PAENIBACILLUS LARVAE TREATMENT WITH PHAGE LYSIN FOR AMERICAN FOULBROOD DISEASE
20170183642 ยท 2017-06-29
Inventors
Cpc classification
A61K38/47
HUMAN NECESSITIES
International classification
Abstract
Materials and methods for treating and preventing American Foulbrood disease in honeybees, such as materials and methods for using phage lysin enzymes to lyse Paenibacillus larvae, are provided herein.
Claims
1. A method for killing a Paenibacillus larvae cell, comprising contacting the cell with a lysin polypeptide having an amino acid sequence with at least 90 percent sequence identity to SEQ ID NO:2.
2. The method of claim 1, wherein the P larvae cell is in a honeybee larva.
3. The method of claim 1, wherein said contacting comprises providing the lysin protein to the environment of a honeybee hive.
4. The method of claim 1, wherein the lysin polypeptide has an amino acid sequence with at least 95 percent sequence identity to SEQ ID NO:2.
5. A purified polypeptide having an amino acid sequence that is at least 90 percent but less than 100 percent identical to the sequence set forth in SEQ ID NO:2.
6. The purified polypeptide of claim 5, wherein the amino acid sequence is at least 95 percent but less than 100 percent identical to the sequence set forth in SEQ ID NO:2.
7. A composition comprising the polypeptide of claim 5.
8. The composition of claim 7, wherein the composition comprises honeybee food.
9. (canceled)
10. (canceled)
11. A method for treating American foulbrood in a population of honeybees, comprising administering to the population a lysin polypeptide having an amino acid sequence with at least 90 percent sequence identity to SEQ ID NO:2.
12. The method of claim 11, wherein the population comprises honeybee larvae.
13. The method of claim 11, wherein said administering comprises providing the lysin protein to the environment of a honeybee hive.
14. The method of claim 11, wherein said administering comprises providing a composition that comprises the lysin protein to the environment of a honeybee hive.
15. The method of claim 11, wherein said administering comprises providing a nucleic acid encoding the lysin protein to the environment of a honeybee hive.
16. The method of claim 11, wherein the lysin polypeptide has an amino acid sequence with at least 95 percent sequence identity to SEQ ID NO:2.
Description
DESCRIPTION OF DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
[0028] P. larvae (previously classified as Bacillus larvae) is a pathogen of the larval honeybee (Apis mellifera L.), which causes American foulbrood. Bacteriophage (also called phage) are viruses that can infect and kill bacteria. A bacteriophage of B. larvae was first isolated from decaying larvae of bees killed by AFB (Smirnova, 1953). A second phage was isolated from a lysogenic culture of P. larvae (Gochnauer, 1955). The second phage differed from the first phage in its ability to pass through asbestos filters, heat stability, and plaque morphology (Smirnova, 1954; Gochnauer, 1970). In addition, evidence suggested that other phages were present in other strains of B. larvae (Gochnauer and L'Arrivee, 1969). This conclusion was drawn from sensitivity tests using culture filtrates from different B. larvae cultures and lawns of many different strains. No efforts were made to isolate the different phages. Researchers were unable to concentrate or purify the phage, and, thus were unable to observe the morphology or analyze the nucleic acid component of the phage.
[0029] Another phage specific for B. larvae was isolated from a soil sample in Bulgaria (Popova et al., 1976; Valerianov et al., 1976). This phage, named L3, lysed 10 of 15 strains of B. larvae tested, and did not lyse B. cereus or B. anthracis. A phage, termed BLA, was isolated in Czechoslovakia from several B. larvae strains obtained from combs containing bee larvae killed by American foulbrood (Drobnikova and Ludvik, 1982). All of the phage preparations from different cultures were typically considered to be identical, based on the sole criterion of their appearance in electron micrographs, although some researches believed that two distinct phages were present.
[0030] P. larvae in honeybees can be lysed by introducing phage into a bee hive, such that the phage can physically associate with and lyse the P. larvae. Some phage can infect multiple P. larvae strains tested, including both environmental and isolated (wild) P. larvae strains. See, e.g., U.S. Ser. No. 14/162,638, which published as US 2014-0213144. Thus, viruses are a potential means to control the bacterium and, thereby, treat P. larvae infection.
