Porcine reproductive and respiratory syndrome virus compositions and uses thereof
09687543 ยท 2017-06-27
Inventors
- Federico Zuckermann (Champaign, IL, US)
- Gabriela Calzada-Nova (Urbana, IL, US)
- William Schnitzlein (Champaign, IL, US)
Cpc classification
A61K9/0019
HUMAN NECESSITIES
C12N2770/10034
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N2770/10021
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
Abstract
Provided herein are embodiments relating to porcine reproductive and respiratory syndrome (PRRS) virus, compositions comprising the virus, and methods of using the virus. The virus may be used to immunize a mammal, including swine. Methods for generating an immune response against PRRS virus in swine by administering a composition comprising the virus are provided.
Claims
1. A method of inducing an immune response specific for Porcine Reproductive and Respiratory Syndrome virus (PRRSV) in a swine, the method comprising the step of: administering to the swine an immunogenic composition comprising a PRRSV, wherein the PRRSV comprises a nucleic acid sequence of at least 95% identity to SEQ ID NO:1, and wherein the nucleic acid sequence encodes a Protein E amino acid sequence comprising SEQ ID NO:12 and a GP3 amino acid sequence comprising SEQ ID NO:16.
2. The method of claim 1, wherein the PRRSV is live.
3. The method of claim 1, wherein the administering is intramuscular, intradermal, mucosal, oral, sublingual, intraocular, intranasal, intravenous, intraperitoneal, topical, or transdermal.
4. The method of claim 1, wherein the administering is intramuscular.
5. The method of claim 2, wherein the administering is intramuscular.
6. The method of claim 1, wherein the administering is intranasal.
7. The method of claim 2, wherein the administering is intranasal.
8. The method of claim 1, wherein the PRRSV is characterized by a Protein E sequence characterized by SEQ ID NO:12, a Nsp2 sequence characterized by SEQ ID NO:7, or both a Protein E sequence characterized by SEQ ID NO:12 and a Nsp2 sequence characterized by SEQ ID NO:7.
9. The method of claim 2, wherein the PRRSV is characterized by a Protein E sequence characterized by SEQ ID NO:12, a Nsp2 sequence characterized by SEQ ID NO:7, or both a Protein E sequence characterized by SEQ ID NO:12 and a Nsp2 sequence characterized by SEQ ID NO:7.
10. The method of claim 1, wherein the PRRSV is characterized by a deposit with the American Type Culture Collection designated as ATCC Patent Deposit No. PTA-120658.
11. The method of claim 2, wherein the PRRSV is characterized by a deposit with the American Type Culture Collection designated as ATCC Patent Deposit No. PTA-120658.
12. A method of inducing an immune response specific for Porcine Reproductive and Respiratory Syndrome virus (PRRSV) in a swine, the method comprising the step of: administering to the swine an immunogenic composition comprising a PRRSV, wherein the PRRSV comprises an isolated PRRS virus having a Protein E sequence characterized by SEQ ID NO:12, a Nsp2 sequence characterized by SEQ ID NO:7, or both a Protein E sequence characterized by SEQ ID NO:12 and a Nsp2 sequence characterized by SEQ ID NO:7.
13. The method of claim 12, wherein the PRRSV is live.
14. The method of claim 12, wherein the administering is intramuscular.
15. The method of claim 12, wherein the administering is intranasal.
16. An isolated Porcine Reproductive and Respiratory Syndrome (PRRS) virus, wherein the virus comprises a nucleic acid sequence of at least 95% identity to SEQ ID NO:1 and wherein the genome of the virus encodes a protein selected from Protein E comprising a valine at position 31 and an alanine at position 60 relative to SEQ ID NO: 25, or Protein GP3 comprising a valine at position 94, a serine at position 96 and a phenylalanine at position 213 relative to SEQ ID NO:21.
17. The isolated PRRSV of claim 16, wherein the genome of the virus further encodes one or more proteins selected from a Nsp2 protein having a histidine at position 338, and a Nsp2 protein having a leucine at position 495.
18. The isolated PRRSV of claim 16, wherein the genome of the virus further encodes one or more proteins selected from a Nsp2 protein having a valine at position 67, and a Nsp2 protein having a proline at position 490.
19. The isolated PRRSV of claim 16, wherein the genome of the virus comprises the sequence of SEQ ID NO:3 or an RNA equivalent thereof.
20. A method of inducing an immune response specific for Porcine Reproductive and Respiratory Syndrome virus (PRRSV) in a swine, the method comprising the step of: administering to the swine an immunogenic composition comprising a PRRSV of claim 16.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
DETAILED DESCRIPTION
(17) Porcine reproductive and respiratory syndrome virus first appeared in the United States of America in the late 1980's. Convincing evidence of the need for new tools to control PRRS is best illustrated by the significant increase in the prevalence of PRRS in U.S. swine population over the last several years. Serological surveys conducted by the Animal and Plant Health Inspection Service (APHIS) indicate that the initial 35% prevalence of PRRS in grower/finisher American swine herds observed in 2000, increased to 53% by 2006. Since then, the prevalence continued to increase so that by 2009 the prevalence reached an alarmingly high 71%, representing a >200% increase over a nine year period. Now, more than 70% of the swine-herds in the U.S. are infected with North American type (genotype 2) PRRS virus, causing economic loses of over $664 million annually, making it the most costly disease to the pork industry.
(18) Being a major economic problem for the pork industry, the National Pork Board (NPB) considers the control and elimination of PRRS virus from swine commercial herds a top priority. However, disease control has proven difficult to achieve largely because the RNA genome of this virus exhibits a high rate of mutation that results in a significant and constant genetic/antigenic virus diversification. This is clearly exemplified by the existence of 9 well-defined type 2 (or North American-like) PRRS virus lineages that exhibit major phylogenetic differences among them. The 9 distinct North American-like PRRS virus lineages have arisen since the first appearance of this major swine pathogen 25 years ago, and encompass the great genetic diversity of PRRSV virus currently existing in the world. These lineages are genetically distinct, as evidenced by an intra-lineage diversity of at least 11%. The great majority (>95%) of PRRS virus that has been isolated in the U.S. belong to four of these lineages, namely lineages 1, 5, 8 and 9.
(19) It is generally thought that the level of protective efficacy of a PRRS MLV vaccine against disease resulting from infection with a virulent PRRS virus is largely dependent on the genetic similarity (homology) of the two viruses. Thus, based on the collective wisdom expressed in the art, the time-dependent increase in genetic diversity among contemporary PRRS virus strains should render an attenuated PRRS virus vaccine with an outdated genotype incapable of conferring sufficiently effective protective immunity against recently evolved PRRS viruses in pigs. Accordingly, it should be noted that the two currently available vaccines were generated from ancient wild-type viruses isolated in 1991 and 1997, and belong to either lineage 5 or 8, which are very distant phylogenetically from the great majority (60%) of PRRS virus strains currently circulating in the field, which belong to either lineage 1 or 9. While such divergence may impact the immunizing potential of the two commercial vaccines, other factors, such as the nature of the immunizing virus on its effectiveness as a vaccine, have not been considered.
(20) The inventors have discovered three new variant strains called G16X, 794A61, and 111698, that were derived from the North American PRRS virus isolate 89-46448-40, and that surprisingly, stimulate IFN alpha considerably more strongly in virus-infected porcine alveolar macrophages as compared to the parental virus strain. The new variants were derived from the parental strain through plaque purification or end point dilution. The new several point mutations in the three variant strains distinguish them from the parental 89-46448-40 virus, which based on its ORF5 sequence belongs to the earliest PRRS virus lineage that appeared in North America, namely lineage 5. The 89-46448-40 virus naturally exhibits negligible virulence, and may be a mixed population of genetically related viruses that differ in their genomic nucleotide sequences by several single nucleotide mutations. The sequences of the virus strains G16X, 794A61, and 111698 differ by several synonymous and non-synonymous point mutations from the 89-46448-40 virus, which based on their ORF5 nucleotide sequence all belong to the type 2 PRRSV sublineage 5.1. The mutations in the genome of the three novel strains result in 2 to 5 amino acid changes compared to proteins encoded by the 89-46448-40 virus.
(21) In addition, G16X unexpectedly does not inhibit the synthesis of interferon alpha by porcine macrophages exposed to the synthetic double stranded (ds) RNA molecule poly (I:C), unlike the 89-46448-40 virus. Instead, the G16X strain enhances the response to this molecule, which is already a strong inducer of the production of this cytokine by porcine alveolar macrophages. Notably, even though G16X, 794A61, and 111698 are nearly isogenic, they differ significantly from each other in their vaccine efficacies [poor (794A61), moderate (111698) and good (G16X)] in providing protection upon subsequent challenge with the highly virulent, and genetically dissimilar (heterologous) PRRS virus isolate belonging to lineage 8. Surprisingly, G16X has superior ability to generate a protective immune response in pigs to which this strain is administered, as compared to the other two strains (794A61 and 111698). This was evidenced by G16X causing a more rapid reduction and/or elimination of infectious lineage 8 (heterologous) challenge virus. In addition when evaluated for its vaccine efficacy against a different heterologous virulent type 2 PRRS virus belonging to lineage 1, the G16X virus is also capable of stimulating strong protective immunity.
(22) In addition, because of the paltry virulence exhibited by the parental 89-46448-40 virus isolate, and the apparent vaccine efficacy of the three derived strains, the mutant PRRS viruses disclosed herein can be used as live PRRS virus vaccines without having to modify their biological character via serial passaging in cultured mammalian cells, or via attenuation. Furthermore, the risk of these vaccines developing a virulent phenotype is unlikely due to the natural negligible virulence of the progenitor virus isolate. Thus, the inventors made the contrarian discovery that virus strains derived from an ancient PRRS virus with negligible virulence can induce protective immunity in pigs against challenge with a heterologous (different lineage) virulent PRRS virus.
1. DEFINITIONS
(23) The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. As used in the specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise.
(24) For recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the numbers 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
(25) Cell refers to a biological entity as would be understood in the art and which is intended to encompass a cell that may be a primary cell or a cell line. When several of these terms are used herein, it will be appreciated by one of ordinary skill that such usage is merely for purposes of emphasizing well understood distinctions. For example, the phrase a cell or cell line may emphasize the contrast between an original primary isolate versus an immortalized version which could be a direct derivative of the original primary isolate.
(26) Isolated refers to a manipulated state that is different than that which is the natural state and/or is modified relative to a starting material, in which case the term is meant to be consistent with the concept of being purified. For example, an isolated primary cell is excised from a natural tissue or other source in a host organism and maintained apart from the original source. As another example, a cell component can be placed in culture or further separated from a lung lavage fluid-based sample, thus achieving a relatively isolated cell.
(27) A peptide or polypeptide is a linked sequence of amino acids and may be natural, synthetic, or a modification or combination of natural and synthetic.
(28) Porcine reproductive and respiratory syndrome or PRRS refers to the causative agent of a disease sometimes referred to as mystery swine disease, swine infertility and respiratory syndrome, and blue ear disease. The terms porcine reproductive and respiratory syndrome or PRRS are intended to include antigenic, genetic and pathogenic variations among PRRS virus isolates as described in Wensvoort et al. 1992, J. Vet. Diagn. Invest., 4:134-138 and Mardassi et al., 1994, J. Gen. Virol., 75:681-685, the contents of which are incorporated herein by reference.
(29) Purified refers to a condition wherein there has been a relative enrichment, separation, and/or removal of a substance relative to a starting material. The term can encompass conditions of an at least partial purification and does not necessarily imply an absolute state of purity. For example, the term can apply to a PRRS virus which is in a mixed stock but is predominantly isogenic, and which may be at least 75%, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7, 99.8, 99.9 or 100% genetically homogeneous. Purified independently can be applicable to what may customarily be considered a pure virus preparation or stock.
