 272 33 n (Patient) 272 53 272 48 272 33 sCr only Median 247 1030 247 921 247 529 Average 382000 8170000 382000 4450000 382000 5520000 Stdev 1700000 2.59E7 1700000 1.78E7 1700000 1.98E7 p (t-test) 5.8E11 1.3E6 3.8E8 Min 7.05 62.4 7.05 62.4 7.05 62.4 Max 1.52E7 1.18E8 1.52E7 9.50E7 1.52E7 9.50E7 n (Samp) 514 34 514 31 514 25 n (Patient) 514 34 514 31 514 25 UO only Median 170 4190 170 3360 170 800 Average 252000 1.64E7 252000 1.02E7 252000 2530000 Stdev 1290000 3.92E7 1290000 3.19E7 1290000 7900000 p (t-test) 4.2E13 3.0E8 2.0E5 Min 7.05 11.1 7.05 11.1 7.05 11.1 Max 1.05E7 1.63E8 1.05E7 1.63E8 1.05E7 3.10E7 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.85 0.76 0.89 0.84 0.76 0.87 0.76 0.68 0.79 SE 0.034 0.049 0.039 0.037 0.051 0.044 0.050 0.060 0.066 p 0 1.9E7 0 0 6.4E7 0 3.0E7 0.0031 1.3E5 nCohort 1 272 514 330 272 514 330 272 514 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 581 522 1650 484 484 1380 290 319 427 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 90% 74% 94% 87% 72% 93% 75% 58% 83% Cutoff 2 408 347 1450 346 364 427 242 290 243 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 83% 61% 94% 80% 62% 83% 68% 56% 66% Cutoff 3 113 113 427 102 319 242 102 102 72.3 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 37% 23% 83% 32% 58% 66% 32% 19% 19% Cutoff 4 253 447 265 253 447 265 253 447 265 Sens 4 85% 74% 90% 85% 71% 86% 76% 56% 76% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 351 805 380 351 805 380 351 805 380 Sens 5 81% 56% 90% 79% 52% 83% 61% 40% 71% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 646 1840 744 646 1840 744 646 1840 744 Sens 6 68% 29% 87% 58% 29% 79% 39% 16% 53% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.0 0.24 0 0.66 0 0 1.0 0 0 p Value 1.0 0.21 na 0.65 na na 1.0 na na 95% CI of 0.20 0.027 na 0.11 na na 0.20 na na OR Quart 2 5.1 2.2 na 4.0 na na 5.1 na na OR Quart 3 2.1 2.3 0.49 2.9 4.3 1.5 2.1 2.6 1.5 p Value 0.31 0.17 0.57 0.13 0.027 0.66 0.31 0.11 0.66 95% CI of 0.50 0.70 0.044 0.73 1.2 0.24 0.50 0.79 0.24 OR Quart 3 8.6 7.8 5.6 11 16 9.2 8.7 8.5 9.2 OR Quart 4 26 5.7 20 20 5.9 16 9.1 2.9 6.7 p Value 2.2E7 0.0020 7.4E5 2.0E6 0.0058 2.5E4 5.8E4 0.076 0.015 95% CI of 7.6 1.9 4.5 5.8 1.7 3.6 2.6 0.89 1.5 OR Quart 4 89 17 85 69 21 69 32 9.3 31 Metalloproteinase inhibitor 2 X Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 7.23 65.3 7.23 59.2 7.23 23.8 Average 10700 798000 10700 300000 10700 205000 Stdev 59400 2270000 59400 1100000 59400 977000 p (t-test) 2.1E8 2.0E5 0.0012 Min 0.348 0.563 0.348 0.563 0.348 0.563 Max 548000 9440000 548000 5510000 548000 5510000 n (Samp) 272 53 272 48 272 33 n (Patient) 272 53 272 48 272 33 sCr only Median 11.5 54.2 11.5 46.7 11.5 23.8 Average 19700 923000 19700 504000 19700 625000 Stdev 89100 2530000 89100 1850000 89100 2050000 p (t-test) 2.6E15 5.8E9 5.3E11 Min 0.348 2.40 0.348 2.40 0.348 2.40 Max 748000 9440000 748000 8840000 748000 8840000 n (Samp) 514 34 514 31 514 25 n (Patient) 514 34 514 31 514 25 UO only Median 7.38 332 7.38 196 7.38 53.5 Average 12800 1210000 12800 554000 12800 399000 Stdev 65500 2700000 65500 1400000 65500 1350000 p (t-test) 5.5E15 1.2E11 3.3E7 Min 0.348 0.563 0.348 0.563 0.348 0.563 Max 548000 9440000 548000 5510000 548000 5510000 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.84 0.75 0.89 0.82 0.74 0.87 0.74 0.66 0.79 SE 0.035 0.049 0.039 0.038 0.052 0.044 0.051 0.061 0.066 p 0 4.1E7 0 0 6.0E6 0 3.0E6 0.0093 1.1E5 nCohort 1 272 514 330 272 514 330 272 514 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 38.6 24.3 67.5 16.7 16.7 47.4 9.84 11.3 17.2 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 93% 74% 94% 82% 64% 94% 65% 49% 80% Cutoff 2 16.2 13.5 47.4 10.7 13.5 16.0 5.68 8.20 9.84 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 82% 55% 94% 68% 55% 79% 39% 39% 63% Cutoff 3 5.68 5.74 13.4 5.68 6.10 8.39 4.28 4.39 4.27 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 39% 24% 73% 39% 26% 56% 31% 19% 29% Cutoff 4 11.8 20.6 12.3 11.8 20.6 12.3 11.8 20.6 12.3 Sens 4 83% 71% 90% 79% 65% 86% 64% 52% 76% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 15.6 34.7 17.2 15.6 34.7 17.2 15.6 34.7 17.2 Sens 5 81% 68% 87% 75% 61% 79% 61% 48% 71% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 28.4 81.8 34.1 28.4 81.8 34.1 28.4 81.8 34.1 Sens 6 74% 38% 87% 67% 39% 79% 48% 24% 59% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 2.6 0.49 1.0 2.1 1.0 0.99 2.6 0.59 0.99 p Value 0.26 0.42 1.0 0.41 1.0 0.99 0.26 0.47 0.99 95% CI of 0.49 0.089 0.062 0.37 0.20 0.061 0.49 0.14 0.061 OR Quart 2 14 2.7 16 12 5.0 16 14 2.5 16 OR Quart 3 3.2 1.3 2.0 4.9 1.7 4.1 2.6 0.99 3.0 p Value 0.17 0.74 0.57 0.045 0.48 0.21 0.26 0.99 0.34 95% CI of 0.62 0.33 0.18 1.0 0.40 0.45 0.49 0.28 0.31 OR Quart 3 16 4.8 23 24 7.2 37 14 3.5 30 OR Quart 4 38 6.7 38 27 7.6 30 14 2.5 14 p Value 1.3E6 6.3E4 4.4E4 1.1E5 0.0014 9.8E4 5.5E4 0.091 0.013 95% CI of 8.7 2.3 5.0 6.3 2.2 4.0 3.1 0.86 1.7 OR Quart 4 160 20 280 120 26 230 62 7.4 110 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.729 2.71 0.729 1.90 0.729 1.69 