[0031] Several varieties of phage exist, and each typically attacks only one species/strain of bacteria. The structure of a bacteriophage is depicted in
[0032]
[0033]
[0034] Following adsorption, the phage injects its DNA (and rarely RNA) into the bacterial cell. The tail sheath contracts and the core is driven through the wall to the membrane. This process is called penetration, and it may be both mechanical and enzymatic. Phage T4 packages a bit of lysozyme in the base of its tail from a previous infection and then uses the lysozyme to degrade a portion of the bacterial cell wall for insertion of the tail core. The DNA is injected into the periplasm of the bacterium; generally it is not known how the DNA penetrates the membrane.
[0035] Immediately after injection of the viral DNA, the process called synthesis of early proteins is initiated. This refers to the transcription and translation of a section of the phage DNA to make a set of proteins that are needed to replicate the phage DNA. Among the early proteins produced are a repair enzyme to repair the hole in the bacterial cell wall, a DNAase enzyme that degrades the host DNA into precursors of phage DNA, and a virus specific DNA polymerase that will copy and replicate phage DNA. During this period, the cell's energy-generating and protein-synthesizing abilities are maintained, but they are subverted by the virus. The result is the synthesis of several copies of the phage DNA.
[0036] The next step is the synthesis of late proteins. Each of the several replicated copies of the phage DNA can be used for transcription and translation of a second set of proteins called the late proteins. The late proteins are mainly structural proteins that make up the capsomeres and the various components of the head and tail assembly. Lysozyme is another late protein that will be packaged in the tail of the phage and used to escape from the host cell during the last step of the replication process.
[0037] The replication of phage parts is followed by an assembly process. The proteins that make up the capsomeres assemble themselves into the heads and reel in a copy of the phage DNA. The tail and accessory structures assemble and incorporate a bit of lysozyme in the tail plate. The viruses arrange their escape from the host cell during the assembly process.
[0038] While the viruses are assembling, lysozyme is being produced as a late viral protein. Some of this lysozyme is used to escape from the host cell by lysing the cell wall peptidoglycan from the inside. This accomplishes the release of the mature viruses, which spread to nearby cells, infect them, and complete additional cycles. The life cycle of a T-phage takes about 25-35 minutes to complete. Because the host cells are ultimately killed by lysis, this type of viral infection is referred to as lytic infection.
[0039]
[0040] The one phage gene that is expressed codes for the synthesis of a repressor molecule that prevents the synthesis of phage enzymes and proteins required for the lytic cycle. If the synthesis of the repressor molecule stops or if the repressor becomes inactivated, another enzyme encoded by the prophage is synthesized, and the enzyme then excises the viral DNA from the bacterial chromosome. The excised DNA (the phage genome) can then behave like a lytic virus to produce new viral particles and eventually lyse the host cell. This spontaneous derepression is a rare event, occurring about one in 10,000 divisions of a lysogenic bacterium, but it assures that new phage are formed that can proceed to infect other cells.
[0041] It can be difficult to recognize lysogenic bacteria, because lysogenic and nonlysogenic cells appear identical. In a few situations, however, the prophage supplies genetic information such that the lysogenic bacteria exhibit a new characteristic (new phenotype) that is not displayed by the nonlysogenic cell. This phenomenon is called lysogenic conversion.
[0042] In lytic systems, a protein known as holin is responsible for forming a pore in the cell membrane, such that lysin proteins can target bonds in the peptidoglycan of the cell wall that are necessary component for the wall to remain intact. Lysin thus produces holes in the cell wall peptidoglycan, and the cell membrane is externalized after internal pressure forces it through the hole in the cell wall. This leads to rupture of the membrane and loss of intercellular components, causing cell death. External lysin therapy works only on Gram+ cells, however. Gram cells have an outer membrane covering the peptidoglycan cell wall, so lysin is not able to form a hole without a holin to degrade the cell membrane.