(30) Treatment or treating, when referring to protection of an animal from a disease, means preventing, suppressing, repressing, or completely eliminating the disease. Preventing the disease involves administering a composition of the present invention to an animal prior to onset of the disease. Suppressing the disease involves administering a composition of the present invention to an animal after induction of the disease but before its clinical appearance. Repressing the disease involves administering a composition of the present invention to an animal after clinical appearance of the disease.
(31) Variant, when referring to a protein sequence disclosed herein, means a protein with a sequence that is at least 50, 55, 60, 65, 70, 75, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identical to a reference sequence. The variant may also retain at least one biological activity of a reference protein, and may also retain at least one immunological or immunogenic property of a reference sequence. The biological activity may be increasing IFN alpha activity.
2. PORCINE REPRODUCTIVE AND RESPIRATORY SYNDROME VIRUS
(32) a. Virus
(33) Provided herein is a virus, which may be PRRS virus. The virus may be isolated, may be purified, may be attenuated, and may be a modified live virus. The virus may be able to stimulate a stronger IFN alpha response in porcine alveolar macrophage cells in comparison to a reference 89-46448-40 virus.
(34) The virus may comprise a genome that encodes a protein, which may be NSP2, E, GP3, or GP4, which may comprise a sequence shown in
(35) The NSP2 protein may comprise the sequence of SEQ ID NO: 4, which may represent amino acids 63-72 of the NSP2 protein, or a variant thereof. With reference to positions in SEQ ID NO: 4, the NSP2 protein may comprise a valine at position 5 (which may be 67V in the NSP2 protein). The NSP 2 protein may also comprise the sequence of SEQ ID NO: 6, which may represent amino acids 334-343 of full-length NSP2 protein, or a variant thereof. With reference to positions in SEQ ID NO: 6, the NSP2 protein may comprise a histidine at position 5 (which may be 338H in the NSP2 protein). The NSP2 protein may comprise the sequence of SEQ ID NO: 8, which may represent amino acids 488-497 of full-length NSP2 protein, or a variant thereof. With reference to positions in SEQ ID NO: 8, the NSP2 protein may comprise a proline at position 3 (which may be 490P in the NSP2 protein), and may comprise a leucine at position 8 (which may be 495L in the NSP2 protein). The sequence of the NSP2 protein may also comprise one or more of SEQ ID NOs: 5, 7, 9, and 10.
(36) The E protein may comprise the sequence of SEQ ID NO: 25, or a variant thereof. With reference to positions in SEQ ID NO: 25, the E protein may comprise a valine at position 31 (31V), and may comprise an alanine at position 60 (60A). The sequence of the E protein may comprise SEQ ID NO: 26. The sequence of the E protein may also comprise SEQ ID NO: 11 or 12 at positions 27-36 with reference to positions in SEQ ID NO: 25, and may also comprise SEQ ID NO: 13 or 14 at positions 56-65, with reference to positions in SEQ ID NO: 25.
(37) The GP3 protein may comprise the sequence of SEQ ID NO: 21, or a variant thereof. With reference to positions in SEQ ID NO: 21, the GP3 protein may comprise a valine at position 94 (94V), may comprise a serine at position 96 (96S), and may comprise a phenylalanine at position 213 (213F). The sequence of the GP3 protein may comprise SEQ ID NO: 22. The sequence of the GP3 protein may also comprise SEQ ID NO: 15 or 16 at positions 90-99, with reference to positions in SEQ ID NO: 21, and may also comprise SEQ ID NO: 17 or 18 at positions 209-218, with reference to positions in SEQ ID NO: 21.
(38) The GP4 protein may comprise the sequence of SEQ ID NO: 23, or a variant thereof. With reference to positions in SEQ ID NO: 23, the GP4 protein may comprise a serine at position 32 (32S). The sequence of the GP4 protein may comprise SEQ ID NO: 24. The sequence of the GP4 protein may comprise SEQ ID NO: 19 or 20 at positions 28-37, with reference to positions in SEQ ID NO: 23.
(39) The genome of the virus may encode an E protein comprising V31 and 60A, and a GP3 protein comprising 94V. The genome of the virus may also encode a NSP2 protein comprising 495L, and a GP3 protein comprising 94V. The genome of the virus may encode a NSP2 protein comprising 338H and 495L, a GP3 protein comprising 94V and 213F, and a GP4 protein comprising 32S.
(40) The genome of the virus may comprise the sequence of a G16X, 794A61, or 111698 viral genome. The G16X virus may be a viral strain deposited under the Budapest Treaty on Oct. 22, 2013, with the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, Va. 20110 USA, under the accession number PTA-120658 designated by the depository and with depositor Identification Reference PRRSV Virus G16X. The sequence of the G16X, 794A61, and 111698 virus genome may respectively be SEQ ID NO: 1, 2, and 3, or the RNA equivalent thereof. SEQ ID NOs: 1-3 lack the first 31 nucleotides at the 5 terminus of the G16X, 794A61, and 111698 viral genomes. The genome of the virus may also be a variant of a sequence disclosed herein. The genomic variant may be at least 40, 50, 55, 60, 65, 70, 75, 76, 77, 78, 79, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7, 99.8, 99.9 or 100% identical to SEQ ID NO: 1, 2, or 3. The virus may also comprise a RNA equivalent of a PRRS virus genomic sequence described herein (i.e., an RNA that is 100% complementary to a DNA that is 100% complementary to a reference DNA sequence).
(41) The % identity of a genomic sequence to another of interest may be determined by methods known in the art. For example, the % identity of the sequence may be determined by GAP (Needleman and Wunsch, 1970) analysis (GCG program) with a gap creation penalty=5, and a gap extension penalty=0.3. The query sequence may be at least 150 nucleotides in length, and the GAP analysis may align the two sequences over a region of at least 150 nucleotides. The query sequence may be at least 300 nucleotides in length and the GAP analysis may align the two sequences over a region of at least 300 nucleotides. The GAP analysis may align the two sequences over their entire length.
(42) The variant may also comprise one or more mutations relative to a G16X, 794A61, or 111698 viral genome, which may be a deletion, insertion, or substitution thereof. The variant may allow the virus to provide an effective immune response in a mammal when administered thereto, and may allow the virus not to cause disease in the mammal. The mutation in the variant may be naturally occurring (i.e., may be isolated from a natural source), or may be synthetic (may be created by site-directed mutagenesis). The mutation in the variant may be introduced by any means known in the art.
(43) The variant may hybridize to the G16X, 794A61, or 111698 genome under stringent conditions. The term stringent hybridization conditions and the like as used herein refers to parameters with which the art is familiar, including the variation of the hybridization temperature with length of an oligonucleotide. For example, stringent hybridization conditions, as used herein, can refer to hybridization at 65 C. in hybridization buffer (3.5SSC, 0.02% Ficoll, 0.02% polyvinyl pyrrolidone, 0.02% Bovine Serum Albumin (BSA), 2.5 mM NaH.sub.2PO.sub.4 (pH7), 0.5% SDS, 2 mM EDTA), followed by one or more washes in 0.2.SSC, 0.01% BSA at 50 C. Alternatively, the nucleic acid and/or oligonucleotides (which may also be referred to as primers or probes or siRNA molecules or antisense molecules) hybridize to the region of a genome of interest, under conditions used in nucleic acid amplification techniques such as PCR.
(44) b. Compositions
(45) Also provided herein is a composition comprising the virus, or an immunogenic (antigenic) component thereof. The composition may be a vaccine. The vaccine may be capable of stimulating an immune response in a mammal. The virus may also reduce the severity of PRRS virus infection and its sequelae or symptoms in a mammal, and may prevent infection of a mammal by PRRS virus. The composition may comprise a carrier, which may be pharmaceutically acceptable, and may also comprise an immunologically acceptable adjuvant. The carrier and adjuvant may be acceptable for veterinary use, such as in swine. The composition may also comprise at least one immunostimulatory molecule.
(46) (1) Adjuvants
(47) The adjuvant may be a molecule capable of enhancing an immune system response to a vaccine, and may not substantially inhibit the immune response. Examples of adjuvants are found in Vaccine design: the subunit and adjuvant approach, Michael F. Powell and Mark J. Newman, eds., Pharmaceutical Biotechnology v. 6, Plenum Press 1995, New York, see e.g., chapter 7 A compendium of Vaccine Adjuvants and Excipients by Frederick R. Vogel and Michael F. Powell and chapter 29, Cytokine-containing liposomes as adjuvants for subunit vaccines by Lachman et al., the contents of which are hereby incorporated by reference.
(48) The adjuvant may be an interferon, which may be interferon , interferon , or a nucleic acid encoding interferon , which may be expressed in a pig cell. The adjuvant may also be poly IC, poly ICLC, or a material that induces or enhances the activity of at least one of interferon or . The interferon may be an interferon protein, such as an interferon protein, or may be a nucleic acid capable of expressing an interferon, such as an interferon . Interferon generated by expression from the exogenously administered nucleic acid sequence may function alone or in combination with interferon generated by expression from endogenous nucleic acid sequences native to a mammal, to enhance immune response to a vaccine that is administered to the mammal. The interferon may directly or indirectly facilitate immune enhancement; for example, the interferon expressed from exogenously administered nucleic acid may induce or activate one or more intermediate species which in turn may facilitate immune enhancement.
(49) The adjuvant may be present at a level sufficient to enhance an immune response to a vaccine administered to a mammal. Enhancement of immune response by the adjuvant may be measured as any significant increase, which may be statistically significant, in immune response compared to control response in the absence of the adjuvant as evaluated by any method accepted in the art. The adjuvant may comprise other ingredients as known in the art to facilitate delivery of an expressible nucleic acid to a cell or tissue for expression or facilitate delivery of the interferon inducer or enhancer to an appropriate cell or tissue. Dosage levels of the adjuvant may be determined by well-known methods.
(50) The adjuvant may comprise both a nucleic acid capable of expressing an interferon and an immunostimulatory material that can induce or enhance the activity of an interferon. The combined amounts of the nucleic acid and the interferon inducer or enhancer may be sufficient to result in a measurable enhancement of immune response to a vaccine.
(51) The adjuvant may comprise an expressible nucleic acid encoding an interferon , a material which induces or enhances the activity of interferon , or both. The material which induces or enhance activity of interferon may be poly IC or poly ICLC. The quantity of polyIC or polyICLC may be in a range of 1 to 200 micrograms per kg of body weight. The adjuvant may also comprise an immunostimulatory sequence (ISS) or cytokine-encoding nucleic acid. The adjuvant may also be a cytokine, alum (aluminum hydroxide), aluminum phosphate, or calcium phosphate. The cytokine may be IL-2, IL-12, or a cytokine-containing liposome.
(52) The adjuvant may comprise a mammalian expression vector containing porcine IFN alpha cDNA, which may be prepared by RT-PCR using RNA isolated from pig lymphocytes previously infected with pseudorabies virus (to stimulate IFN alpha production). Primers for performing the RT-PCR may be designed based on the nucleotide sequence of porcine IFN alpha cDNA (as described in Lefevre and La Bonnardiere 1986, the contents of which are incorporated herein by reference). Products of the anticipated size (590 bp) resulting from the RT-PCR may be cloned into the pCR2.1 plasmid (Invitrogen Corp., Rockville, Md.), and an insert having the predicted restriction enzyme sites may be sequenced. The IFN alpha cDNA may be excised from the recombinant pCR2.1 plasmid and placed under the transcriptional regulation of the cytomegalovirus promoter in pcDNA3 (Invitrogen) to generate pINA3. To verify that an active cytokine is encoded by the amplified cDNA, Chinese hamster ovary (CHO) cells may be transfected with pINA3 and single cell clones resistant to geneticin may be prepared. Supernatants from the clones may be tested for the ability to inhibit the replication of an interferon-inducer negative strain of vesicular stomatitis virus in Madin Derby bovine kidney (MDBK) cells. Clones producing from 0 to greater than 200,000 units (1 unit inhibits 50% of VSV replication) of IFN alpha may be detected.