Average 1.13 9.16 1.13 7.13 1.13 3.92 Stdev 1.34 18.6 1.34 13.2 1.34 6.57 p (t-test) 7.7E12 1.2E12 3.0E9 Min 0.0643 0.142 0.0643 0.142 0.0643 0.0285 Max 13.2 103 13.2 70.5 13.2 31.2 n (Samp) 275 53 275 48 275 33 n (Patient) 275 53 275 48 275 33 sCr only Median 0.939 2.12 0.939 1.93 0.939 1.79 Average 1.45 10.2 1.45 7.97 1.45 4.51 Stdev 1.68 21.9 1.68 14.4 1.68 7.32 p (t-test) 1.4E17 1.1E19 7.2E11 Min 0.0643 0.142 0.0643 0.142 0.0643 0.142 Max 16.4 103 16.4 70.5 16.4 31.2 n (Samp) 518 34 518 31 518 25 n (Patient) 518 34 518 31 518 25 UO only Median 0.756 4.83 0.756 1.92 0.756 1.92 Average 1.17 6.83 1.17 5.46 1.17 3.09 Stdev 1.37 8.91 1.37 8.82 1.37 3.04 p (t-test) 1.7E22 3.1E14 3.6E7 Min 0.0643 0.355 0.0643 0.355 0.0643 0.0285 Max 13.2 47.0 13.2 47.0 13.2 9.63 n(Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.82 0.76 0.83 0.80 0.75 0.79 0.72 0.69 0.72 SE 0.037 0.049 0.046 0.040 0.052 0.051 0.052 0.060 0.071 p 0 1.5E7 1.4E12 1.6E13 1.8E6 1.8E8 4.0E5 0.0014 0.0019 nCohort 1 275 518 331 275 518 331 275 518 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 1.66 1.55 1.87 1.40 1.53 1.28 1.01 1.12 1.04 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 81% 69% 85% 74% 69% 71% 63% 57% 62% Cutoff 2 1.04 1.03 1.40 1.04 1.31 1.04 0.721 1.02 0.875 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 64% 54% 74% 64% 62% 62% 50% 54% 56% Cutoff 3 0.710 0.710 0.504 0.681 0.710 0.448 0.358 0.362 0.448 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 49% 38% 31% 47% 38% 25% 19% 14% 25% Cutoff 4 1.28 1.59 1.28 1.28 1.59 1.28 1.28 1.59 1.28 Sens 4 77% 68% 81% 75% 65% 72% 61% 56% 59% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 1.61 2.11 1.66 1.61 2.11 1.66 1.61 2.11 1.66 Sens 5 72% 50% 74% 62% 45% 62% 52% 40% 53% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 2.19 2.99 2.36 2.19 2.99 2.36 2.19 2.99 2.36 Sens 6 55% 44% 58% 44% 39% 45% 36% 32% 41% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.0 1.0 0.32 1.3 1.5 0.33 0.74 0.66 0.49 p Value 1.0 1.0 0.33 0.71 0.65 0.34 0.70 0.65 0.57 95% CI of 0.24 0.20 0.033 0.29 0.25 0.033 0.16 0.11 0.044 OR Quart 2 4.1 5.0 3.2 6.2 9.2 3.2 3.4 4.0 5.6 OR Quart 3 2.7 2.4 1.3 4.5 5.3 2.4 2.4 2.8 2.6 p Value 0.10 0.21 0.70 0.025 0.033 0.21 0.16 0.14 0.26 95% CI of 0.81 0.61 0.29 1.2 1.1 0.61 0.71 0.71 0.49 OR Quart 3 9.0 9.5 6.2 16 25 9.8 8.2 11 14 OR Quart 4 15 8.1 9.8 14 8.9 7.2 5.2 4.3 4.9 p Value 1.7E6 9.1E4 3.2E4 2.6E5 0.0041 0.0021 0.0048 0.028 0.046 95% CI of 4.9 2.3 2.8 4.1 2.0 2.1 1.7 1.2 1.0 OR Quart 4 43 28 34 49 39 26 16 15 23 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.566 5.62 0.566 3.65 0.566 2.08 Average 0.921 15.8 0.921 11.1 0.921 4.97 Stdev 1.34 34.1 1.34 21.3 1.34 8.84 p (t-test) 2.9E12 5.6E14 1.4E11 Min 0.0244 0.363 0.0244 0.355 0.0244 0.0404 Max 14.6 197 14.6 128 14.6 43.1 n (Samp) 274 53 274 48 274 33 n (Patient) 274 53 274 48 274 33 sCr only Median 0.743 3.69 0.743 3.51 0.743 2.33 Average 1.37 18.8 1.37 13.3 1.37 6.50 Stdev 2.30 41.8 2.30 25.6 2.30 10.7 p (t-test) 1.5E19 4.8E22 1.7E14 Min 0.0244 0.363 0.0244 0.429 0.0244 0.374 Max 31.2 197 31.2 128 31.2 43.1 n (Samp) 517 34 517 31 517 25 n (Patient) 517 34 517 31 517 25 UO only Median 0.588 5.68 0.588 4.59 0.588 2.09 Average 1.02 12.2 1.02 7.59 1.02 3.41 Stdev 1.52 13.3 1.52 8.54 1.52 3.08 p (t-test) 6.6E38 1.4E28 7.2E9 Min 0.0244 0.438 0.0244 0.355 0.0244 0.0404 Max 14.6 53.4 14.6 31.2 14.6 10.6 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.88 0.85 0.89 0.87 0.85 0.87 0.80 0.78 0.79 SE 0.031 0.042 0.039 0.034 0.044 0.043 0.048 0.056 0.066 p 0 2.2E16 0 0 2.2E15 0 6.4E10 6.5E7 1.0E5 nCohort 1 274 517 330 274 517 330 274 517 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 1.94 2.20 2.20 1.87 2.06 1.68 0.923 1.44 1.14 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 91% 86% 90% 90% 85% 87% 74% 74% 78% Cutoff 2 1.43 1.48 1.43 1.21 1.48 0.926 0.648 0.923 0.703 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 84% 75% 82% 82% 75% 71% 57% 61% 58% Cutoff 3 0.516 0.521 0.700 0.516 0.926 0.621 0.435 0.474 0.435 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 48% 38% 58% 48% 61% 53% 42% 35% 39% Cutoff 4 0.843 1.21 0.923 0.843 1.21 0.923 0.843 1.21 0.923 Sens 4 85% 85% 87% 83% 87% 83% 73% 76% 76% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 1.14 1.65 1.27 1.14 1.65 1.27 1.14 1.65 1.27 Sens 5 81% 76% 81% 81% 77% 79% 70% 60% 65% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 1.87 3.04 2.20 1.87 3.04 2.20 1.87 3.04 2.20 Sens 6 75% 56% 71% 71% 52% 66% 55% 40% 47% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 >7.6 3.0 >3.1 >6.4 >3.1 >3.1 5.2 >5.2 0.99 p Value <0.061 0.34 <0.33 <0.089 <0.33 <0.34 0.14 <0.14 0.99 95% CI of >0.91 0.31 >0.32 >0.75 >0.32 >0.31 0.59 >0.59 0.061 OR Quart 2 na 29 na na na na 46 na 16 OR Quart 3 >5.3 4.1 >3.1 >4.2 >4.1 >3.1 4.1 >3.1 3.0 p Value <0.13 0.21 <0.33 <0.20 <0.21 <0.34 0.21 <0.33 0.34 95% CI of >0.60 0.45 >0.32 >0.46 >0.45 >0.31 0.45 >0.32 0.31 OR Quart 3 na 37 na na na na 38 na 30 OR Quart 4 >81 32 >34 >71 >29 >31 32 >19 14 p Value <2.0E5 7.8E4 <6.3E4 <3.6E5 <0.0010 <9.5E4 8.4E4 <0.0043 0.013 95% CI of >11 4.2 >4.5 >9.4 >3.9 >4.0 4.2 >2.5 1.7 OR Quart 4 na 240 na na na na 240 na 110 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2/ (Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 1.13 9.98 1.13 6.38 1.13 3.64 Average 1160 328000 1160 100000 1160 25100 Stdev 7110 1480000 7110 489000 7110 110000 p (t-test) 2.9E4 8.3E4 4.3E4 Min 0.0169 0.00941 0.0169 0.00941 0.0169 0.00941 Max 73000 1.03E7 73000 3290000 73000 600000 n (Samp) 273 53 273 48 273 33 n (Patient) 273 53 273 48 273 33 sCr only Median 1.75 4.92 1.75 4.97 1.75 3.64 Average 2840 367000 2840 51600 2840 64000 Stdev 17400 1760000 17400 176000 17400 194000 p (t-test) 2.5E6 5.8E9 4.6E11 Min 0.0169 0.172 0.0169 0.172 0.0169 0.172 Max 247000 1.03E7 247000 772000 247000 772000 n (Samp) 515 34 515 31 515 25 n (Patient) 515 34 515 31 515 25 UO only Median 1.13 60.1 1.13 26.8 1.13 5.70 Average 1200 231000 1200 167000 1200 48700 Stdev 6910 661000 6910 624000 6910 152000 p (t-test) 4.9E10 1.4E6 2.4E8 Min 0.0169 0.00941 0.0169 0.00941 0.0169 0.00941 Max 73000 3290000 73000 3290000 73000 600000 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.81 0.70 0.88 0.80 0.70 0.86 0.71 0.62 0.78 SE 0.037 0.052 0.041 0.040 0.054 0.045 0.053 0.061 0.068 p 0 1.5E4 0 6.5E14 2.9E4 1.3E15 5.7E5 0.044 4.3E5 nCohort 1 273 515 331 273 515 331 273 515 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 3.62 3.55 16.1 3.55 3.55 5.84 1.82 1.84 2.96 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 82% 67% 95% 82% 67% 89% 68% 52% 77% Cutoff 2 1.94 1.48 5.84 2.47 1.48 3.45 0.829 0.998 1.82 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 69% 44% 89% 75% 44% 79% 40% 31% 66% Cutoff 3 0.778 0.704 2.63 0.778 0.778 0.829 0.242 0.242 0.778 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 37% 23% 75% 37% 25% 40% 12% 7% 37% Cutoff 4 2.10 4.14 2.15 2.10 4.14 2.15 2.10 4.14 2.15 Sens 4 79% 59% 90% 81% 61% 90% 70% 48% 76% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 3.24 7.73 3.49 3.24 7.73 3.49 3.24 7.73 3.49 Sens 5 75% 41% 84% 73% 42% 79% 55% 32% 65% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 5.84 18.6 7.04 5.84 18.6 7.04 5.84 18.6 7.04 Sens 6 57% 29% 77% 52% 32% 66% 30% 20% 47% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.7 0.39 2.0 1.7 0.74 2.0 0.99 0.74 2.0 p Value 0.48 0.27 0.57 0.47 0.70 0.57 0.98 0.70 0.57 95% CI of 0.39 0.075 0.18 0.39 0.16 0.18 0.24 0.16 0.18 OR Quart 2 7.3 2.1 22 7.4 3.4 23 4.1 3.4 23 OR Quart 3 3.2 2.3 2.0 2.9 2.3 3.1 1.3 2.3 2.0 p Value 0.086 0.13 0.57 0.13 0.17 0.34 0.73 0.17 0.57 95% CI of 0.85 0.78 0.18 0.73 0.70 0.31 0.33 0.70 0.18 OR Quart 3 12 6.8 23 11 7.8 30 4.9 7.8 23 OR Quart 4 20 3.5 36 17 4.1 31 6.3 2.3 14 p Value 1.7E6 0.019 5.4E4 7.9E6 0.015 9.5E4 0.0014 0.17 0.013 95% CI of 5.9 1.2 4.7 4.9 1.3 4.0 2.0 0.70 1.7 OR Quart 4 70 9.7 270 58 13 230 20 7.8 110 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.799 17.8 0.799 13.4 0.799 4.97 Average 792 278000 792 111000 792 26500 Stdev 5040 833000 5040 458000 5040 106000 p (t-test) 6.7E8 8.0E5 8.4E5 Min 0.0182 0.0134 0.0182 0.0134 0.0182 0.0134 Max 58400 3800000 58400 2500000 58400 486000 n (Samp) 272 53 272 48 272 33 n (Patient) 272 53 272 48 272 33 sCr only Median 1.42 9.33 1.42 9.35 1.42 4.97 Average 1940 290000 1940 110000 1940 137000 Stdev 10700 877000 10700 465000 10700 517000 p (t-test) 2.1E13 1.4E7 3.6E9 Min 0.0182 0.242 0.0182 0.242 0.0182 0.242 Max 151000 3800000 151000 2550000 151000 2550000 n (Samp) 514 34 514 31 514 25 n (Patient) 514 34 514 31 514 25 UO only Median 0.867 84.7 0.867 42.1 0.867 9.72 Average 911 359000 911 189000 911 51300 Stdev 5220 853000 5220 580000 5220 146000 p (t-test) 1.2E13 5.2E9 6.1E10 Min 0.0182 0.0134 0.0182 0.0134 0.0182 0.0134 Max 58400 2640000 58400 2500000 58400 486000 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.85 0.76 0.89 0.84 0.76 0.87 0.76 0.68 0.80 SE 0.034 0.049 0.039 0.037 0.051 0.043 0.050 0.060 0.065 p 0 8.2E8 0 0 4.8E7 0 3.0E7 0.0024 3.0E6 nCohort 1 272 514 330 272 514 330 272 514 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 5.86 4.82 19.4 3.41 3.42 12.7 1.63 2.40 2.57 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 92% 77% 95% 86% 71% 94% 72% 65% 80% Cutoff 2 3.10 2.30 9.39 1.82 2.30 1.82 0.619 1.40 1.61 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 85% 65% 92% 74% 65% 72% 42% 50% 68% Cutoff 3 0.576 0.488 1.61 0.576 0.631 1.33 0.388 0.388 0.576 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 41% 23% 68% 41% 28% 64% 28% 18% 40% Cutoff 4 1.60 3.38 1.73 1.60 3.38 1.73 1.60 3.38 1.73 Sens 4 85% 74% 87% 85% 71% 83% 73% 52% 71% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 2.19 6.60 2.55 2.19 6.60 2.55 2.19 6.60 2.55 Sens 5 83% 59% 87% 79% 55% 79% 70% 40% 71% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 5.09 19.3 5.86 5.09 19.3 5.86 5.09 19.3 5.86 Sens 6 74% 38% 87% 65% 39% 79% 48% 28% 59% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.4 0.24 1.0 1.0 0.33 0.99 1.4 0.49 0.99 p Value 0.70 0.21 1.0 1.0 0.34 0.99 0.70 0.41 0.99 95% CI of 0.29 0.027 0.062 0.20 