[0043]
[0044] As described herein, a novel phage lysin was isolated and characterized, and shown to be active against P. larvae in culture. Thus, this document provides methods for lysing P. larvae cells by contacting them with a lysin polypeptide. The methods provided herein can include, for example, providing to an environment of a bee hive infected with P. larvae an isolated lysin polypeptide or a nucleic acid encoding the lysin polypeptide. In some embodiments, the lysin polypeptide or nucleic acid can be contained within a composition, and can be provided directly to bee larvae (e.g., in larvae food, or in another composition that larvae can ingest) or can be applied to the bee hive or portions thereof. Lysing of the P. larvae can cause a hole in the peptidoglycan of the cell wall, and the cell membrane of the P. larvae can be is externalized due to internal pressure that forces the membrane through the hole in the cell wall, leading to rupture of the cell membrane and loss of intercellular components. Rupture of the cell membrane can lead to death of the P. larvae cells. The methods provided herein therefore can be used to treat or prevent AFB in a population of honeybees.
[0045] The lysin polypeptide can contain the amino acid sequence set forth in SEQ ID NO:2 herein. In some embodiments, the lysin polypeptide can include an amino acid sequence that is at least 90 percent (e.g., at least 91, at least 92, at least 93, at least 94, at least 95, at least 96, at least 97, at least 98, or at least 99 percent) identical to the sequence set forth in SEQ ID NO:2.
[0046] The percent sequence identity between a particular nucleic acid or amino acid sequence and a sequence referenced by a particular sequence identification number is determined as follows. First, a nucleic acid or amino acid sequence is compared to the sequence set forth in a particular sequence identification number using the BLAST 2 Sequences (Bl2seq) program from the stand-alone version of BLASTZ containing BLASTN version 2.0.14 and BLASTP version 2.0.14. This stand-alone version of BLASTZ can be obtained online at fr.com/blast or at ncbi.nlm.nih.gov. Instructions explaining how to use the Bl2seq program can be found in the readme file accompanying BLASTZ. Bl2seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. To compare two nucleic acid sequences, the options are set as follows: -i is set to a file containing the first nucleic acid sequence to be compared (e.g., C:\seq1.txt); -j is set to a file containing the second nucleic acid sequence to be compared (e.g., C:\seq2.txt); -p is set to blastn; -o is set to any desired file name (e.g., C:\output.txt); -q is set to 1; -r is set to 2; and all other options are left at their default setting. For example, the following command can be used to generate an output file containing a comparison between two sequences: C:\Bl2seq c:\seq1.txt -j c:\seq2.txt -p blastn -o c:\output.txt -q 1 -r 2. To compare two amino acid sequences, the options of Bl2seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C:\seq1.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C:\seq2.txt); -p is set to blastp; -o is set to any desired file name (e.g., C:\output.txt); and all other options are left at their default setting. For example, the following command can be used to generate an output file containing a comparison between two amino acid sequences: C:\Bl2seq c:\seq1.txt -j c:\seq2.txt -p blastp -o c:\output.txt. If the two compared sequences share homology, then the designated output file will present those regions of homology as aligned sequences. If the two compared sequences do not share homology, then the designated output file will not present aligned sequences.
[0047] Once aligned, the number of matches is determined by counting the number of positions where an identical nucleotide or amino acid residue is presented in both sequences. The percent sequence identity is determined by dividing the number of matches either by the length of the sequence set forth in the identified sequence (e.g., SEQ ID NO:2), or by an articulated length (e.g., 100 consecutive nucleotides or amino acid residues from a sequence set forth in an identified sequence), followed by multiplying the resulting value by 100. For example, a nucleic acid sequence that has 210 matches when aligned with the sequence set forth in SEQ ID NO:2 is 93.8 percent identical to the sequence set forth in SEQ ID NO:2 (i.e., 210224100=93.8). It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 75.11, 75.12, 75.13, and 75.14 are rounded down to 75.1, while 75.15, 75.16, 75.17, 75.18, and 75.19 are rounded up to 75.2. It also is noted that the length value will always be an integer.
[0048] This document also provides isolated nucleic acids having a sequence with at least 90 percent but less than 100 percent sequence identity to the nucleotide sequence set forth in SEQ ID NO:1, and purified polypeptides having a sequence with at least 90 percent but less than 100 percent sequence identity to the amino acid sequence set forth in SEQ ID NO:2. For example, a polypeptide can have one or more additions subtractions, or substitutions as compared to SEQ ID NO:2. Polypeptides having one or more amino acid substitutions relative to SEQ ID NO:2 can be prepared using methods known in the art.