(53) The adjuvant may also comprise the chemical compound, polyICLC. The adjuvant may also comprise the following chemicals: Poly-L-Lysine, poly IC, and carboxymethylcellulose, low viscosity. Poly IC (500 mL; 4.0 mg/mL); poly-L-lysine (250 mL; 6.0 mg/mL); and 2% carboxymethylcellulose (250 mL) may be prepared in pyrogen-free 0.85% NaCl. Poly ICLC (stabilized polynucleotide) may be prepared following the method of Levy, Baer et al. (1975), the contents of which are incorporated herein by reference, with minor modifications. Poly I:C may be re-annealed by heating at 71 C. for 1 hour and cooling slowly. Annealed poly I:C may then be mixed with equal volumes of 6.0 mg/mL poly-L-lysine in normal saline and 2% carboxymethylcellulose. The final concentration of poly I:C may 1 mg/mL. This preparation may be stored at 4 C. until needed.
(54) (2) Immunostimulatory Material
(55) The composition may also comprise an immunostimulatory material that induces or enhances the activity of interferon, such as an interferon . The immunostimulatory material may function to induce or enhance the activity of interferon generated from exogenously administered expressible nucleic acid or that generated from endogenous nucleic acids native to a mammal. The immunostimulatory material may function directly to induce or enhance interferon activity or indirectly by induction or enhancement of the activity or expression of an intermediate species. The immunostimulatory material may function to induce or enhance expression levels of an interferon or may otherwise enhance or activate interferon for enhancement of immune response. The immunostimulatory material may be interferon , interleukin 12 (IL-12), IL-18, or IL-15.
(56) (3) Carriers
(57) The carrier may comprise saline or another suitable carrier known in the art. The carrier may be as described in Amon, R (Ed.), Synthetic Vaccines 1:83-92, CRC Press, Inc., Boca Raton Fla. (1987), the contents of which are incorporated herein by reference. The carrier may enable the compositions to be formulated as a tablet, pill, capsule, liquid, gel, syrup, slurry, suspension, or the like, which may be appropriate for oral ingestion. The carrier may also comprise an additional adjuvant, in which case it can be selected by standard criteria based on the antigen used, the mode of administration and the subject. The carrier may comprise an excipient or auxiliary that facilitates processing of the composition into a preparation that can be used pharmaceutically.
(58) (4) Dose
(59) The composition may comprise a dose of viral particles of the virus, which may be from 10.sup.2 to 10.sup.10, 10.sup.2 to 10.sup.9, 10.sup.2 to 10.sup.8, 10.sup.2 to 10.sup.7, 10.sup.2 to 10.sup.6, 10.sup.2 to 10.sup.5, 10.sup.2 to 10.sup.4, 10.sup.3 to 10.sup.10, 10.sup.3 to 10.sup.9, 10.sup.3 to 10.sup.8, 10.sup.3 to 10.sup.7, 10.sup.3 to 10.sup.6, 10.sup.3 to 10.sup.5, 10.sup.4 to 10.sup.10, 10.sup.4 to 10.sup.9, 10.sup.4 to 10.sup.8, 10.sup.4 to 10.sup.7, 10.sup.4 to 10.sup.6, or 10.sup.5 to 10.sup.10, 10.sup.5 to 10.sup.9, 10.sup.5 to 10.sup.8, or 10.sup.5 to 10.sup.7 virus particles.
(60) (5) Formulation
(61) The composition may comprise a cationic liposome, an anionic liposome, a cochleate, or a microcapsules. The liposome or cochleate may enhance in vivo transfection of the virus. The liposome may be a spherical lipid bilayer with an aqueous interior. All molecules present in an aqueous solution at the time of liposome formation may be incorporated into the aqueous interior. The liposomal contents may be both protected from the external microenvironment and, because liposomes fuse with cell membranes, efficiently delivered into the cell cytoplasm. Additionally, due to their hydrophobicity, certain small organic molecules may be directly administered intracellularly. The composition may also comprise another medicinal agent, a pharmaceutical agent, or a diluent.
(62) The composition may be formulated as an aqueous solution, a liquid solution or suspension, a solid form suitable for solution or suspension into a liquid prior to injection, or as an emulsion. For injection, the composition may be formulated in an aqueous solution, which may be in a physiologically compatible buffer such as Hanks' solution, Ringer's solution, or physiological saline buffer. For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art. The composition may be formulated with a cationic lipid or liposome. The composition formulated for oral administration may be in the form of a tablet, dragee, capsule, or solution, and may be formulated for delayed release or only to be released when the pharmaceutical reaches the small or large intestine.
(63) The composition for parenteral administration may be formulated as an aqueous solution in water-soluble form. The suspension may be prepared as an oily injection suspension. The suspension may comprise a suitable lipophilic solvent or vehicle, which may be a fatty oil such as sesame oil, or a synthetic fatty acid ester, such as ethyl oleate or a triglyceride, or a liposome. The suspension for aqueous injection may contain a substance that increases the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. The suspension may also contain a suitable stabilizer or agent which increases the solubility of the composition to allow for the preparation of a highly concentrated solution.
(64) The composition for oral use may be obtained by combining the active compounds with a solid excipient. Obtaining the composition may further comprise grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, to obtain tablets or dragee cores. The solid excipient may be a filler such as a sugar, including lactose, sucrose, mannitol, or sorbitol; a cellulose preparation such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, or polyvinylpyrrolidone (PVP). The composition may also comprise a disintegrating agent, which may be a cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
(65) The composition may be a dragee core, which may have a suitable coating. The coating may comprise a concentrated sugar solution, and may comprise gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, titanium dioxide, a lacquer solution, or a suitable organic solvent or solvent mixture. A tablet or dragee may comprise a coating comprising a dyestuff or pigment, which may be used for identification or to characterize different combinations of active compound doses.
(66) The composition may be formulated for oral administration as a push-fit capsule comprising gelatin, or may be formulated as a sealed capsule comprising gelatin or a plasticizer, such as glycerol or sorbitol. The push-fit capsule may comprise the composition in admixture with a filler such as lactose, a binder such as starches, or a lubricant such as talc or magnesium stearate, or a stabilizer. The composition for oral administration may be formulated as a soft capsule, and the composition may be dissolved or suspended in a suitable liquid, such as a fatty oil, liquid paraffin, or liquid polyethylene glycol. The soft capsule may also comprise a stabilizer.
(67) In the case of a composition comprising a DNA vaccine, the composition may comprise DNA incorporated in a liposome or cochleate to enhance in vivo transfection. The composition may comprise a genetic adjuvant, which may be an immunostimulatory sequence (ISS) or a cytokine-encoding nucleic acid. The genetic adjuvant may be as described in Homer A. A. et al., 1998, Immunostimulatory DNA is a potent mucosal adjuvant, Cell Immunology, 190:77-82, the contents of which are incorporated herein by reference.
(68) (6) Method of Making
(69) The composition may be manufactured in a manner that is itself known, such as by means of conventional mixing, dissolving, granulating, dragee-making, levitating, emulsifying, encapsulating, entrapping or lyophilizing processes.
3. METHOD OF GENERATING AN IMMUNE RESPONSE
(70) Provided herein is a method of generating or inducing an immune response in a mammal, which may be a swine. The method may comprise administering the composition comprising the virus to a mammal in need thereof. The method may also comprise administering an immunogenic composition, which may be a booster, and may comprise administering an adjuvant as described herein. The composition may provide protective immunity to the mammal against a PRRS virus. The composition may also result in greater weight gain and less viremia in the mammal in comparison to a mammal in which the composition was not administered. The composition may induce immunity in the mammal, which may help achieve fewer abortions and/or normal farrowing, or reduce the severity of respiratory disease and mortality in the mammal, in comparison to a mammal to which the composition is not administered.
(71) a. Mode of Administration
(72) The composition comprising the virus may be administered by any effective route, which may be systemic or local. The administration may be parenteral, intramuscular, intradermal, subcutaneous, oral, mucosal, sublingual, intraocular, intranasal, intravenous, intraperitoneal, intramedullary, topical, or transdermal. The administration may also be rectal, vaginal, or intestinal. The administration may be by injection, which may be done using a needle and syringe. The administration may also be via electroporation, cationic microparticle, ultrasonic distribution, or via a biolistic particle.
(73) The administration may also be based on a formulation of the composition with cationic a lipid or liposome, which may be applicable to either the DNA form or protein form of a cytokine adjuvant or to a chemical such as one capable of immune stimulation, for example by induction of an endogenous cytokine. Examples of such administration are described in Pachuk et al., 2000, Curr Opin Mol Ther April 2(2):188-98; Van Slooten et al. 2001, Biochim Biophys Acta 1530:134-45; Van Slooten et al., 2000, Pharm Res 17:42-48; Lachman et al., 1996, Eur Cytokine Netw 7:693-8, the contents of which are incorporated herein by reference.
(74) The adjuvant may be included in the composition comprising the virus. The adjuvant also may be administered simultaneously with the composition comprising the virus or within 1, 2, 4, 8, 12, 18, or 24 hours thereof.
(75) b. Timing of Administration
(76) The composition may be administered to the mammal when the mammal is from about 2 weeks to about 30 weeks of age, or when the mammal is an adult. The composition may also be administered a second time about 2 to about 5 weeks after a first administration, and may also be administered an additional number of times. The composition may be administered to a breeding male or female, and may be administered prior to breeding or after farrowing.
(77) The exact formulation, route of administration and dosage for generating the immune response may be chosen by the individual clinician or in view of the patient's condition, such as described in Fingl et. al., in The Pharmacological Basis of Therapeutics, 1975, Ch. 1 p. 1, the contents of which are incorporated herein by reference. The attending veterinarian or physician would know how to and when to terminate, interrupt, or adjust administration due to toxicity, or to organ dysfunctions, or other negative effects. Conversely, the attending practitioner would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity). The magnitude of an administered dose in the management of the disorder of interest may vary with the severity of the condition to be treated and to the route of administration. The severity of the condition may, for example, be evaluated, in part, by standard prognostic evaluation methods. Further, the dose and perhaps dose frequency, may also vary according to the age, body weight, and response of the individual patient. A program comparable to that discussed above also may be used in veterinary medicine.
(78) The present invention has multiple aspects, illustrated by the following non-limiting examples.
Example 1
PRRS Vaccine Components
(79) Example 1. This example shows specific examples of a vaccine described herein. In particular, the example describes three isolated and purified, nearly isogenic porcine reproductive and respiratory syndrome (PRRS) viruses, termed 794A61, 111698 and G16X, each of which was derived from stocks of the ancient North American PRRS virus isolate 89-46448-40, which naturally exhibits negligible virulence. The originating 89-46448-40 virus stocks comprised a mixed population of genetically related PRRS virus variants, from which the three strains were purified to homogeneity using either standard plaque assays or end-point dilution. Genomic sequence analysis of these three strains revealed that they differ from the viral genotypes present in the 89-46448-40 virus stocks by several synonymous and non-synonymous point mutations. The latter type of nucleotide mutations resulted in three of the structural and one of the non-structural viral proteins having novel amino acid changes that are not present in the parental virus population. The three isolated strains also differed biologically from the parental virus 89-46448-40 in their ability to stimulate a considerable interferon alpha response by virus-infected, porcine alveolar macrophages. In addition, unlike the parental 89-46448-40, the G16X strain did not inhibit synthesis of interferon alpha by porcine alveolar macrophages exposed to poly(I:C), but rather enhanced their response to this activating molecule. Remarkably, even though these three strains are nearly isogenic, they differed significantly from each other in regards to their vaccine potential, as demonstrated by the extent of their vaccine efficacies (poor, 794A61; moderate, 111698 and good, G16X) in providing protection upon subsequent challenge with a genetically dissimilar (heterologous) PRRS virus isolate. One vaccine isolate (G16X) distinguished itself from the other two strains (794A61 and 111698) by excelling in its ability to afford immunized pigs greater protection, as evidenced by a more rapid reduction and/or elimination of the virulent challenge virus from tissues.