0.034 0.061 0.29 0.088 0.061 OR Quart 2 6.2 2.2 16 5.1 3.2 16 6.3 2.7 16 OR Quart 3 1.4 1.5 2.0 2.1 2.8 4.1 1.0 1.5 3.0 p Value 0.70 0.52 0.57 0.31 0.14 0.21 1.0 0.53 0.34 95% CI of 0.29 0.42 0.18 0.50 0.72 0.45 0.20 0.42 0.31 OR Quart 3 6.2 5.5 23 8.6 11 37 5.1 5.5 30 OR Quart 4 27 6.7 38 21 7.1 30 10 3.5 14 p Value 1.4E7 6.3E4 4.4E4 1.3E6 0.0019 9.8E4 2.6E4 0.034 0.013 95% CI of 8.0 2.3 5.0 6.1 2.1 4.0 3.0 1.1 1.7 OR Quart 4 94 20 280 72 25 230 36 11 110 Serum Creatinine 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 0.900 2.07 0.900 1.73 0.900 1.42 Average 0.970 2.32 0.970 1.91 0.970 1.58 Stdev 0.492 1.29 0.492 1.06 0.492 0.885 p (t-test) 5.2E32 4.7E20 3.5E9 Min 0.100 0.500 0.100 0.500 0.100 0.500 Max 3.42 5.30 3.42 5.30 3.42 4.14 n (Samp) 275 53 275 48 275 33 n (Patient) 275 53 275 48 275 33 sCr only Median 0.900 2.20 0.900 1.74 0.900 1.45 Average 1.04 2.57 1.04 2.05 1.04 1.68 Stdev 0.539 1.32 0.539 1.02 0.539 0.939 p (t-test) 1.3E38 7.6E20 4.8E8 Min 0.100 0.500 0.100 0.500 0.100 0.500 Max 5.50 4.80 5.50 4.21 5.50 4.14 n (Samp) 518 34 518 31 518 25 n (Patient) 518 34 518 31 518 25 UO only Median 0.900 2.10 0.900 1.79 0.900 1.45 Average 1.01 2.55 1.01 2.05 1.01 1.56 Stdev 0.526 1.54 0.526 1.22 0.526 0.792 p (t-test) 1.3E28 5.6E17 6.1E5 Min 0.100 0.590 0.100 0.530 0.100 0.540 Max 3.42 6.32 3.42 5.30 3.42 3.05 n (Samp) 331 31 331 29 331 17 n (Patient) 331 31 331 29 331 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.85 0.87 0.85 0.80 0.83 0.80 0.74 0.76 0.71 SE 0.034 0.040 0.044 0.040 0.046 0.050 0.051 0.057 0.072 p 0 0 2.2E15 1.6E14 1.3E12 3.1E9 2.1E6 6.8E6 0.0033 nCohort 1 275 518 331 275 518 331 275 518 331 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 1.44 1.58 1.45 1.20 1.36 1.44 0.980 1.09 0.980 Sens 1 74% 71% 71% 71% 71% 72% 76% 72% 71% Spec 1 88% 88% 86% 81% 82% 85% 63% 66% 60% Cutoff 2 1.09 1.19 1.15 0.970 1.09 0.970 0.880 0.990 0.800 Sens 2 83% 82% 81% 81% 81% 83% 82% 84% 82% Spec 2 72% 73% 74% 62% 66% 59% 48% 57% 39% Cutoff 3 0.890 0.890 0.900 0.750 0.910 0.590 0.660 0.880 0.590 Sens 3 91% 94% 90% 92% 90% 93% 91% 92% 94% Spec 3 49% 45% 52% 37% 51% 17% 28% 44% 17% Cutoff 4 1.04 1.10 1.10 1.04 1.10 1.10 1.04 1.10 1.10 Sens 4 83% 82% 81% 75% 77% 76% 67% 68% 65% Spec 4 70% 70% 72% 70% 70% 72% 70% 70% 72% Cutoff 5 1.20 1.30 1.33 1.20 1.30 1.33 1.20 1.30 1.33 Sens 5 75% 79% 74% 71% 71% 72% 58% 56% 65% Spec 5 81% 80% 80% 81% 80% 80% 81% 80% 80% Cutoff 6 1.54 1.70 1.58 1.54 1.70 1.58 1.54 1.70 1.58 Sens 6 64% 68% 65% 60% 52% 66% 39% 32% 35% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.7 3.0 0.99 0.99 3.0 0.66 1.7 3.0 1.5 p Value 0.47 0.34 0.99 0.99 0.34 0.65 0.47 0.34 0.65 95% CI of 0.39 0.31 0.14 0.24 0.31 0.11 0.39 0.31 0.25 OR Quart 2 7.4 30 7.2 4.1 30 4.0 7.4 29 9.3 OR Quart 3 2.1 3.0 2.0 2.1 4.1 1.0 1.7 6.2 0.49 p Value 0.31 0.34 0.42 0.25 0.21 1.0 0.47 0.094 0.57 95% CI of 0.50 0.31 0.37 0.60 0.45 0.20 0.39 0.73 0.044 OR Quart 3 8.6 30 11 7.2 37 5.1 7.4 52 5.6 OR Quart 4 24 33 15 12 27 8.8 8.7 17 6.2 p Value 4.4E7 6.3E4 3.5E4 7.2E6 0.0013 6.4E4 8.0E4 0.0069 0.021 95% CI of 7.0 4.5 3.4 4.1 3.6 2.5 2.5 2.2 1.3 OR Quart 4 82 250 65 37 200 31 31 130 29 Serum Creatinine/(Weight Adjusted Urine Output) 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 sCr or UO Median 1.58 9.30 1.58 6.74 1.58 3.22 Average 3160 26300 3160 12700 3160 7610 Stdev 17000 84400 17000 48800 17000 32400 p (t-test) 4.4E5 0.014 0.21 Min 0.104 0.407 0.104 0.407 0.104 0.407 Max 154000 421000 154000 280000 154000 170000 n (Samp) 272 53 272 48 272 33 n (Patient) 272 53 272 48 272 33 sCr only Median 2.36 5.82 2.36 4.57 2.36 3.87 Average 4820 30600 4820 18800 4820 23200 Stdev 21200 93900 21200 66700 21200 73800 p (t-test) 3.2E6 0.0037 5.6E4 Min 0.104 0.407 0.104 0.407 0.104 0.407 Max 180000 421000 180000 330000 180000 330000 n (Samp) 514 34 514 31 514 25 n (Patient) 514 34 514 31 514 25 UO only Median 1.60 21.6 1.60 14.4 1.60 4.65 Average 4090 57700 4090 35800 4090 14800 Stdev 21400 128000 21400 97900 21400 44500 p (t-test) 5.4E11 2.6E6 0.063 Min 0.104 0.469 0.104 0.469 0.104 0.469 Max 230000 431000 230000 431000 230000 170000 n (Samp) 330 31 330 29 330 17 n (Patient) 330 31 330 29 330 17 0 hr prior to AKI stage 24 hr prior to AKI stage 48 hr prior to AKI stage sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.81 0.71 0.88 0.79 0.70 0.85 0.70 0.62 0.74 SE 0.037 0.051 0.041 0.040 0.054 0.045 0.053 0.061 0.070 p 0 3.2E5 0 4.8E13 2.8E4 7.8E15 2.1E4 0.046 7.5E4 nCohort 1 272 514 330 272 514 330 272 514 330 nCohort 2 53 34 31 48 31 29 33 25 17 Cutoff 1 3.57 2.72 9.58 3.03 2.64 6.58 1.87 1.90 2.11 Sens 1 72% 71% 71% 71% 71% 72% 73% 72% 71% Spec 1 85% 58% 95% 79% 57% 92% 58% 41% 62% Cutoff 2 2.28 2.11 6.58 1.99 2.09 3.57 1.47 1.82 1.99 Sens 2 81% 82% 81% 81% 81% 83% 82% 80% 82% Spec 2 67% 46% 92% 61% 45% 83% 46% 39% 60% Cutoff 3 1.23 1.23 3.57 1.21 1.73 1.52 0.944 1.21 0.551 Sens 3 91% 91% 90% 92% 90% 93% 91% 92% 94% Spec 3 40% 25% 83% 39% 37% 47% 26% 24% 6% Cutoff 4 2.40 3.74 2.46 2.40 3.74 2.46 2.40 3.74 2.46 Sens 4 79% 62% 90% 73% 58% 86% 55% 52% 65% Spec 