[0049] In some embodiments, amino acid substitutions can be conservative amino acid substitutions. In some cases, amino acid substitutions can be substitutions that do not differ significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side-chain properties: (1) hydrophobic: norleucine, methionine, alanine, valine, leucine, isoleucine; (2) neutral hydrophilic: cysteine, serine, threonine; (3) acidic: aspartate, glutamate; (4) basic: asparagine, glutamine, histidine, lysine, arginine; (5) residues that influence chain orientation: glycine, proline; and (6) aromatic; tryptophan, tyrosine, phenylalanine. Conservative amino acid substitution also includes groupings based on side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. It is reasonable to expect that replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid will not have a major effect on the properties of the resulting polypeptide. In some cases, non-conservative substitutions can be used. A non-conservative substitution can include exchanging a member of one of the classes described herein for another. Whether an amino acid change results in a functional polypeptide can readily be determined by assaying the specific activity of the polypeptide (e.g., using a method for assessing lytic activity against P. larvae, as described herein).
[0050] As used herein, isolated, when in reference to a nucleic acid, refers to a nucleic acid that is separated from other nucleic acids that are present in a genome, e.g., a plant genome, including nucleic acids that normally flank one or both sides of the nucleic acid in the genome. The term isolated as used herein with respect to nucleic acids also includes any non-naturally-occurring sequence, since such non-naturally-occurring sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome.
[0051] An isolated nucleic acid can be, for example, a DNA molecule, provided one of the nucleic acid sequences normally found immediately flanking that DNA molecule in a naturally-occurring genome is removed or absent. Thus, an isolated nucleic acid includes, without limitation, a DNA molecule that exists as a separate molecule (e.g., a chemically synthesized nucleic acid, or a cDNA or genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences, as well as DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a pararetrovirus, a retrovirus, lentivirus, adenovirus, or herpes virus), or the genomic DNA of a prokaryote or eukaryote. In addition, an isolated nucleic acid can include a recombinant nucleic acid such as a DNA molecule that is part of a hybrid or fusion nucleic acid. A nucleic acid existing among hundreds to millions of other nucleic acids within, for example, cDNA libraries or genomic libraries, or gel slices containing a genomic DNA restriction digest, is not to be considered an isolated nucleic acid.
[0052] A nucleic acid can be made by, for example, chemical synthesis or polymerase chain reaction (PCR). PCR can be used to amplify specific sequences from DNA as well as RNA, including sequences from total genomic DNA or total cellular RNA. Various PCR methods are described, for example, in PCR Primer: A Laboratory Manual, Dieffenbach and Dveksler, eds., Cold Spring Harbor Laboratory Press, 1995. Generally, sequence information from the ends of the region of interest or beyond is employed to design oligonucleotide primers that are identical or similar in sequence to opposite strands of the template to be amplified. Various PCR strategies also are available by which site-specific nucleotide sequence modifications can be introduced into a template nucleic acid.
[0053] Isolated nucleic acids also can be obtained by mutagenesis. For example, a donor nucleic acid sequence can be mutated using standard techniques, including oligonucleotide-directed mutagenesis and site-directed mutagenesis through PCR. See, Short Protocols in Molecular Biology, Chapter 8, Green Publishing Associates and John Wiley & Sons, edited by Ausubel et al., 1992.
[0054] The term polypeptide as used herein refers to a compound of two or more subunit amino acids regardless of post-translational modification (e.g., phosphorylation or glycosylation). The subunits may be linked by peptide bonds or other bonds such as, for example, ester or ether bonds. The term amino acid is intended to include natural and unnatural or synthetic amino acids, including D/L optical isomers.