(80) The three PRRSV strains (G16X, 794A61 and 111698) were derived by either plaque purification (794A61 and G16X) or by end-point dilution (111698) from a low passage stock of the PRRS virus 89-46448-40. The 89-46448-40 virus was isolated at the National Veterinary Services Laboratory (NVSL) in Ames, Iowa, from specimens from animals submitted as a diagnostic case (designated 89-46448) from an Iowa farm which experienced a PRRS outbreak in 1989 (Wesley et al, 1998). Notably, the 89-46448 case represents one of the oldest publicly recorded outbreaks of PRRS from which PRRS virus was retrieved (Wesley et al., 1998). Accordingly, the 89-46448-40 virus likely represents one of the most temporally ancient PRRS virus isolated in the US. Virus isolation at NVSL was accomplished by overlaying monolayers of the MA-104 African green monkey cell line with clarified suspensions of macerated tissues prepared from infected animals. Virus isolation was indicated by the development of a cytopathic effect within 6-8 days after inoculation of the cell cultures as described by Kim et al. (1993, Enhanced replication of porcine reproductive and respiratory syndrome (PRRS) virus in a homogeneous subpopulation of MA-104 cell line, Arch. Virol. 133, 477-83). Culture fluids were harvested at 10 days after inoculation and stored at 70 C. Subsequent passages of the 89-46448-40 virus isolate in MA-104 cells were performed at NVSL using methods described by Kim et al. (1993). Between late 1992 and early 1993, aliquots of several PRRS virus isolates, including the 89-46448-40 isolate, were distributed as reference PRRS viruses by NVSL to several veterinary diagnostic laboratories (VDL) in the US. The VDL at the University of Illinois (Urbana, Ill.) received a vial containing about 1 mL of culture medium collected from the second passage in MA-104 cells of the 89-46448-40 isolate (89-46448-40 MA104/2) from the specimen from which it was isolated. At the University of Illinois VDL, the MARC-145 cell line, a PRRS virus-permissive cell clone originating from MA-104 cells, was used as the host to prepare 89-46448-40 virus stocks from the 89-46448-40 MA104/2 aliquot. The virus was propagated using methods known in the art, and monolayers of MARC-145 cells grown in 75 cm.sup.2 tissue culture flasks containing Eagle's Minimal Essential Medium (MEM) with pH adjusted to 7.2, to which 5% fetal calf serum, 0.15% sodium bicarbonate and antibiotics had been added (complete MEM) were used. The flasks containing the MARC-145 cells and 10 mL culture medium were incubated at 37 C. in an atmosphere of 5% CO.sub.2 for several days until a confluent cell monolayer was established. At this point the cell monolayers were inoculated with 1 mL of diluted virus suspension and incubated for 1 h at 37 C. to allow virus absorption. The inoculum was then removed and 10 mL of fresh complete MEM added. The cell cultures were then incubated at 37 C. in an atmosphere of 5% CO.sub.2 until a cytopathic effect, which occurred within 4 days, was observed. Once >75% of the cells in the monolayers exhibited a cytopathic effect, the contents of the flasks were harvested, combined into a single pool, divided into 1-2 mL aliquots in sterile glass vials and stored at 80 C. until needed. Titers of the virus stocks were determined by using standard techniques and MARC-145 cells (see Material and Methods, Example 1). For instance, the stock prepared in July, 1994 (794 stock) had a titer of 10.sup.7.4 TCID.sub.50 and corresponded to the second passage of the PRRS virus isolate 89-46448-40 in MARC-145 cells at the University of Illinois VDL, i.e., the fourth overall passage of this virus in cultured cells, including its isolation in MA-104 cells.
(81) Both the 111698 and the 794A61 virus strains were isolated directly from the 794 stock PRRS virus. To produce the 111698 virus, 1.0 mL of a 3000-fold dilution (MOI=0.001) of the 794 stock was used as inoculum to infect a monolayer of MARC-145 cells in a 75 cm2 tissue culture flask (in triplicate). After 4 days at 37 C. in a humidified 5% CO.sub.2 atmosphere, at which time >75% of each of the three monolayers exhibited a cytopathic effect, the contents of the flasks were collected. The combined harvests were centrifuged at 2000 rpm for 10 min at 4 C. to remove cell debris and the supernatant, designated as 111698 virus, divided into aliquots and stored at 80 C. In contrast, the 794A61 virus was the product of a six-fold plaque-purification of the 794 stock. Initially, monolayers of MARC-145 cells in 35-mm diameter tissue culture dishes were overlaid with sequential 10-fold dilutions of the 794 stock in MEM, pH 7.2, supplemented with 10% fetal calf serum and 50 g/mL gentamicin. After rocking at 1 h at ambient temperature, the inocula were removed, and the monolayers overlaid with 3 mL of a 1:1 mixture of 2X MEM supplemented with 6% fetal calf serum, 100 g/mL gentamicin and 2% low-melting-point agarose. After 30 min at ambient temperature (to allow the agarose to harden), the plates were left at 37 C. and in a humidified 5% CO.sub.2 atmosphere for 4 days. At this time to enhance visualization of the plaques, 100 l of 100 mg/mL Thiazolyl Blue Tetrazolium bromide (Methylthiazolyldiphenyl-tetrazolium bromide, MTT) was placed on top of each agarose overlay and the cells were returned to a 37 C. and humidified 5% CO.sub.2 atmosphere environment for 2-3 h before the plaques appeared as clear areas with darkened perimeters. Several well-isolated plaques in those monolayers successfully infected with the greatest dilution of inoculum were picked by using a Pasteur pipet and transferred into vials containing 0.5 mL of MEM supplemented with 10% fetal calf serum and 50 g/mL gentamicin. One of the selected plaques was subjected to two cycles of freezing at 80 C. before use as inoculum. This process of plaque-purification was repeated an additional five times with a plaque picked after the sixth round being designated 794A61. After being subjected to two cycles of freezing at 80 C., 0.1 mL of the 794A61 preparation was used to infect a 35-mm diameter tissue culture plate as described above. However, in this case, the monolayer was overlaid with 3 mL MEM supplemented with 3% fetal calf serum and 50 g/mL gentamicin. After 3 days in a 37 C. and humidified 5% CO.sub.2 atmosphere environment, approximately 20% of the infected monolayer exhibited a cytopathic effect. At this time, the medium was collected, centrifuged at 2000 rpm for 10 min at 4 C. to remove cell debris and the supernatant, designated as 794A61 P1 virus, was stored at 80 C. An additional passaging of this virus in monolayers of MARC-145 cells in 75 cm.sup.2 tissue culture flasks as described above at an MOI=0.01 was performed to produce the 794A61 P2 virus.
(82) Isolation of the G16X virus proceeded indirectly from the 794 stock virus, in that the inoculum source was the sequential passage of the 794 stock virus in monolayers of MARC-145 cells in 75 cm.sup.2 flasks. In this case, each monolayer had been infected with 1 mL of undiluted 794 stock (MOI=1). After 3 days at 37 C. in a humidified 5% CO.sub.2 atmosphere, at which time, >90% of each of the three monolayers exhibited a cytopathic effect, the contents of the flasks were collected. The combined harvests were centrifuged at 2000 rpm for 10 min at 4 C. to remove cell debris and the supernatant, designated as VR virus, divided into aliquots and stored at 80 C. This VR virus preparation was subjected to a five-fold plaque-purification as described above, except that at 4-5 days post-infection, the individual plaques were identified as opaque areas against a relatively clear, uninfected cell monolayer background. An isolated plaque from the fifth plaque-purification was passaged in a 35-mm diameter tissue culture dish under the conditions described above, as were the progeny from this infection and four subsequent infections of MARC-145 cells at various MOI in either 25- or 75 cm.sup.2 tissue culture flasks. Supernatant medium from this 5th unselected passage of virus served as the initial inoculum for an additional six rounds of plaque-purification that utilized MTT for plaque visualization as described above. A well-isolated plaque picked after the sixth round was designated G16X and was propagated initially in a monolayer of MARC-145 cells in a 35-mm diameter tissue culture plate (G16X P1) and then twice sequentially in cm.sup.2 flasks (G16X P2 and G16X P3) as described above for the production of the 794A61 virus.
(83) It has been documented that the level of pathogenicity among PRRS virus isolates can vary considerably. Moreover, it has become evident that in the 25 years after the initial North American outbreaks of PRRS in 1987-1988, the virulence level of PRRS virus in the U.S. and other parts of the world has increased to an alarming intensity. The first noticeable upsurge in PRRS virus virulence occurred in 1996 when swine veterinarians and diagnosticians began to report disease outbreaks described as swine abortion and mortality syndrome, atypical PPRS, or acute PRRS. This was confirmed in experimental studies, which showed not only that strains circulating in US swine-herds at the beginning of the PRRS epidemic in the late 1980's were less virulent than those that appeared in the summer of 1996 but that the latter were causing PRRS outbreaks of a higher severity. But, even in the early 1990s, varying disease severity in PRRS outbreaks was apparent. While mainly <10 week-old pigs were afflicted with a respiratory illness that ranged in intensity from mild to severe in the absence of reproductive failure, outbreaks of severe respiratory disease in older pigs and reproductive failure manifested, mostly by late term abortions in pregnant females, were also observed. In an attempt to discern distinguish levels of PRRS virus virulence, a concrete measurement of respiratory pathogenicity was developed. It involved scoring the percentage of the lungs affected with grossly visible pneumonia resulting from experimental infection of young swine with one of 9 different isolates of PRRS viruses reported exhibit different levels of virulence. This method enabled the categorization of PRRS viruses acquired in 1993 or earlier into high and low virulence isolates. Incongruent results, however, were obtained with this method of scoring and a different disease characteristic was used to assess virulence. In that case, the virulence levels of two isolates, previously categorized as either being high (VR-2385) or low (VR-2431), based on the gross pathology of the lungs of infected pigs, were shown be similar when evaluated in terms of the viruses' ability to induce late term reproductive failure.
(84) A more reliable and more commonly used parameter to determine PRRS virus virulence is monitoring the amount of infectious virus in the blood stream (viremia) of infected pigs. For instance, inoculation of young swine with PRRS virus isolates classified as exhibiting either moderate or high levels of virulence reproducibly generate high levels of viremia that occur within 3 days after virus inoculation and can extend for more than 28 days. In contrast, administration of equivalent doses of attenuated (vaccine) PRRS virus strains that were derived from virulent strains by serial passage in simian cells produce significantly lower levels of viremia, although of similar (>28 days) duration. Notably, viremia resulting from infection with PRRS virus is negatively related to pig growth and positively associated with the severity of clinical disease. Lack of appetite is also a hallmark of PRRS virus infection and in young and fast growing pigs negatively impacts their rate of weight gain and feed efficiency. Likewise, infections with either moderately or highly virulent PRRS virus isolates strongly decrease the rate of weight-gain of grower pigs. On the other hand inoculation of swine with attenuated PRRS virus strains reduce pig growth minimally or not at all. Thus, while virulent PRRS viruses significantly inhibit the rate of growth of young pigs and generate a strong viremia, PRRS virus strains that have been made non-virulent (attenuated) by serial passage in cell culture do not affect the growth of young pigs and produce a comparatively weaker viremia.
Example 2
Isolation of PRRS Viruses
(85) Example 2. This example demonstrates isolation of mutant PRRS viruses. The PRRS virus isolate 89-46448-40 naturally exhibits a negligible level of virulence, which is akin to, if not lower than, the level of virulence that has been described for attenuated strains of PRRS virus that were generated by serial passage in vitro. The level of virulence possessed by the PRRS virus isolate 89-46448-40 was determined by assessing parameters which have been used previously to determine PRRS virus virulence, including the weight gain of virus-infected pigs, the magnitude and length of viremia in virus-infected pigs, and the gross pathology of the lungs of virus-infected pigs. The results obtained for measurements of all of these parameters support the conclusion that the virulence of the 89-46448-40 isolate in pigs is negligible.