4 70% 70% 70% 70% 70% 70% 70% 70% 70% Cutoff 5 3.15 5.26 3.33 3.15 5.26 3.33 3.15 5.26 3.33 Sens 5 74% 50% 90% 69% 48% 83% 52% 28% 59% Spec 5 80% 80% 80% 80% 80% 80% 80% 80% 80% Cutoff 6 4.79 9.19 5.26 4.79 9.19 5.26 4.79 9.19 5.26 Sens 6 64% 41% 87% 56% 35% 79% 33% 24% 47% Spec 6 90% 90% 90% 90% 90% 90% 90% 90% 90% OR Quart 2 1.0 1.0 0.49 0.74 2.0 0.49 1.0 2.4 0.49 p Value 1.0 1.0 0.57 0.70 0.32 0.56 1.0 0.21 0.56 95% CI of 0.24 0.24 0.044 0.16 0.50 0.044 0.24 0.60 0.043 OR Quart 2 4.1 4.1 5.6 3.4 8.4 5.5 4.2 9.4 5.5 OR Quart 3 1.8 1.8 0 2.4 2.0 0.99 2.1 1.7 1.5 p Value 0.35 0.36 na 0.16 0.32 0.99 0.24 0.48 0.66 95% CI of 0.51 0.51 na 0.71 0.50 0.14 0.61 0.39 0.24 OR Quart 3 6.5 6.3 na 8.2 8.4 7.2 7.4 7.2 9.2 OR Quart 4 17 5.4 20 13 5.9 16 5.1 3.5 6.1 p Value 4.9E7 0.0030 7.4E5 6.1E6 0.0058 2.5E4 0.0052 0.062 0.021 95% CI of 5.6 1.8 4.5 4.2 1.7 3.6 1.6 0.94 1.3 OR Quart 4 50 16 85 38 21 69 16 13 28

(92) TABLE-US-00009 TABLE 4 Comparison of marker levels in samples collected within 12 hours of reaching stage R from Cohort 1 (patients that reached, but did not progress beyond, RIFLE stage R) and from Cohort 2 (patients that reached RIFLE stage I or F). Insulin-like growth factor-binding protein 7 and Metalloproteinase inhibitor 2 were measured in urine. Insulin-like growth factor-binding protein 7 sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 109 129 112 142 114 139 Average 118 165 131 180 129 167 Stdev 76.3 105 86.9 127 85.6 99.9 p (t-test) 6.4E7 0.0056 1.7E4 Min 20.0 20.0 20.0 20.0 20.0 20.0 Max 453 545 340 545 469 600 n (Samp) 191 207 79 72 177 174 n (Patient) 191 207 79 72 177 174 At Enrollment sCr or UO sCr only UO only AUC 0.63 0.61 0.61 SE 0.028 0.046 0.030 p 4.1E6 0.021 2.0E4 nCohort 1 191 79 177 nCohort 2 207 72 174 Cutoff 1 95.8 97.7 98.3 Sens 1 70% 71% 70% Spec 1 47% 44% 40% Cutoff 2 76.9 74.9 79.8 Sens 2 80% 81% 80% Spec 2 35% 32% 32% Cutoff 3 54.4 46.8 61.9 Sens 3 90% 90% 90% Spec 3 22% 16% 20% Cutoff 4 143 154 147 Sens 4 45% 44% 46% Spec 4 70% 71% 70% Cutoff 5 163 196 168 Sens 5 40% 39% 40% Spec 5 80% 81% 80% Cutoff 6 212 281 262 Sens 6 30% 19% 20% Spec 6 90% 91% 90% OR Quart 2 2.0 1.6 1.6 p Value 0.019 0.29 0.11 95% CI of 1.1 0.65 0.90 OR Quart 2 3.5 4.1 3.0 OR Quart 3 1.1 1.1 1.3 p Value 0.66 0.88 0.39 95% CI of 0.64 0.42 0.71 OR Quart 3 2.0 2.7 2.4 OR Quart 4 4.3 2.8 3.9 p Value 1.6E6 0.030 2.3E5 95% CI of 2.4 1.1 2.1 OR Quart 4 7.9 7.2 7.3 Metalloproteinase inhibitor 2 sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 4.66 6.15 4.65 6.53 5.19 6.34 Average 5.37 8.66 5.72 11.3 5.87 8.60 Stdev 3.85 13.9 5.02 23.1 3.72 11.4 p (t-test) 0.0017 0.038 0.0027 Min 1.20 1.20 1.20 1.20 1.20 1.20 Max 38.6 182 38.6 182 28.4 140 n (Samp) 191 207 79 72 177 174 n (Patient) 191 207 79 72 177 174 At Enrollment sCr or UO sCr only UO only AUC 0.63 0.62 0.60 SE 0.028 0.046 0.030 p 4.9E6 0.0099 6.0E4 nCohort 1 191 79 177 nCohort 2 207 72 174 Cutoff 1 4.05 3.93 4.19 Sens 1 70% 71% 70% Spec 1 39% 41% 37% Cutoff 2 3.58 2.91 3.72 Sens 2 80% 81% 80% Spec 2 34% 22% 31% Cutoff 3 2.56 1.76 2.94 Sens 3 90% 90% 90% Spec 3 19% 11% 21% Cutoff 4 6.59 6.72 7.10 Sens 4 45% 50% 41% Spec 4 70% 71% 70% Cutoff 5 7.27 7.59 7.87 Sens 5 42% 42% 39% Spec 5 80% 81% 80% Cutoff 6 8.80 9.14 10.2 Sens 6 31% 26% 23% Spec 6 90% 91% 90% OR Quart 2 1.4 0.77 1.4 p Value 0.22 0.57 0.32 95% CI of 0.81 0.30 0.75 OR Quart 2 2.5 1.9 2.5 OR Quart 3 1.3 0.95 1.2 p Value 0.39 0.92 0.48 95% CI of 0.73 0.38 0.68 OR Quart 3 2.3 2.4 2.3 OR Quart 4 4.6 2.8 3.3 p Value 7.6E7 0.030 1.4E4 95% CI of 2.5 1.1 1.8 OR Quart 4 8.5 7.3 6.2 Weight Adjusted Urine Output sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 0.487 0.375 0.567 0.523 0.418 0.309 Average 0.924 0.516 1.03 0.803 0.745 0.406 Stdev 1.42 0.701 1.34 0.980 1.22 0.580 p (t-test) 3.1E4 0.26 0.0011 Min 1.00E5 1.00E5 0.119 1.00E5 1.00E5 1.00E5 Max 10.6 6.00 8.93 6.00 10.6 4.67 n (Samp) 183 205 71 68 176 171 n (Patient) 183 205 71 68 176 171 At Enrollment sCr or UO sCr only UO only AUC 0.36 0.45 0.33 SE 0.028 0.049 0.029 p 1.7E7 0.35 1.7E9 nCohort 1 183 71 176 nCohort 2 205 68 171 Cutoff 1 0.244 0.414 0.204 Sens 1 70% 71% 70% Spec 1 13% 30% 11% Cutoff 2 0.197 0.306 0.141 Sens 2 80% 81% 80% Spec 2 9% 18% 7% Cutoff 3 0.112 0.147 0.0753 Sens 3 90% 91% 91% Spec 3 4% 6% 4% Cutoff 4 0.787 0.912 0.612 Sens 4 13% 25% 10% Spec 4 70% 70% 70% Cutoff 5 1.08 1.12 0.833 Sens 5 10% 22% 6% Spec 5 80% 80% 80% Cutoff 6 1.72 2.55 1.28 Sens 6 2% 3% 4% Spec 6 90% 90% 90% OR Quart 2 2.0 0.79 2.9 p Value 0.021 0.63 0.0012 95% CI of 1.1 0.31 1.5 OR Quart 2 3.5 2.0 5.5 OR Quart 3 2.1 1.3 3.3 p Value 0.0099 0.63 2.5E4 95% CI of 1.2 0.49 1.7 OR Quart 3 3.8 3.2 6.3 OR Quart 4 3.8 1.1 6.8 p Value 1.2E5 0.91 1.7E8 95% CI of 2.1 0.41 3.5 OR Quart 4 6.8 2.7 13 Insulin-like growth factor-binding protein 7/(Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 203 425 175 328 274 522 Average 309000 481000 281 398000 476000 528000 Stdev 2320000 2930000 319 3250000 3100000 2670000 p (t-test) 0.53 0.31 0.87 Min 1.89 4.09 2.58 4.09 1.89 4.28 Max 2.49E7 2.66E7 1980 2.66E7 