[0055] By isolated or purified with respect to a polypeptide it is meant that the polypeptide is separated to some extent from the cellular components with which it is normally found in nature (e.g., other polypeptides, lipids, carbohydrates, and nucleic acids). A purified polypeptide can yield a single major band on a non-reducing polyacrylamide gel. A purified polypeptide can be at least about 75% pure (e.g., at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% pure). Purified polypeptides can be obtained by, for example, extraction from a natural source, by chemical synthesis, or by recombinant production in a host cell or transgenic plant, and can be purified using, for example, affinity chromatography, immunoprecipitation, size exclusion chromatography, and ion exchange chromatography. The extent of purification can be measured using any appropriate method, including, without limitation, column chromatography, polyacrylamide gel electrophoresis, or high-performance liquid chromatography.
[0056] Recombinant nucleic acid constructs (e.g., vectors) containing lysin nucleic acids also are provided herein. A vector is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements. Suitable vector backbones include, for example, those routinely used in the art such as plasmids, viruses, artificial chromosomes, BACs, YACs, or PACs. The term vector includes cloning and expression vectors, as well as viral vectors and integrating vectors. An expression vector is a vector that includes one or more expression control sequences, and an expression control sequence is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence. Suitable expression vectors include, without limitation, plasmids and viral vectors derived from, for example, bacteriophage, baculoviruses, tobacco mosaic virus, herpes viruses, cytomegalovirus, retroviruses, vaccinia viruses, adenoviruses, and adeno-associated viruses. Numerous vectors and expression systems are commercially available from such corporations as Novagen (Madison, Wis.), Clontech (Palo Alto, Calif.), Stratagene (La Jolla, Calif.), and Invitrogen/Life Technologies (Carlsbad, Calif.).
[0057] In a construct as provided herein, a lysin coding sequence can be operably linked to a regulatory region that controls expression of the coding sequence. The terms regulatory region, control element, and expression control sequence refer to nucleotide sequences that influence transcription or translation initiation and rate, and stability and/or mobility of the transcript or polypeptide product. Regulatory regions include, without limitation, promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5 and 3 untranslated regions (UTRs), transcriptional start sites, termination sequences, polyadenylation sequences, introns, and other regulatory regions that can reside within coding sequences, such as secretory signals, Nuclear Localization Sequences (NLS) and protease cleavage sites.
[0058] As used herein, operably linked means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest. A coding sequence is operably linked and under the control of expression control sequences in a cell when RNA polymerase is able to transcribe the coding sequence into RNA, which if an mRNA, then can be translated into the protein encoded by the coding sequence. Thus, a regulatory region can modulate, e.g., regulate, facilitate or drive, transcription in the plant cell, plant, or plant tissue in which it is desired to express a modified target nucleic acid.
[0059] The vectors provided herein also can include, for example, origins of replication, and/or scaffold attachment regions (SARs). In addition, an expression vector can include a tag sequence designed to facilitate manipulation or detection (e.g., purification or localization) of the expressed polypeptide. Tag sequences, such as green fluorescent protein (GFP), glutathione S-transferase (GST), polyhistidine, c-myc, hemagglutinin, or Flag tag (Kodak, New Haven, Conn.) sequences typically are expressed as a fusion with the encoded polypeptide. Such tags can be inserted anywhere within the polypeptide, including at either the carboxyl or amino terminus.
[0060] The methods provided herein can be used to treat, prevent, or reduce the risk of a P. larvae infection in a honeybee or a population of honeybees. In some embodiments, the methods provided herein can include administering to a honeybee a composition containing a lysin polypeptide that is capable of lysing more than one strain of P. larvae. Any suitable amount of polypeptide or nucleic acid can be administered. in some embodiments, for example, a method can include administering at least 100 mg (e.g., at least 100 mg, at least 500 mg, at least 1 g, at least 2.5 g, at least 5 g, or more than 5 g) of a lysin polypeptide to the environment of a bee hive. The terms treatment and treating refer to an intervention (e.g., the administration of an agent to a subject) that prevents, slows, or delays the onset or progression of a disease or reduces (e.g., eradicates) its incidence within a treated subject (e.g., a honey bee).