(86) To ascertain the level of virulence exhibited by the 89-46448-40 virus isolate, groups of 9-10-week-old pigs from a herd nave for PRRS virus were inoculated with either the 89-46448-40 isolate or, as a comparison, with the high virulence atypical PRRS virus isolate NADC-20. Controls consisted of pigs given a mock inoculum. Before virus inoculation and at 4, 7, 10 and 14 days after inoculation, venous blood was collected from the jugular vein of each pig and the extent of viremia was determined quantitatively by measuring the amount of infectious virus present in each animal's serum. Body weights were recorded for all pigs on study days 0, 7 and 14 and the weight change from the day of challenge calculated. The extent of gross pathology of the pigs' lungs was scored at 14 days after inoculation using known methods.
(87) The porcine alveolar macrophage cell line ZMAC (Calzada-Nova et al., 2012), was cultured using 75 cm.sup.2 tissue culture flasks (Corning, Corning, N.Y.) in RPMI-1640 medium with L-glutamine (Mediatec, Herndon, Va.), supplemented with 10% fetal bovine serum (GIBCO, Invitrogen, Grand Island, N.Y.), 1 mM sodium pyruvate (Mediatec) and 1 non-essential amino acids (Mediatec), and maintained at 37 C. in a 5% CO.sub.2 atmosphere. Since porcine alveolar macrophages are the natural host cell for this virus, ZMAC cells are fully permissive to wild-type PRRS virus. Thus, this cell line was used to perform titration of PRRS virus from clinical (serum) samples and to prepare virus stocks for animal inoculation. The ZMAC cell line is free of adventitious agents including bovine viral diarrhea, porcine circovirus, mycoplasma, PRRS virus, porcine parvovirus and porcine adenovirus.
(88) The acute PRRS virus isolate NADC-20 was passaged once in ZMAC cells directly from the serum of a diseased animal in order to create a stock of virus for animal inoculation. NADC-20 has been shown to produce significant respiratory disease in young pigs with total gross lung lesion scores ranging from 30-45% as well causing a substantial viremia of similar magnitude to that observed for other virulent PRRS virus isolates. The inoculum for the 89-46448-40 virus was prepared from the 7th passage in ZMAC cells starting from an original vial of 89-46448-40 virus prepared by NVSL (89-46448-40 MA104/2). The virus in the vial received from NVSL represented the second passage of the 89-46448-40 virus in MA-104 cells from a specimen of case 89-46448. For animal inoculation the viruses were diluted in a phosphate buffered solution (Mediatech) supplemented with 0.05% neonatal porcine serum (diluent) to obtain a virus titer of 10.sup.4 TCID.sub.50/mL. The mock inoculum consisted of the diluent alone. The expected titer of infectious virus in those inocula prepared from either the 89-46448-40 or NADC-20 virus stock was verified afterwards by titration (TCID.sub.50) in ZMAC cells.
(89) Determination of infectious virus titer as determined as follows. Each virus inoculum was serially diluted ten-fold to a final dilution of 10.sup.5 to 10.sup.8, depending on the type of sample, in tubes containing 0.9 mL of RPMI-1640 medium (Mediatech) supplemented with 5% fetal bovine serum (Gibco). A 0.1 mL aliquot of each diluted sample being tested was transferred separately to quadruplicate wells that were present in a 96-well tissue culture plate and contained 0.1 mL medium having 3-410.sup.4 ZMAC cells/well. After 96 h of culture at 37 C. in a humid environment with a 5% CO.sub.2 atmosphere, the cells in each well were examined for the presence of a cytopathic effect by using an inverted microscope. Wells were scored as positive for virus infection when >90% of the cells within exhibited apoptosis and/or had lysed. The number of TCID.sub.50 per sample was determined by using the method of Reed and Muench. Similar titrations of virus infectivity were performed on each serum and bronchoalveolar lavage (BAL) fluid sample collected from the individual, virus-infected or nave pigs.
(90) The body weight of each pig was measured by using a scale with a digital readout. The scale was calibrated using calibration weights before and after each use. All pigs were weighed on the first day of the study (immediately before virus infection) and at 7 and 14 days thereafter. The body weight gain attained by the individual pigs at 7 and 14 days after inoculation was calculated relative to their respective body weight on the day of virus exposure. Results are presented as the mean adjusted weight changestandard error of the mean (SEM) for each treatment group.
(91) Bronchoalveolar lavage (BAL) samples were obtained. Fourteen days after virus challenge the animals were euthanized and their lungs removed intact from the thoracic cavity. BAL fluid samples were obtained from each lung by infusing into its right middle lobe sterile Dulbecco's phosphate buffered saline (Mediatech) with a 20 cc plastic syringe connected to a tubing infusion set (Butterfly 19 12 tubing, Abbott Laboratories, Chicago, Ill.) from which the needle was cut. The tubing was inserted into the bronchi leading to the right middle lobe and the two clamped together with a string to avoid leakage. Afterwards, 10 mL of Dulbecco's phosphate buffered solution were slowly propelled into the lobe. After gently massaging the perfused lobe, the fluid was removed by slowly retracting the plunger. Typically half (5 mL) of the infused fluid was easily recovered. The BAL fluid was then transferred to a sterile 15 cc Falcon polypropylene conical tube (Becton Dickinson, Franklin Lakes, N.J.) and kept at 4 C. for no more than 4 h after collection. The BAL fluid was then clarified by centrifugation at 2000 rpm for 10 min, and the resultant fluid split into 1 mL aliquots in sterile RNAase and DNAase & pyrogen free, 1.7 mL Posi-Click Tubes (Denville Scientific) and stored at 80 C. until being tested for virus load.
(92) Scoring of gross lung lesions was carried out as follows. Fourteen days after inoculation all of the animals were euthanized. Their lungs were removed from the thoracic cavity and the extent of gross lesions in this organ evaluated based on the scoring system described by Halbur et al. (1995). Briefly, each lung lobe was assigned a certain amount of points to reflect the approximate volume percentage of the entire lung represented by that lobe. For instance, ten points (five for dorsal and five for ventral aspects) were consigned to the right anterior lobe, right middle lobe, anterior part of the left anterior lobe and caudal part of the left anterior lobe. The accessory lobe was allotted 5 points and 27.5 points (15 for dorsal and 12.5 for ventral aspects) were given to each of the right and left caudal lobes to reach a total of 100 points. Based on examination of each lobe for the presence of macroscopic lung lesions, the extent of pneumonia in each lobe was estimated and that percentage times the respective, assigned lobe points, generated a value that when summed with the values determined for all of the other lobes produced a score indicative of the overall percentage of the entire lung afflicted with grossly visible pneumonia.
(93) Mixed breed pigs (YorkshireLandraceDuroc) from a PRRS-free farm were randomly assigned to isolation cubicles (3-4 pigs/cubicle) at two separate suites (8 cubicles/suite) with separate air handling at the animal bio-containment facility at the University of Illinois (Urbana, Ill.). Animals were fed a corn-based, non-medicated pig phase II diet (University of Illinois Feed Mill, Champaign, Ill.). The pigs were housed in accordance with biomedical level procedures, maintained on 12 h light/dark cycles, and had ad libitum access to water and feed. At 9-10 weeks of age the animals were infected intranasally and intramuscularly with 2 mL (1 mL per route with 10.sup.4 TCID.sub.50/mL) with one of the two viruses (89-46448-40 or NADC-20) or with a mock inoculum (diluent alone). Cross-infection of pigs during the study was avoided by infecting all of the animals in a cubicle with the same type of virus isolate by only having pigs inoculated with one type of virus isolate in each suite. Mock-inoculated animals were kept in cubicles that were in the same suite as those housing the virus-infected animals but were geographically distinct. Strict bio-containment procedures were followed to keep the mock-inoculated pigs free of PRRS virus and avoid cross-contamination between suites. The animals were monitored daily for changes of vitality and signs of respiratory distress for an interval starting on the day of virus introduction and continuing through the next 14 days. Blood samples were collected form the jugular vein using MONOJECT blood collection tubes without additive (Tyco Healthcare Group, Mansfield, Mass.) before and at 4, 7, 10 and 14 days after inoculation. Serum was separated from the clotted blood by centrifugation, harvested and stored frozen at 80 C. in small aliquots in sterile 1.5 mL microcentrifuge tubes until tested. The level of viremia in the pigs was determined by measuring the amount of infectious virus in the prepared serum samples in ZMAC cells as described above. Clinical observations and analyses of serum samples confirmed that cross-contamination of PRRS virus isolates between containment suites and infection of mock-inoculated control pigs with PRRS virus did not occur. Each pig's body weight was determined immediately prior to virus infection and at 7 and 14 days thereafter. Fourteen days after virus exposure, all animals were euthanized and their lungs removed from the thoracic cavity and scored for gross pathology as described above.
(94) Statistical analyses were performed as described. The General Linear Model Univariate procedure and the Fisher's LSD test were applied to assess differences between groups in regards to the extent of viremia (log.sub.10 TCID.sub.50/mL) and gross lung pathology score, which for analysis was also log.sub.10 transformed. Dunnett's t-test (2-sided) was used to compare the pigs' proportion of weight change from the time of virus exposure to 7 and 14 days later to the same parameter measured in the reference (mock-inoculated) group. Statistical analyses were performed using the SAS Software (Cary, N.C.). P-values of <0.01 were considered statistically significant.
(95) Results. Effect of PRRS virus 89-46448-40 or NADC-20 on the weight gain of infected pigs. Grower pigs were infected with either the PRRS virus 89-46448-40 (n=6) or NADC-20 (n=10) isolate or were mock-infected (n=10) and the percent body weight gain of the individual animals at 7 and 14 days thereafter was determined and averaged for members of each group. (
(96) Viremia and virus load in the lungs in pigs infected with PRRS virus isolates 89-46448-40 or NADC-20 was determined. When sampled just prior to inoculation, infectious virus was not detected in the sera of any of the animals, confirming their PRRS virus-free status (
(97) At 14 days post virus inoculation with PRRS virus 89-46448-40 or NADC-20, the lungs of all animals in the study were scored for gross lesions in order to quantify the extent of pneumonia. Individually, all pigs in the mock- or 89-46448-40 virus-inoculated groups were assessed with gross lung lesion scores of <25%. In contrast, 6 of the 10 members of the NADC-20-virus infected group were appraised to have gross lung lesion scores of 25%, including two pigs with scores of >75%. As expected, animals in the mock-inoculated control group had mostly normal lungs with individual scores ranging from 0 to 15% that averaged to a mean group score of 3.52% (
(98) The data in this example demonstrate that the 89-46448-40 PRRS virus isolate naturally exhibits a negligible level of virulence. For instance, pigs inoculated with the 89-46448-40 isolate maintained a growth rate equivalent to that achieved by its mock-treated cohorts. Moreover, the viremia resulting from inoculation of the pigs with the 89-46448-40 virus isolate was of significantly lower magnitude than the viremia observed in cohorts receiving the virulent PRRS virus isolate NADC-20. In addition, the length of viremia and the presence of virus in the lungs following the infection of young pigs with the 89-46448-40 virus isolate was of shorter duration than what has been reported for animals of similar age after infection with either other wild-type or attenuated strains of PRRS virus. Finally, the extent of pneumonia as indicated by the mean gross lung lesion scores was not statistically different when considering the mock-infected and 89-46448-40 virus-inoculated groups. In conclusion, the negligible level of virulence naturally exhibited by the PRRS virus isolate 89-46448-40 is akin to if not lower than what is observed with an attenuated strain of PRRS virus generated by serial passage in vitro.