2.66E7 2.50E7 n (Samp) 182 203 70 67 174 170 n (Patient) 182 203 70 67 174 170 At Enrollment sCr or UO sCr only UO only AUC 0.68 0.60 0.68 SE 0.027 0.048 0.029 p 5.3E11 0.041 2.2E10 nCohort 1 182 70 174 nCohort 2 203 67 170 Cutoff 1 225 126 282 Sens 1 70% 70% 70% Spec 1 53% 40% 52% Cutoff 2 148 80.5 209 Sens 2 80% 81% 80% Spec 2 40% 26% 42% Cutoff 3 77.2 44.9 127 Sens 3 90% 91% 90% Spec 3 23% 14% 29% Cutoff 4 334 317 397 Sens 4 56% 52% 58% Spec 4 70% 70% 70% Cutoff 5 452 498 601 Sens 5 46% 28% 47% Spec 5 80% 80% 80% Cutoff 6 782 565 1000 Sens 6 31% 27% 26% Spec 6 90% 90% 90% OR Quart 2 1.9 1.1 2.1 p Value 0.028 0.81 0.018 95% CI of 1.1 0.43 1.1 OR Quart 2 3.5 3.0 4.0 OR Quart 3 2.4 1.6 3.0 p Value 0.0038 0.33 7.6E4 95% CI of 1.3 0.62 1.6 OR Quart 3 4.3 4.2 5.6 OR Quart 4 7.1 1.9 6.3 p Value 1.7E9 0.19 5.1E8 95% CI of 3.8 0.73 3.3 OR Quart 4 14 5.0 12 Metalloproteinase inhibitor 2/(Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 8.67 17.9 7.13 11.6 11.9 22.5 Average 12400 37100 12.0 19300 20400 40400 Stdev 93800 267000 15.1 158000 136000 276000 p (t-test) 0.24 0.31 0.39 Min 0.114 0.248 0.134 0.248 0.114 0.257 Max 992000 3240000 108 1290000 1290000 3240000 n (Samp) 182 203 70 67 174 170 n (Patient) 182 203 70 67 174 170 At Enrollment sCr or UO sCr only UO only AUC 0.67 0.60 0.67 SE 0.027 0.048 0.029 p 3.1E10 0.033 2.1E9 nCohort 1 182 70 174 nCohort 2 203 67 170 Cutoff 1 9.90 5.76 12.5 Sens 1 70% 70% 70% Spec 1 55% 43% 52% Cutoff 2 6.81 3.00 9.00 Sens 2 80% 81% 80% Spec 2 41% 20% 41% Cutoff 3 3.85 1.53 6.04 Sens 3 90% 91% 90% Spec 3 27% 9% 28% Cutoff 4 16.4 14.7 20.8 Sens 4 55% 45% 52% Spec 4 70% 70% 70% Cutoff 5 22.1 17.6 26.7 Sens 5 42% 39% 44% Spec 5 80% 80% 80% Cutoff 6 34.3 24.5 43.3 Sens 6 29% 25% 28% Spec 6 90% 90% 90% OR Quart 2 1.8 0.42 1.7 p Value 0.041 0.086 0.083 95% CI of 1.0 0.15 0.93 OR Quart 2 3.3 1.1 3.3 OR Quart 3 2.7 1.0 2.7 p Value 9.7E4 1.0 0.0022 95% CI of 1.5 0.39 1.4 OR Quart 3 4.8 2.6 5.0 OR Quart 4 5.2 1.9 5.6 p Value 1.5E7 0.19 2.3E7 95% CI of 2.8 0.73 2.9 OR Quart 4 9.6 5.1 11 Insulin-like growth factor-binding protein 7 X Serum Creatinine sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 81.6 148 125 211 83.5 150 Average 112 209 165 291 129 208 Stdev 95.1 205 136 282 134 183 p (t-test) 9.1E9 7.6E4 7.6E6 Min 10.0 9.20 17.2 9.20 10.0 13.5 Max 494 1820 769 1820 1000 1120 n (Samp) 185 204 74 71 174 171 n (Patient) 185 204 74 71 174 171 At Enrollment sCr or UO sCr only UO only AUC 0.68 0.66 0.67 SE 0.027 0.045 0.029 p 4.3E12 3.1E4 3.9E9 nCohort 1 185 74 174 nCohort 2 204 71 171 Cutoff 1 95.1 129 95.5 Sens 1 70% 70% 70% Spec 1 58% 51% 56% Cutoff 2 67.2 96.0 70.5 Sens 2 80% 80% 80% Spec 2 41% 36% 41% Cutoff 3 45.3 59.3 53.5 Sens 3 90% 90% 90% Spec 3 24% 23% 28% Cutoff 4 121 202 131 Sens 4 59% 54% 58% Spec 4 70% 70% 70% Cutoff 5 163 253 176 Sens 5 45% 44% 41% Spec 5 80% 81% 80% Cutoff 6 230 343 292 Sens 6 31% 27% 21% Spec 6 90% 91% 90% OR Quart 2 1.7 1.6 1.7 p Value 0.079 0.33 0.083 95% CI of 0.94 0.62 0.93 OR Quart 2 3.0 4.3 3.3 OR Quart 3 2.8 3.2 2.8 p Value 6.2E4 0.019 0.0014 95% CI of 1.5 1.2 1.5 OR Quart 3 5.0 8.4 5.2 OR Quart 4 5.6 4.2 5.4 p Value 4.0E8 0.0041 3.5E7 95% CI of 3.0 1.6 2.8 OR Quart 4 10 11 10 Metalloproteinase inhibitor 2 X Serum Creatinine sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 3.89 6.25 5.59 8.79 4.07 6.62 Average 4.99 11.9 7.45 18.6 5.73 11.5 Stdev 4.69 28.4 8.51 45.9 5.63 21.8 p (t-test) 0.0011 0.043 8.6E4 Min 0.528 0.481 1.03 0.762 0.528 0.481 Max 50.2 374 51.0 374 45.1 260 n (Samp) 185 204 74 71 174 171 n (Patient) 185 204 74 71 174 171 At Enrollment sCr or UO sCr only UO only AUC 0.68 0.66 0.66 SE 0.027 0.045 0.029 p 4.4E11 4.1E4 4.4E8 nCohort 1 185 74 174 nCohort 2 204 71 171 Cutoff 1 4.07 5.00 4.41 Sens 1 70% 70% 70% Spec 1 54% 46% 56% Cutoff 2 3.00 3.97 3.20 Sens 2 80% 80% 80% Spec 2 36% 36% 36% Cutoff 3 2.23 2.35 2.43 Sens 3 90% 90% 90% Spec 3 20% 15% 25% Cutoff 4 5.89 7.37 6.19 Sens 4 53% 58% 52% Spec 4 70% 70% 70% Cutoff 5 7.11 9.41 8.41 Sens 5 43% 46% 37% Spec 5 80% 81% 80% Cutoff 6 9.34 12.7 11.0 Sens 6 31% 34% 27% Spec 6 90% 91% 90% OR Quart 2 1.0 1.3 1.4 p Value 1.0 0.63 0.27 95% CI of 0.56 0.49 0.76 OR Quart 2 1.8 3.3 2.7 OR Quart 3 2.2 1.3 2.7 p Value 0.0067 0.63 0.0014 95% CI of 1.2 0.49 1.5 OR Quart 3 3.9 3.3 5.1 OR Quart 4 5.0 5.5 4.4 p Value 3.1E7 9.7E4 5.8E6 95% CI of 2.7 2.0 2.3 OR Quart 4 9.3 15 8.3 Insulin-like growth factor-binding protein 7 X Serum Creatinine/(Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 180 473 210 400 206 569 Average 214000 535000 373 339000 353000 879000 Stdev 1550000 3220000 583 2760000 2320000 4770000 p (t-test) 0.23 0.33 0.20 Min 1.35 3.00 2.35 4.75 1.35 3.00 Max 1.52E7 3.25E7 4220 2.26E7 2.26E7 4.43E7 n (Samp) 176 200 65 67 171 167 n (Patient) 176 200 65 67 171 167 At Enrollment sCr or UO sCr only UO only AUC 0.71 0.65 0.70 SE 0.026 0.048 0.028 p 2.2E15 0.0022 4.0E13 nCohort 1 176 65 171 nCohort 2 200 67 167 Cutoff 1 206 161 273 Sens 1 70% 70% 70% Spec 1 57% 43% 65% Cutoff 2 135 115 176 Sens 2 80% 81% 80% Spec 2 43% 37% 42% Cutoff 