[0061] The methods provided herein can include, for example, providing to an environment of a bee hive infected with P. larvae an isolated lysin polypeptide or a nucleic acid encoding the lysin polypeptide. In some embodiments, the lysin polypeptide or nucleic acid can be contained within a composition, and can be provided directly to bee larvae (e.g., in larvae food, or in another composition that larvae can ingest) or can be applied to the bee hive or portions thereof. In some cases, the method can include providing a population of honeybees (e.g., a population that includes larvae) with a composition (e.g., a nutritional medium such as worker jelly or royal jelly) containing an amount of indole, phenol, or a derivative thereof, that is effective to prevent germination of P. larvae spores. Nutritional media for honeybees can be obtained commercially, for example, and supplemented with a compound as described herein.
[0062] The invention will be further described in the following example, which does not limit the scope of the invention described in the claims.
EXAMPLE
Isolation and Characterization of a Novel Phage Lysin Active Against P. larvae
[0063] During the lytic cycle of viral infection, bacteriophages express proteins called lysins after genome replication and capsid assembly. A holin protein is expressed first, and creates lesions in the inner bacterial membrane. The lysin can then traverse these lesions and hydrolyze peptidoglycan, causing lysis of the cell and release of progeny virions, which completes the viral life cycle. In Gram-positive bacteria, the peptidoglycan layer is exposed, so exogenous application of purified recombinant lysin can cause rapid cell death even without the holin or viral infection. Lysins are modular, possessing one or more conserved N-terminal catalytic domains and one C-terminal cell wall binding domain. Using bioinformatics, the genomes of numerous P. larvae phage were analyzed, revealing extensive conservation of lysin and holin genes. A bacteriophage lysin (PlyPalA) was identified from the genome of a novel bacteriophage that infects P. larvae. PlyPalA has an N-acetylmuramoyl-L-alanine amidase N-terminal domain, and it caused significant reduction in turbidity of pathogenic log-phase P. larvae cultures. PlyPalA also had a wide pH range of activity, and was readily expressed in transformed E. coli and purified by ion exchange chromatography.
[0064] Materials and methods: Genomic phage DNA was extracted and then sequenced using Illumina NextGen sequencing, followed by annotation and identification of putative lysin genes in DNA Master. Comparative genomics using previously-sequenced P. larvae phages was carried out using Mauve. PlyPalA was identified with BLAST due to high similarity to known phage lysins. Primers specific for the lysin gene plypalA were engineered with PstI and EcoRI restriction sites, ligated into the plasmid pBAD24, and cloned into E. coli strain MON1. Positive transformants were screened with a soft agar overlay containing P. larvae and identified by a distinct clearing around the colonies.
[0065] A positive transformant was cultured in LB supplemented with ampicillin, and expression of PlyPalA was induced with arabinose. Total proteins were extracted by chloroform and bead beating. The lysin, PlyPalA, was purified by salting out with 40% saturation of (NH.sub.4).sub.2SO.sub.4, cation exchange chromatography (CEC), and anion exchange chromatography (AEC). Purity was verified by SDS-PAGE. The lysin was quantified with a bicinchoninic acid (BCA) assay in which reduced copper ions form a purple-colored complex in the presence of protein. Lysis assays were carried out in triplicate on 96-well plates at 35 C. using a Tecan plate reader.