Example 3
Genomic and Biologic Differences Between the Parental 89-46448-40 Virus and the G16X, 794A61 and 111698 PRRS Virus Strains
(99) Example 3. This example demonstrates that the initial stock of the PRRS virus isolate 89-46448-40 was comprised of a discrete mixture of genetically related viruses. Three PRRS virus strains were derived and purified to homogeneity from the 89-46448-40 virus stock using either standard plaque assays (794A61 and G16X) or end-point dilution (111698). The genomes of the purified 794A61, 111698 and G16X virus strains differ from the virus population present in the initial 89-46448-40 virus stock by several non-synonymous and synonymous nucleotide point mutations. The latter resulted in 2, 3 or 5 amino acid changes, respectively, distributed among structural and non-structural viral proteins of 794A61, G16X and 111698 virus strains, which are not believed to be represented in the translated genomes of the 89-46448-40 parental virus stock. The viral proteins with predicted amino acid sequence changes that differentiate the three derived strains from the viruses in the parental 89-46448-40 stock include the non-structural protein (Nsp)2, the structural protein E and glycoproteins (GP)3 and GP4. See
(100) TABLE-US-00001 TABLE 1 Amino acids among the PRRS virus strains 794A61, 111698 and G16X relating to progenitor virus 89-46448-40. Position and predicted novel Total no. of PRRS amino acid change in the amino acid virus corresponding PRRS virus protein differences from strain NSP2 E GP3 GP4 89-46448-40 794A61 495 (Leu) 94 (Val) 2 111698 338 (His) 94 (Val) 32 (Ser) 5 495 (Leu) 213 (Phe) G16X 31 (Val) 94 (Val) 3 60 (Ala)
(101) As shown in Table 1, the viruses have one or more mutations in a protein including NSP2, E, GP3, and/or GP4, including one or more of the following: for NSP2, 495 Leu, 338 His; for E, 31 Val, 60 Ala; for GP3 94 Val, 213 Phe; for GP4, 32 Ser.
(102) Monolayers of the simian cell line, MARC-145, were prepared in 75 cm.sup.2 tissue culture flasks containing complete MEM that consisted of Eagle's Minimal Essential Medium (MEM) with pH adjusted to 7.2 and supplemented with 5% fetal calf serum, 0.15% sodium bicarbonate and antibiotics. The flasks containing MARC-145 cells and 10 mL culture medium were incubated at 37 C. in an atmosphere of 5% CO.sub.2. The porcine alveolar macrophage cell line ZMAC (ATCC Number PTA-8764), was cultured using Ultra-low adherence 75 cm.sup.2 tissue culture flasks (Corning) in RPMI-1640 medium with L-glutamine (Mediatec, Herndon, Va., USA), supplemented with 10% fetal bovine serum (GIBCO, Invitrogen, Grand Island, N.Y., USA), 1 mM sodium pyruvate (Mediatec) and 1 non-essential amino acids (Mediatec), and maintained at 37 C. in a 5% CO.sub.2 atmosphere. The ZMAC cell line is free of adventitious agents, including bovine viral diarrhea, porcine circovirus, mycoplasma, PRRS virus, porcine parvovirus and porcine adenovirus.
(103) All PRRS virus isolates used in this study were propagated in MARC-145 cell monolayers as described by Kim et al. (1993). For this purpose, confluent monolayers of MARC-145 cells were inoculated with 1 mL of virus suspension and incubated for 1 h at 37 C. to allow virus absorption. The virus inoculum was then removed, and 10 mL of fresh complete MEM added. The cell cultures were then incubated at 37 C. in an atmosphere of 5% CO.sub.2 until cytopathic effects were observed (4 days). Once >75% of the cells in the monolayer exhibited cytopathic effects, the contents of the flask(s) were harvested and either purified or divided into several 1-2 mL aliquots in sterile glass or plastic vials and stored at 80 C. until needed. Purification of the viruses for use in biological assays began with the cell culture medium being first clarified by centrifugation at 2000 rpm and 4 C. for 10 min. The supernatant was then layered on top of a 3 mL solution of TE buffer (10 mM Tris, pH 8.0, 1 mM EDTA) containing 15% sucrose in SW28 rotor tubes (Beckman, Palo Alto, Calif.). The tubes were then centrifuged at 20,000 rpm and 4 C. for 3 h. The virus-containing pellets were then resuspended in 1 mL TE buffer, passed through a 0.2 M syringe filter (Nalgene, Rochester, N.Y.) and stored in aliquots at 80 C. until needed.
(104) The origins of the viruses used in this study have been described herein above. Viruses whose genomes were used for nucleotide sequencing analysis were: the original 89-46448-40 isolate provided by NVSL to the University of Illinois VDL (89-46448-40 MA104/2); the first passage of the six-fold plaque of the 794 stock that was the second passage of 89-46448-40 MA104/2 in MARC-145 cells at the University of Illinois (794A61 P1); an end-point dilution (MOI=0.001) passage of the 794 stock in MARC-145 cells (111698); and the second passage of a plaque derived from two cycles of plaque-purification of the virus obtained during the first subsequent passage of the 794 stock at high MOI (MOI=1.0) in MARC-145 cells (G16X P2). Virus preparations used for evaluating the effect of PRRS virus on interferon alpha production by porcine alveolar macrophages were: i) the third passage of 89-46448-40 MA104/2 in MARC-145 cells (89-46448-40 P3); ii) the third passage of the 794A61 final plaque in MARC-145 cells (794A61 P3); iii) the third passage of 111698 virus in MARC-145 cells (111698 P3); iv) the fifth passage of the G16X final plaque in MARC-145 cells (G16X P5); v) the second passage of the wild-type NADC-20 virus preparation, that was originally passaged directly from the serum of an infected pig into ZMAC cells, and once in MARC-145 cells (NADC-20 P2), and, vi) the third passage of the FL-12 virus starting with a virus preparation derived by the transfection of ZMAC cells with the infectious clone of this virus and then passaged twice in MARC-145 cells (FL-12 P3).
(105) Determination of infectious virus titer was carried out as follows. Virus preparations were serially diluted ten-fold in tubes containing 0.9 mL of complete MEM. A 0.1 mL aliquot of each diluted sample being tested was transferred separately to quadruplicate wells that were present in a 96-well tissue culture plate and contained 0.1 mL medium overlaying a nearly confluent monolayer of MARC-145 cells. After 5 days of culture at 37 C. in a humid environment with a 5% CO.sub.2 atmosphere, the cells in each well were examined for the presence of a cytopathic effect by using an inverted microscope. Wells were scored as positive for virus infection when >90% of the cells within exhibited apoptosis and/or had lysed. The number of TCID.sub.50 per sample was determined using the method of Reed and Muench.
(106) To isolate the PRRS virus genomic RNA, RNA was extracted from samples of PRRS virus stocks 89-46448-40 MA104/2, G16X P2, 794A61 P1, and 111698 (described above) by using a QIAamp viral RNA minikit (Qiagen, Chatsworth, Calif.) according to manufacturer's instructions as described below. 140 l of each sample was combined with 560 l Buffer AVL containing 5.6 l carrier RNA in a 1.5 mL Eppendorf tube, pulse-vortexed for 15 sec, and incubated at ambient temperature for 10 min. 560 l of 100% ethanol was added to each tube and the contents were pulse-vortexed for 15 sec and centrifuged at 6000g for 10 sec. 630 l of each mixture was applied to the top surface of a QIAamp Mini spin column and centrifuged at 8000g for 1 min. The eluant was discarded and the process repeated for the remainder of each mixture. Each column was then sequentially washed with 500 l Buffer AW1 (8000g for 1 min), and 500 l Buffer AW2 (20,000g for 3 min). Afterwards, the dried columns were centrifuged at 20,000g for 1 min before 60 l of Buffer AVE was applied to each column. Following 1 min incubation at ambient temperature, the RNA was eluted into 1.5 mL Eppendorf tubes during a 1 min centrifugation at 6000g. Eluted RNAs were stored at 80 C. until needed.
(107) Reverse transcription (RT) and polymerase chain reaction (PCR) amplifications of PRRS virus genomic RNA were performed as follows. PRRS virus 89-46448-40 MA104/2 and 794A61 P1 RNAs were reverse transcribed in the presence of 50 M random hexamers (Invitrogen, Carlsbad, Calif.), 50 mM Tris (pH 8.3), 75 mM KCl, 3 mM MgCl.sub.2, 10 mM DTT, 0.5 mM each of dATP, dCTP, dGTP, and dTTP and 25 units of mouse murine leukemia virus reverse transcriptase (Promega, Madison, Wis.)/l reaction. The composition of the reaction mixture used for RT of the PRRS virus G16X P2 and 111698 genomes was the same except that the random hexamer primers were replaced with 0.5 M RT REV primer (CAACTGCAGAGCTCATATGCAT) (SEQ ID NO: 30) or other primers whose sequences were complimentary to the virus genomic RNA. After denaturation of the RNAs and primers in either 0.5 mL Eppendorf tubes or 0.2 mL PCR tubes at 70 C. for 10 min and cooling at 4 C. for 2 min, the other components were added. The entire mixtures were either subjected to one cycle of 10 min at 25 C., one cycle of 50 min at 45 C., and one cycle of 15 min at 70 C. (random hexamer primers) or to one cycle of 60 min at 42 C. and one cycle of 15 min at 70 C. The resultant cDNAs were stored at 80 C. until needed.
(108) PCR amplifications of PRRSV cDNAs to obtain amplicons for nucleotide sequencing were performed in 12.5 or 25 l reaction mixtures. Their compositions were identical and consisted of 1 l cDNA (prepared as described above) and 0.25 units IPROOF High-Fidelity DNA polymerase (Bio-Rad Laboratories, Hercules, Calif.) per 12.5 l reaction mixture, 1 IPROOF HF buffer, and 0.2 mM each of dATP, dCTP, dGTP, and dTTP. PCR reaction mixes in 0.2 mL PCR tubes were either maintained at 70 C. in a thermocycler or at 4 C. on ice before the addition of PRRS virus-specific forward and reverse primers to a final concentration of 0.45 mM. In the latter case, samples were then immediately transferred to a thermocycler pre-heated to 70 C. For amplification, samples were subjected to one cycle of denaturation at 98 C. for 30 sec, thirty-seven cycles of denaturation at 98 C. for 10 sec, primer annealing at 56 C. to 58 C. for 30 sec, and product elongation at 72 C. for 1-3 min, and one cycle of 5 min at 72 C. The resultant amplicons were stored at 20 C. until electrophoresed in 0.7% agarose gels. Ethidium bromide-stained bands representing amplicons of the anticipated size were visualized using long wave ultraviolet light (366 nm), excised, purified by using a Zymoclean Gel DNA recovery kit (ZYMO Research, Orange, Calif.) and eluted from Zymo-Spin I columns in 10 l RNAse-free H.sub.2O per sample.
(109) In preparation for nucleotide sequence analysis, a 2.8 l aliquot of each purified amplicon was combined with 5.2 l 12.5% glycerol, 2.0 l 5 sequencing buffer (400 mM Tris, pH 9.0, 10 mM MgCl.sub.2), and 1.0 l BIGDYE Terminator v3.0 or v3.1 Cycle Sequencing RR-24 (Applied Biosystems, Austin, Tex.) in a 0.2 mL PCR tube and maintained at 4 C. Upon addition of an individual sequencing primer to a final concentration of 1.5 mM, each tube was transferred to a thermocycler pre-heated to 70 C. Reactions are then subjected to one cycle of 1 min at 95 C. and 35 cycles of 15 sec at 95 C., 5 sec at 50 C., and 4 min at 60 C. The completed reactions were processed by the University of Illinois at Urbana-Champaign (UIUC) Core DNA Sequencing Facility, and the resulting chromatograms were visually inspected and edited with the SeqEd program (Applied Biosystems).