3 90.1 53.3 95.7 Sens 3 90% 91% 90% Spec 3 32% 20% 28% Cutoff 4 273 411 347 Sens 4 64% 49% 65% Spec 4 70% 71% 70% Cutoff 5 429 524 605 Sens 5 52% 42% 48% Spec 5 80% 80% 80% Cutoff 6 813 828 1040 Sens 6 33% 28% 32% Spec 6 90% 91% 90% OR Quart 2 2.2 1.7 1.5 p Value 0.011 0.32 0.21 95% CI of 1.2 0.62 0.79 OR Quart 2 4.0 4.5 2.9 OR Quart 3 3.5 2.1 3.3 p Value 5.2E5 0.14 2.3E4 95% CI of 1.9 0.79 1.8 OR Quart 3 6.4 5.7 6.3 OR Quart 4 9.2 5.3 7.2 p Value 6.8E11 0.0019 1.3E8 95% CI of 4.7 1.9 3.6 OR Quart 4 18 15 14 Metalloproteinase inhibitor 2 X Serum Creatinine/(Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 7.38 17.9 8.49 16.6 10.6 22.1 Average 8600 51300 16.2 16400 15300 67800 Stdev 63000 420000 30.1 134000 105000 470000 p (t-test) 0.18 0.33 0.15 Min 0.0807 0.180 0.122 0.288 0.0807 0.180 Max 605000 5510000 229 1100000 1100000 5510000 n (Samp) 176 200 65 67 171 167 n (Patient) 176 200 65 67 171 167 At Enrollment sCr or UO sCr only UO only AUC 0.70 0.65 0.69 SE 0.027 0.048 0.029 p 6.5E14 0.0024 1.2E11 nCohort 1 176 65 171 nCohort 2 200 67 167 Cutoff 1 8.94 7.12 12.0 Sens 1 70% 70% 70% Spec 1 54% 46% 57% Cutoff 2 5.98 4.49 7.82 Sens 2 80% 81% 80% Spec 2 44% 32% 42% Cutoff 3 4.23 2.61 5.45 Sens 3 90% 91% 90% Spec 3 33% 25% 33% Cutoff 4 15.2 16.9 17.6 Sens 4 56% 48% 56% Spec 4 70% 71% 70% Cutoff 5 20.4 21.4 26.2 Sens 5 46% 40% 47% Spec 5 80% 80% 80% Cutoff 6 34.1 33.0 42.6 Sens 6 33% 30% 35% Spec 6 90% 91% 90% OR Quart 2 2.1 1.3 2.4 p Value 0.018 0.62 0.0088 95% CI of 1.1 0.48 1.2 OR Quart 2 3.7 3.4 4.5 OR Quart 3 2.7 1.0 2.5 p Value 0.0013 1.0 0.0047 95% CI of 1.5 0.37 1.3 OR Quart 3 4.8 2.7 4.8 OR Quart 4 8.8 5.7 7.6 p Value 1.5E10 0.0017 5.8E9 95% CI of 4.5 1.9 3.8 OR Quart 4 17 17 15 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 0.522 0.729 0.522 0.976 0.584 0.758 Average 0.801 1.86 0.947 2.72 0.961 2.07 Stdev 0.922 3.75 1.13 6.11 1.13 6.49 p (t-test) 1.7E4 0.012 0.025 Min 0.0240 0.0240 0.0240 0.0270 0.0240 0.0240 Max 5.38 39.1 6.28 39.1 7.75 83.9 n (Samp) 191 207 79 72 177 174 n (Patient) 191 207 79 72 177 174 At Enrollment sCr or UO sCr only UO only AUC 0.64 0.62 0.61 SE 0.028 0.046 0.030 p 9.5E7 0.0073 1.2E4 nCohort 1 191 79 177 nCohort 2 207 72 174 Cutoff 1 0.421 0.413 0.451 Sens 1 70% 71% 70% Spec 1 46% 47% 43% Cutoff 2 0.299 0.214 0.333 Sens 2 80% 81% 80% Spec 2 35% 25% 32% Cutoff 3 0.157 0.133 0.187 Sens 3 90% 90% 90% Spec 3 23% 18% 22% Cutoff 4 0.951 1.04 1.04 Sens 4 45% 49% 45% Spec 4 70% 71% 70% Cutoff 5 1.17 1.54 1.39 Sens 5 43% 42% 39% Spec 5 80% 81% 80% Cutoff 6 2.03 2.58 2.23 Sens 6 30% 24% 26% Spec 6 90% 91% 90% OR Quart 2 2.0 0.77 2.2 p Value 0.019 0.57 0.012 95% CI of 1.1 0.30 1.2 OR Quart 2 3.5 1.9 4.0 OR Quart 3 1.2 1.1 1.2 p Value 0.56 0.90 0.57 95% CI of 0.67 0.43 0.65 OR Quart 3 2.1 2.6 2.2 OR Quart 4 5.0 2.5 3.9 p Value 2.0E7 0.052 2.4E5 95% CI of 2.7 0.99 2.1 OR Quart 4 9.2 6.4 7.2 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 0.405 0.934 0.581 1.21 0.477 1.00 Average 0.757 2.56 1.26 4.20 0.991 2.92 Stdev 0.990 6.67 2.12 10.7 1.51 12.1 p (t-test) 3.1E4 0.022 0.037 Min 0.0120 0.0152 0.0206 0.0152 0.0120 0.0168 Max 5.77 64.2 15.7 64.2 11.5 156 n (Samp) 185 204 74 71 174 171 n (Patient) 185 204 74 71 174 171 At Enrollment sCr or UO sCr only UO only AUC 0.67 0.65 0.66 SE 0.027 0.045 0.029 p 1.1E10 7.1E4 8.7E8 nCohort 1 185 74 174 nCohort 2 204 71 171 Cutoff 1 0.387 0.594 0.430 Sens 1 70% 70% 70% Spec 1 50% 51% 48% Cutoff 2 0.268 0.290 0.298 Sens 2 80% 80% 80% Spec 2 39% 34% 36% Cutoff 3 0.141 0.130 0.202 Sens 3 90% 90% 90% Spec 3 23% 15% 26% Cutoff 4 0.732 1.14 0.800 Sens 4 53% 55% 56% Spec 4 70% 70% 70% Cutoff 5 1.09 1.77 1.28 Sens 5 45% 42% 43% Spec 5 80% 81% 80% Cutoff 6 1.98 2.78 2.85 Sens 6 31% 35% 23% Spec 6 90% 91% 90% OR Quart 2 2.5 1.4 1.8 p Value 0.0025 0.47 0.062 95% CI of 1.4 0.55 0.97 OR Quart 2 4.5 3.7 3.3 OR Quart 3 2.5 1.8 2.3 p Value 0.0025 0.23 0.0092 95% CI of 1.4 0.69 1.2 OR Quart 3 4.5 4.6 4.2 OR Quart 4 6.2 5.4 4.1 p Value 9.2E9 9.9E4 1.1E5 95% CI of 3.3 2.0 2.2 OR Quart 4 12 15 7.8 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2/ (Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 0.988 2.68 0.795 1.97 1.48 3.87 Average 2190 5240 2.00 5130 4260 4590 Stdev 19800 37400 3.51 42000 32900 31600 p (t-test) 0.33 0.31 0.93 Min 0.00227 0.00514 0.00310 0.00610 0.00227 0.00514 Max 247000 344000 25.3 344000 344000 335000 n (Samp) 182 203 70 67 174 170 n (Patient) 182 203 70 67 174 170 At Enrollment sCr or UO sCr only UO only AUC 0.67 0.61 0.67 SE 0.027 0.048 0.029 p 3.0E10 0.019 9.2E9 nCohort 1 182 70 174 nCohort 2 203 67 170 Cutoff 1 1.05 0.424 1.34 Sens 1 70% 70% 70% Spec 1 52% 30% 48% Cutoff 2 0.522 0.252 0.827 Sens 2 80% 81% 80% Spec 2 35% 24% 37% Cutoff 3 0.222 0.0801 0.395 Sens 3 90% 91% 90% Spec 3 22% 10% 26% Cutoff 4 2.20 2.20 2.91 Sens 4 53% 46% 55% Spec 4 70% 70% 70% Cutoff 5 3.16 3.11 4.34 Sens 5 48% 40% 46% Spec 5 80% 80% 80% Cutoff 6 5.82 4.35 8.21 Sens 6 34% 31% 32% Spec 6 90% 90% 90% OR Quart 2 1.4 0.47 2.1 p Value 0.24 0.14 0.020 95% CI of 0.79 0.17 1.1 OR Quart 2 2.5 1.3 3.9 OR