[0066] The nucleic acid sequence of PlyPalA is:
TABLE-US-00001 (SEQIDNO:1) ATGATGGAAATCAGAGAAATGCTAGTAGACCCAAGTAAATATGGAATTA AATGTCCGAATAAAATGGCACCGAAATATATTACGTTCCACAATACGTAT AACGATGCTCCCGCAGAAAATGAGGTTCGTTACATGATCGGGAACAATAA CGAGGTTTCGTTCCACGTTGCTGTGGATGATAAGGAAGCTGTTCAGGGCA TTCCTTTTGATCGAAATGCCTGGCATTGTGGAGACGGGAACGGGACAGGA AACCGTCAATCCATCGGCGTAGAGATTTGTTATTCCAAGTCCGGCGGTAA CCGATATTATAAGGCCGAGGACAATGCGGCTATTATCATTGCCCAGCTTA TGAAACAGTTTTGTATTCCTATTGAGAATGTGGTTCCACACCAGCACTGG AGTGGTAAATACTGTCCGCACAGAATGTTAGATGAGGGAAGAGTGCCAAG CTTTATAGAGCGAATTAAACAAGCATACGAAGGAGAGGAAGACGACATGA GTAGAACATTACAACTGGAAGATTGGCAATGGAAACAGCTCTATGACAAT ATGGGGAAAGTCTGGAATGCAGGGAAATTTACAGACTGGAATTGGATGGT TAAAATAGAAAACCGTTGCCTTACCGTTGATGAGCTGGCATGGCTTAACA ACCACATTTTAGCGAGTAGCCTGTAG
[0067] The amino acid sequence for the encoding protein is:
[0068] MMEIREMLVDPSKYGIKCPNKMAPKYITFHNTYNDAPAENEVRYMIGNN NEVSFHVAVDDKEAVQGIPFDRNAWHCGDGNGTGNRQSIGVEICYSKSGGNRYY KAEDNAAIIIAQLMKQFCIPIENVVPHQHWSGKYCPHRMLDEGRVPSFIERIKQAY EGEEDDMSRTLQLEDWQWKQLYDNMGKVWNAGKFTDWNWMVKIENRCLTVD ELAWLNNHILASSL (SEQ ID NO:2)
[0069] A hybrid method for phage DNA extraction: Phage capsids were disrupted by Proteinase K and SDS. Phenol was added to denature proteins and chloroform was used to remove phenol, directly yielding intact genomes suitable for sequencing and PCR. After sequencing, they were annotated and putative lysins and holins were identified and analyzed bioinformatically.
[0070] The gene for PlyPalA is immediately upstream of a gene for a putative phage holin: Phobius (
[0071] Predicted 3D structure of PlyPalA: Phyre2 (
[0072] Comparative genomics of P. larvae phage lysis cassettes: A comparative analysis of three phage genomes is shown in
[0073] Phusion PCR amplification of lysin genes: Phusion is a DNA polymerase with an error rate of 4.410.sup.7, approximately 50 times less than that of Taq polymerase. Phusion was used to amplify plypalA from phage XIII (
[0074] SDS-PAGE of the progressive purification of PlyPalA: A 7.5% acrylamide gel showing purification is shown in
[0075] Lytic activity of PlyPalA against P. larvae strains: P. larvae strains were grown to log-phase, washed in PBS, and frozen at 80 C. Cells were resuspended in buffer, and 180 L of the cell suspension was combined with either 20 L of purified lysin or buffer, in triplicate. Effective % drop in OD600 was calculated by subtracting the buffer control % drop from the treated % drop after 30 minutes of incubation at 35 C. E. coli was used as a negative control. Results are summarized in Table 1.
TABLE-US-00002 TABLE 1 Effective Bacterial Strain % Drop in OD.sub.600 P. larvae 16425 68.77 P. larvae 2188 65.88 P. larvae 748 54.10 P. larvae 3544 48.45 P. larvae 2231 45.39 P. larvae 747 43.76 P. larvae 2605 38.04 P. larvae 3688 30.23 P. larvae 367 18.73 P. larvae 843 11.84 P. larvae 368 7.36 E. coli 11303B 0.28
[0076] pH activity range of PlyPalA: P. larvae strain 748 was grown to log-phase, and 270 L was treated with 30 L of purified lysin or buffer. Percentage drop in OD.sub.600 was calculated after 67 minutes of incubation at 35 C., and is plotted on
[0077] Further experiments: The genomes of XIII and F appear to have assembled into one contig with high coverage and seem complete; sequencing reads of WA's genome are assembled. Additionally, PlyPalB, which has a high (<90%) amino acid similarity to PlyPalA, is expressed and purified to test whether its range of activity is different from PlyPalA. SDS-PAGE is conducted with additional reducing agent to verify that the lytic activity indeed comes from one protein.
[0078] In addition, the specificity of PlyPalA in vitro is further characterized. In particular, its activity against Paenibacillus spp., as well as its activity against other genera of Gram-positive bacteria, such as Lactobacillus spp., is evaluated to ensure that it will not harm commensal organisms in the honey bee larva microbiome. Its stability in heat and its ability to be lyophilized are determined. Once in vitro tests are completed, PlyPalA and the other lysins are tested in vivo, in honey bee larvae that are raised in the lab and infected with P. larvae endospores.
OTHER EMBODIMENTS
[0079] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.