(110) In order to assess the interferon alpha response of pig alveolar macrophages to PRRS virus, cultures of the porcine alveolar macrophage cell line ZMAC (2.510.sup.5 cells per tube) were prepared in 1275 mm polystyrene round bottom tubes (BD Falcon, Bedford, Mass.) containing 0.5 mL of RPMI-1640 with L-glutamine and HEPES (Mediatec, Herndon, Va.) and supplemented with 10% fetal bovine serum (GIBCO, Invitrogen, Grand Island, N.Y.), 1 mM sodium pyruvate (Mediatec) and 1 non-essential amino acids (Mediatech). Each culture was mixed with 0.1 mL medium either lacking (mock-treated) or containing one of the following PRRS virus strains: 89-46448-40, G16X, 111698, 794A61, FL-12, or NADC-20, at a concentration determined to provide a multiplicity of infection (MOI) ranging from 0.04 to 5. The cultures were placed at 37 C. in a 5% CO.sub.2 atmosphere, harvested 8 h later, and centrifuged for 10 min at 4 C. and 2000 rpm. The resultant cell-free, supernatant media were removed and tested for the presence of interferon alpha by using a specific ELISA.
(111) To assess the effect of PRRS virus on the interferon alpha response of macrophages to polyinosinic:polycytidylic acid [poly(I:C)], individual cultures of 2.510.sup.5 ZMAC cells in round bottom tubes containing 0.5 mL of supplemented RPMI-1640 medium were mixed with medium either lacking (mock-treated) or containing one of the following PRRS virus strains: 89-46448-40, G16X, 111698, 794A61, FL-12, or NADC-20, at a concentration determined to provide a MOI of 5. After a 2 h incubation at 37 C. in a 5% CO.sub.2 atmosphere, the cell cultures were exposed to 10 g/mL of poly(I:C) (Amersham Pharmacia Biotech, Inc. Piscataway, N.J.) and returned to the 37 C. and 5% CO.sub.2 atmospheric environment. After an additional 8 h, the cultures were harvested were harvested and centrifuged for 10 min at 4 C. and 2000 rpm. The resultant cell-free, supernatant media were removed and tested for the presence of interferon alpha by using a specific ELISA.
(112) Results are presented as a percentage of the amount of IFN alpha detected in ZMAC cell cultures stimulated with poly(I:C) alone, which were given a value of 100%. The amount of IFN alpha detected in the supernatants of poly(I:C) treated ZMAC cell cultures at this cell concentration ranged from 11 to 35 ng/mL. The data presented in
(113) Quantitation of porcine interferon alpha by using a specific ELISA was carried out as follows. Individual wells of a Nunc Immulon II 96-well plate (Thermo Fisher Scientific, Inc., Rockford, Ill., USA) were coated for 16 h at 4 C. with 50 l of 5 g/mL anti-pig interferon alpha mAb F17 (PBL InterferonSource, Piscataway, N.J., USA) in 0.1 M carbonate buffer (pH 9.6), washed 3 times with PBS containing 0.05% Tween 20 (PBS-T), and then incubated with 200 l milk blocking solution (BioFix, Owings Mills, Md., USA) for 1 h at 25 C. After three washes with PBS-T, 50 l cell culture supernatants or recombinant pig interferon alpha standards (PBL InterferonSource) diluted in RPMI complete medium were added to duplicate wells and left for 1.5 h at 25 C. After washing 5 times with PBS-T, each well was incubated with 50 l of PBS-T containing 0.3 g/mL biotin-labeled, anti-pig interferon alpha mAb K9 (PBL InterferonSource) and 0.5% milk blocking solution at 25 C. for 1.5 h. After 5 washes with PBS-T, each well was incubated with 50 l PBS-T containing 20 ng/mL streptavidin conjugated to horse radish peroxidase (BIOSOURCE, Invitrogen) for 20 min at 25 C. and then again washed 5 times with PBS-T. Color development was initiated at 25 C. with the addition of 100 l TMB substrate (KPL, Gaithersburg, Md., USA) per well and terminated with 100 l 1 M phosphoric acid. Optical densities were determined at 450 nm with a SPECTRAMAX Plus plate reader (Molecular Devices, Sunnyvale, Calif.). Results were averaged and the amounts of interferon alpha were determined by comparison to a standard curve generated from the values obtained with known quantities of this cytokine.
(114) Results. Amino acid differences between the proteins of PRRS virus 89-46448-40 and the three derived strains 794A61, 111698 and G16X were determined. A comparison of the nucleotide sequences comprising more than 99% of the entire genomes of three PRRS virus strains (794A61, 111698, and G16X; Tables 3-5), corresponding to the translated portions of the virus genome that result in expressed proteins for each of these three PRRS virus strains (see also Tables 1-2 and
(115) Without wishing to be bound by any particular theory, it is believed that the mutation to encode alanine rather than threonine at amino acid 60 in Protein E is responsible for or contributes to the advantageous immunizing phenotype of the G16X isolate, alone or in combination with the isoleucine to valine change at amino acid 31 in Protein E may further contribute to this phenotype. It is acknowledged that other changed amino acids as shown in
(116) The effects of PRRS virus 89-46448-40 and the three derived strains on interferon alpha production by porcine alveolar macrophages were determined. Previous studies have shown that very low to negligible amounts of interferon alpha are produced by porcine alveolar macrophages when exposed to PRRS virus, with some slight variation between the responses elicited by different PRRS virus field isolates. To ascertain differences between the parental 89-46448-40 isolate and the three strains derived from it, the interferon alpha response of the porcine alveolar macrophage cell line ZMAC to their exposure to any of these four related viruses was studied. For comparison, the interferon alpha response provoked by NADC-20 and FL-12, two wild-type PRRS virus isolates, was also investigated. Exposure of ZMAC cells to either 89-46448-40, FL-12 or NADC-20 virus isolates resulted in a meager interferon alpha response, analogous in magnitude to the response by elicited by other wild-type PRRS virus isolates from pig alveolar macrophages. In contrast, the exposure of alveolar macrophages to the G16X strain at the highest multiplicity of infection (MOI) tested (MOI=5) elicited a response that was two-fold larger in magnitude than the response elicited by its progenitor isolate (89-46448-40) at the same MOI (
(117) In summary, the data demonstrate that the stock of 89-46448-40 virus isolate originated from NVSL (89-46448-40 MA104/2) was comprised of a mixture of viruses of related genotypes. The example also shows that the three purified PRRS virus strains 794A61, 111698 and G16X differed from the parental 89-46448-40 virus population by several synonymous and non-synonymous nucleotide point mutations. The latter mutations resulted in 2, 3 or 5 amino acid changes distributed among Nsp2 and structural proteins protein E, GP3 and GP4, respectively, that distinguish them from the parental virus. These three strains also differed biologically from the progenitor 89-46448-40 virus, as shown by their unique ability to stimulate interferon alpha production by porcine alveolar macrophages.
Example 4
PRRS Virus Vaccine
(118) Example 4. This example demonstrates differences in the vaccine efficacies of the PRRS virus strains 794A61, 111698 and G16X in an experimental respiratory challenge model of PRRS in grower pigs. Vaccine effectiveness took into account factors indicative of protection from clinical disease including the rate of pig growth, the magnitude and duration of viremia in the pig, and the presence of virus in the pigs' lungs. The results are summarized in Table 2. Based on these parameters the protective efficacy against the same heterologous challenge virus for these three nearly isogenic PRRS virus strains was rated as poor (794A61), moderate (111698) or good (G16X).
(119) TABLE-US-00002 TABLE 2 Outcomes of the vaccination challenge study. Vaccine efficacy parameter Reduction/ Reduction/ Minimize elimination of Vaccine Vaccine elimination reduction in lung-associated efficacy strain of viremia pig growth virus rating 794A61 ++ (1) (3) (3) Poor 111698 +++ (1) ++ (1) (3) Moderate G16X +++ (1) ++ (1) ++ (2) Good Key: +++ indicates strong effect; ++ indicates good effect; + indicates moderate effect; indicates no effect. (1), (2), (3): Level of statistical significance when comparing the indicated vaccinated group to the unvaccinated challenge control group. (1) p 0.001; (2) p < 0.005; (3) p > 0.4 (not significant).
(120) Materials and Methods. Monolayers of the simian cell line, MARC-145, were prepared in 75 cm.sup.2 tissue culture flasks containing complete MEM that consisted of Eagle's Minimal Essential Medium (MEM) with pH adjusted to 7.2 and supplemented with 5% fetal calf serum, 0.15% sodium bicarbonate and antibiotics. The flasks containing MARC-145 cells and 10 mL culture medium were incubated at 37 C. in an atmosphere of 5% CO.sub.2. The porcine alveolar macrophage cell line ZMAC, was cultured using Ultra-low adherence T75 tissue culture flasks (Corning, Corning, N.Y.) in RPMI-1640 medium with L-glutamine (Mediatec, Herndon, Va.), supplemented with 10% fetal bovine serum (GIBCO, Invitrogen, Grand Island, N.Y.), 1 mM sodium pyruvate (Mediatec) and 1 non-essential amino acids (Mediatec), and maintained at 37 C. in a 5% CO.sub.2 atmosphere.
(121) The three PRRS virus isolates (794A61, 111698, and G16X) used as potential vaccines in this study were propagated in MARC-145 cell monolayers as described in the art. Confluent monolayers of MARC-145 cells were inoculated with 1 mL of virus suspension and incubated for 1 h at 37 C. to allow virus absorption. The virus inoculum was then removed and 10 mL of fresh complete MEM added. The cell cultures were then incubated at 37 C. in an atmosphere of 5% CO.sub.2 until cytopathic effects were observed (within 4 days). Once >75% of the cells in the monolayer exhibited cytopathic effects, the contents of the flask(s) were harvested and either purified or divided into several 1-2 mL aliquots in sterile glass or plastic vials and stored at 80 C. until needed. The acute PRRS virus isolate NADC-20 used as the challenge virus was passaged once in ZMAC cells directly from the serum of a diseased animal in order to create a stock of virus for animal inoculation. The NADC-20 virus has been shown to produce significant respiratory disease in young pigs, with total gross lung lesion scores ranging from 30-45% and substantial viremia of similar magnitude to that observed for other virulent PRRS virus isolates. For animal inoculation the viruses were diluted in a phosphate buffered solution (Mediatech) supplemented with 0.05% neonatal porcine serum (diluent) to obtain a virus titer of 10.sup.4 TCID.sub.50/mL. The mock inoculum consisted of the diluent alone.
(122) The origins of the three vaccine viruses used in this study have been described in detail herein above. The stocks of these viruses used for vaccination are: the second passage of the six-fold plaque purified isolate of the 794 stock that was the second passage of 89-46448-40 MA104/2 (original 89-46448-40 isolate provided by NVSL to the University of Illinois VDL) in MARC-145 cells (794A61 P2); an end-point dilution (MOI=0.001) passage of the 794 stock in MARC-145 cells (111698); and the third passage of a plaque derived from two cycles of plaque-purification of virus obtained during the first subsequent passage of the 794 stock at high MOI (MOI=1.0) in MARC-145 cells (G16X P3).
(123) Prior to inoculation, the vaccine and challenge virus stocks were diluted in Dulbecco's phosphate buffered solution (Mediatech, Manassas, Va.) supplemented with 0.05% neonatal porcine serum to obtain an infectious dose of 104.1 or 104.7 TCID.sub.50/mL, respectively. The expected titers of each inoculum were verified on the day of use by titration in MARC-145 cells (three vaccines) or ZMAC cells (NADC-20 challenge virus) as described below.
(124) To quantitate the amount of infectious virus (infectious virus titer) in the preparations to be used for vaccination, the virus stocks were serially diluted ten-fold in tubes containing 0.9 mL of complete MEM. A 0.1 mL aliquot of each diluted sample being tested was transferred separately to quadruplicate wells that were present in a 96-well tissue culture plate and contained 0.1 mL medium overlaying a nearly confluent monolayer of MARC-145 cells. After 5 days of culture at 37 C. in a humid environment with a 5% CO.sub.2 atmosphere, the cells in each well were examined for the presence of cytopathic effects using an inverted microscope. Wells were scored as positive for virus infection when >90% of the cells within exhibited apoptosis and/or had lysed. The number of TCID.sub.50 per sample was determined by using the method of Reed and Muench (Reed and Muench, 1938).