Quart 3 1.6 1.1 1.7 p Value 0.11 0.81 0.085 95% CI of 0.90 0.43 0.93 OR Quart 3 2.8 2.9 3.2 OR Quart 4 6.0 2.5 6.0 p Value 3.0E8 0.073 1.1E7 95% CI of 3.2 0.92 3.1 OR Quart 4 11 6.5 12 Insulin-like growth factor-binding protein 7 X Metalloproteinase inhibitor 2 X Serum Creatinine/(Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 0.874 3.05 0.932 2.68 1.15 3.95 Average 1490 6420 2.71 4370 3240 7220 Stdev 12700 46100 6.92 35700 25700 47100 p (t-test) 0.17 0.33 0.33 Min 0.00161 0.00360 0.00282 0.00707 0.00161 0.00360 Max 151000 435000 53.9 292000 292000 435000 n (Samp) 176 200 65 67 171 167 n (Patient) 176 200 65 67 171 167 At Enrollment sCr or UO sCr only UO only AUC 0.70 0.64 0.69 SE 0.027 0.048 0.029 p 2.1E13 0.0029 4.4E11 nCohort 1 176 65 171 nCohort 2 200 67 167 Cutoff 1 0.961 0.748 1.39 Sens 1 70% 70% 70% Spec 1 54% 43% 55% Cutoff 2 0.541 0.320 0.663 Sens 2 80% 81% 80% Spec 2 41% 25% 39% Cutoff 3 0.272 0.135 0.378 Sens 3 90% 91% 90% Spec 3 28% 14% 28% Cutoff 4 1.67 2.53 2.50 Sens 4 60% 54% 57% Spec 4 70% 71% 70% Cutoff 5 3.05 3.09 4.20 Sens 5 50% 43% 49% Spec 5 80% 80% 80% Cutoff 6 6.12 5.01 8.34 Sens 6 36% 36% 35% Spec 6 90% 91% 90% OR Quart 2 1.6 0.69 1.5 p Value 0.14 0.45 0.22 95% CI of 0.87 0.26 0.79 OR Quart 2 2.8 1.8 2.8 OR Quart 3 2.3 1.0 2.7 p Value 0.0056 1.0 0.0020 95% CI of 1.3 0.38 1.4 OR Quart 3 4.1 2.6 5.1 OR Quart 4 7.6 3.8 5.7 p Value 1.5E9 0.014 2.7E7 95% CI of 4.0 1.3 2.9 OR Quart 4 15 11 11 Serum Creatinine sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 0.845 1.10 1.20 1.50 0.815 1.10 Average 0.945 1.26 1.26 1.72 0.958 1.25 Stdev 0.434 0.740 0.545 0.956 0.489 0.732 p (t-test) 4.2E7 3.4E4 1.3E5 Min 0.200 0.370 0.300 0.460 0.200 0.370 Max 2.80 5.30 2.80 5.30 3.57 4.31 n (Samp) 196 211 77 74 184 181 n (Patient) 196 211 77 74 184 181 At Enrollment sCr or UO sCr only UO only AUC 0.63 0.65 0.62 SE 0.027 0.045 0.029 p 1.9E6 0.0011 4.2E5 nCohort 1 196 77 184 nCohort 2 211 74 181 Cutoff 1 0.790 1.15 0.740 Sens 1 71% 70% 70% Spec 1 41% 47% 38% Cutoff 2 0.690 0.890 0.660 Sens 2 80% 82% 80% Spec 2 29% 25% 24% Cutoff 3 0.530 0.790 0.510 Sens 3 90% 92% 91% Spec 3 14% 21% 14% Cutoff 4 1.06 1.50 1.04 Sens 4 52% 49% 51% Spec 4 70% 71% 70% Cutoff 5 1.26 1.60 1.30 Sens 5 41% 46% 36% Spec 5 80% 81% 81% Cutoff 6 1.51 2.10 1.60 Sens 6 27% 24% 24% Spec 6 90% 91% 91% OR Quart 2 0.91 0.53 0.69 p Value 0.73 0.20 0.22 95% CI of 0.52 0.21 0.38 OR Quart 2 1.6 1.4 1.3 OR Quart 3 1.3 1.3 1.6 p Value 0.29 0.56 0.10 95% CI of 0.78 0.53 0.91 OR Quart 3 2.3 3.3 2.9 OR Quart 4 3.3 3.7 2.6 p Value 7.1E5 0.0087 0.0016 95% CI of 1.8 1.4 1.4 OR Quart 4 5.8 9.7 4.8 Serum Creatinine/(Weight Adjusted Urine Output) sCr or UO sCr only UO only Cohort 1 Cohort 2 Cohort 1 Cohort 2 Cohort 1 Cohort 2 Median 1.73 2.75 1.93 2.36 2.05 3.40 Average 1530 4100 2.72 1250 2050 8260 Stdev 10100 22700 2.96 10300 12000 43700 p (t-test) 0.16 0.33 0.073 Min 0.0673 0.150 0.102 0.144 0.0673 0.150 Max 74000 170000 18.0 85000 85000 431000 n (Samp) 177 202 66 68 173 168 n (Patient) 177 202 66 68 173 168 At Enrollment sCr or UO sCr only UO only AUC 0.68 0.62 0.68 SE 0.027 0.048 0.029 p 2.1E11 0.017 1.7E10 nCohort 1 177 66 173 nCohort 2 202 68 168 Cutoff 1 1.92 1.64 2.18 Sens 1 70% 71% 70% Spec 1 54% 44% 54% Cutoff 2 1.46 1.33 1.58 Sens 2 80% 81% 80% Spec 2 41% 39% 38% Cutoff 3 1.07 0.907 1.07 Sens 3 90% 91% 90% Spec 3 32% 33% 24% Cutoff 4 2.73 2.89 3.10 Sens 4 50% 43% 52% Spec 4 70% 71% 71% Cutoff 5 3.53 4.05 3.90 Sens 5 41% 34% 45% Spec 5 80% 80% 80% Cutoff 6 5.15 6.39 5.83 Sens 6 29% 19% 36% Spec 6 90% 91% 90% OR Quart 2 3.0 6.5 1.6 p Value 3.5E4 6.0E4 0.15 95% CI of 1.6 2.2 0.84 OR Quart 2 5.5 19 3.0 OR Quart 3 3.0 2.9 2.0 p Value 3.5E4 0.044 0.029 95% CI of 1.6 1.0 1.1 OR Quart 3 5.5 8.4 3.7 OR Quart 4 7.3 5.0 6.2 p Value 1.2E9 0.0026 6.8E8 95% CI of 3.9 1.8 3.2 OR Quart 4 14 14 12

(93) While the invention has been described and exemplified in sufficient detail for those skilled in this art to make and use it, various alternatives, modifications, and improvements should be apparent without departing from the spirit and scope of the invention. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Modifications therein and other uses will occur to those skilled in the art. These modifications are encompassed within the spirit of the invention and are defined by the scope of the claims.

(94) It will be readily apparent to a person skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention.

(95) All patents and publications mentioned in the specification are indicative of the levels of those of ordinary skill in the art to which the invention pertains. All patents and publications are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.

(96) The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. Thus, for example, in each instance herein any of the terms comprising, consisting essentially of and consisting of may be replaced with either of the other two terms. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims.

(97) Other embodiments are set forth within the following claims.