(125) To determine the quantity of infectious virus in the challenge virus preparation, the NADC-20 stock was serially diluted ten-fold in tubes containing 0.9 mL of RPMI-1640 medium (Mediatech) supplemented with 5% fetal bovine serum (Gibco). A 0.1 mL aliquot of each diluted sample being tested was transferred separately to quadruplicate wells in a 96-well tissue culture plate and contained 0.1 mL medium having 3-410.sup.4 ZMAC cells/well. After 96 h of incubation at 37 C. in a humid environment with a 5% CO.sub.2 atmosphere, the cells in each well were examined for the presence of cytopathic effects using an inverted microscope. Wells were scored as positive for virus infection when >90% of the cells within exhibited apoptosis and/or had lysed. The number of TCID.sub.50 per sample was determined by using the method of Reed and Muench. Similar titrations of virus infectivity using ZMAC cells were performed on each serum and bronchoalveolar lavage (BAL) fluid sample collected from the individual, virus-infected or nave pigs.
(126) The body weight of each pig was measured by using a scale with a digital readout. The scale was calibrated using calibration weights before and after each use. All pigs were weighed on the day of virus challenge (immediately before inoculation) and at 7 days thereafter. The body weight gained by the individual pigs at 7 days after challenge was calculated relative to their respective body weight on the day of NADC-20 virus inoculation. Results are presented as the mean adjusted weight changestandard error of the mean (SEM) for each treatment group.
(127) Seven days after NADC-20 virus challenge, the animals were euthanized and their lungs removed intact from the thoracic cavity. Bronchoalveolar (BAL) fluid samples were obtained from each lung by infusing into its right middle lobe sterile Dulbecco's phosphate buffered saline (Mediatech) with a 20 cc plastic syringe connected to a tubing infusion set (Butterfly 19 12 tubing, Abbott Laboratories, Chicago, Ill.) from which the needle was cut. The tubing was inserted into the bronchi leading to the right middle lobe and the two clamped together with a string to avoid leakage. Afterwards, 10 mL of Dulbecco's phosphate buffered solution were gently propelled into the lobe. After gently massaging the perfused lobe, the fluid was removed by slowly retracting the plunger. Typically half (5 mL) of the infused fluid was easily recovered. The BAL fluid was then transferred to a sterile 15 cc Falcon polypropylene conical tube (Becton Dickinson, Franklin Lakes, N.J.) and kept at 4 C. for no more than 4 h after collection. The BAL fluid was then clarified by centrifugation at 2000 rpm for 10 min, and the resultant fluid split into 1 mL aliquots in sterile RNAase and DNAase & pyrogen free, 1.7 mL Posi-Click Tubes (Denville Scientific) and stored at 80 C. until being tested for virus load.
(128) Viremia was detected and measured using quantitative RT-PCR, with primers as described herein below. RNA was extracted from serum samples obtained from PRRS virus-vaccinated and nave pigs at seven days after challenge with the NADC-20 virus by using a QIAamp viral RNA minikit (Qiagen, Chatsworth, Calif.) according to manufacturer's instructions and as described below. 140 l of each sample was combined with 560 l Buffer AVL containing 5.6 l carrier RNA in a 1.5 mL Eppendorf tube, pulse-vortexed for 15 sec, and incubated at ambient temperature for 10 min. 560 l of 100% ethanol was added to each tube and the contents were pulse-vortexed for 15 sec and centrifuged at 6000g for 10 sec. 630 l of each mixture was applied to the top surface of a QIAamp Mini spin column and centrifuged at 8000g for 1 min. The eluant was discarded and the process repeated for the remainder of each mixture. Each column was then sequentially washed with 500 l Buffer AW1 (8000g for 1 min) and 500 l Buffer AW2 (20,000g for 3 min). Afterwards, the dried columns were centrifuged at 20,000g for 1 min before 60 l of Buffer AVE was applied to each column. Following a 1 min incubation at ambient temperature, the RNA was eluted into 1.5 mL Eppendorf tubes during a 1 min centrifugation at 6000g. Eluted RNAs were stored at 80 C. until needed.
(129) Serum RNA samples were reverse transcribed in the presence of 0.5 M reverse, complementary primer (CACACGGTCGCCCTAATTG) (SEQ ID NO: 27), 50 mM Tris (pH 8.3), 75 mM KCl, 3 mM MgCl.sub.2, 10 mM DTT, 0.5 mM each of dATP, dCTP, dGTP, and dTTP and 25 units of mouse murine leukemia virus reverse transcriptase (Promega, Madison, Calif.)/l reaction. After denaturation of the RNAs and primers in either 0.5 mL Eppendorf tubes or 0.2 mL PCR tubes at 70 C. for 10 min and cooling at 4 C. for 2 min, the other components were added. The entire mixtures were either subjected to one cycle of 10 min at 25 C., one cycle of 50 min at 45 C., and one cycle of 15 min at 70 C. (random hexamer primers) or to one cycle of 60 min at 42 C. and one cycle of 15 min at 70 C. The resultant cDNAs were stored at 80 C. until needed.
(130) Real-time PCR for the amplification/detection of PRRSV genomes in the reaction mixtures was performed by using the TaqMan Universal PCR Master Mix, an ABI SDS 7000 machine (Applied Biosystems, Foster City, Calif.), forward primer TGGTGAATGGCACTGATTGAC (SEQ ID NO: 28), the above-mentioned reverse primer, and TaqMan probe, 6-FAM-TGTGCCTCTAAGTCACC (SEQ ID NO: 29) (where FAM is 6-carboxyfluorescein). Primers and probe were designed with Primer Express, version 2.0, software (Applied Bio systems) and were purchased from Integrated DNA Technologies, Inc. (IDT, Coralville, Iowa), and Applied Biosystems, respectively. PRRS virus RNA copy number was determined by comparison of the obtained threshold cycle (CT) values to a standard curve generated by using known amounts of RNA transcripts corresponding to approximately 9% of the 3-terminal region of the genome of PRRS virus strain G16X.
(131) Thirty cross-bred (YorkshireLandrace) pigs at 352 days of age were obtained from the PRRS virus-free swine herd at the University of Illinois, College of Veterinary Medicine, Swine Research Farm (Urbana, Ill.). The pigs were randomly distributed to isolation cubicles (n=3 pigs/cubicle) at the Bio-containment Facility at the University of Illinois. A thermal climate of 24 C. to 28 C. was maintained in the cubicles. Pigs were fed a corn-based phase II diet that provided nutrient concentrations that met or exceeded the estimated requirements of high-lean pigs. The animals were housed in groups of 3 in accordance with biomedical level procedures in ten 182-243-cm cubicles, maintained on 12 h light/dark cycles, and had ad libitum access to water and feed. After a 5-day period of acclimation, animals in 6 of the cubicles were injected once intramuscularly in the rump area with a 2 mL suspension containing 10.sup.4.1 TCID.sub.50/mL of either G16X-P3, 794A61-P2 or 111698 virus, for a total of 2 cubicles per type of vaccine virus (n=6 pigs). Six animals in two additional cubicles were mock-vaccinated with 2 mL of diluent (PBS supplemented with 0.5% pig serum). Six pigs in the remaining two cubicles were not immunized and were used as strict controls. At 39.50.5 days after vaccination, all of the immunized animals as well as the six mock-vaccinated pigs were challenged with 10.sup.5.3 TCID.sub.50 of the virulent PRRS virus isolate NADC-20. The challenge inoculum consisted of 4 mL of NADC-20 virus at a concentration of 10.sup.4.7 TCID.sub.50/mL administered in 2 mL doses intranasally and intramuscularly. The body weight of each animal was determined immediately prior to and at 7 days after virus challenge. The animals were monitored daily for changes of vitality and signs of respiratory distress for an interval starting on the day of challenge and continuing throughout the next 7 days. Serum samples were collected immediately before and at 7 days after challenge, and the levels of viremia ascertained by measuring the amount of PRRS virus genomes/mL of serum using quantitative real-time PCR. Seven days after the challenge, the animals were euthanized and their lungs removed intact from their thorax. BAL samples were collected from the right middle lobe and amount of infectious virus in them determined by titration in ZMAC cells.
(132) Statistical analyses were carried out as follows. The General Linear Model Univariate procedure and the Fisher's LSD test were applied to assess differences between groups in regards to the extent of viremia (viral genome copy number/mL) and amount of infectious virus in the lungs (TCID.sub.50/mL). For analysis both of these measurements were transformed to log 10 values and compared to the group mean of the mock-vaccinated-challenged group. Dunnett's t-test (2-sided) was used to compare the vaccinated pigs' differential weight change before and after virus challenge to the same parameter measured in the reference mock-vaccinated-challenged group. Analyses were performed using the statistical SAS software (Cary, N.C.). P-values of <0.01 were considered statistically significant.
(133) In order to assess the vaccine efficacy of the PRRS virus strains 794A61, 111698 and G16X, groups of pigs were either immunized with one of these viruses or mock-vaccinated and challenged about 5.5 weeks later with the virulent acute PRRS strain NADC-20. An additional group of pigs remained PRRS virus naive and served as strict controls. On the day of challenge, the average body weight of all 30 pigs in the study was 49.93 kg. No significant differences were found between the mean body weight established for any of the three vaccinated groups and that of either the mock-vaccinated or strict control group. Thus, exposure to any of the three vaccine strains had no obvious impact on animal growth. In contrast, inoculation of the non-vaccinated animals with the NADC-20 virus was associated with a drastic reduction of their potential growth during the ensuing 7 days as evidenced by a meager 31.6% weight change, one sixth of the average 18.51.54% weight gained by the strict controls (
(134) The effect of PRRS virus vaccination on the level of viremia in NADC-20 virus-challenged pig was determined. As expected, none of the strict control pigs, which had not been directly exposed to PRRS virus, had measurable quantities of infectious virus in their sera when sampled together with the other animals at 7 days post NADC-20 virus challenge. Thus, cross-contamination between cubicles did not occur. Likewise, at this time, infectious virus was not evident in the sera of any of the G16X virus-vaccinated pigs. On the other hand, infectious PRRS virus was readily detected in the sera from all six mock-vaccinated animals as well as in 3 and 4 of the six group members that had been vaccinated with either 794A61 or 111698, respectively. To more accurately measure the level of viremia in these animals, especially the apparently PRRS virus-negative members of the G16X vaccinated group, a quantitative real-time PCR assay was employed (
(135) The effect of PRRS virus vaccination on the virus load in the lungs of NADC-20 virus-challenged pigs was determined. At 7 days after challenge with NADC-20 virus, the BAL fluid collected from the lungs of pigs that had previously been mock-vaccinated or immunized with either 794A61 or 111698 virus, had similar amounts of infectious virus, with statistically similar group averages of 10.sup.4.5, 10.sup.4.8, and 10.sup.4.1 TCID.sub.50/mL, respectively (
(136) Based on the results presented it was determined that the nearly isogenic PRRS virus strains 794A61, 111698 and G16X can be reasonably rated with respect to vaccine efficacy as poor, moderate and good, respectively.
Example 5
G16X PRRS Virus Vaccine
(137) Example 5. This example demonstrates the ability of the G16X virus, to provide heterologous protective immunity to pigs vaccinated with this virus and challenge with a virulent type 2 PRRS virus of a different lineage, namely of lineage 1. In this study the efficacy of two PRRS vaccine viruses was tested. One group of animals was vaccinated with the vaccine candidate G16X. A second group of pigs was vaccinated with the commercially available Ingelvac PRRS MLV. The study was a blinded, placebo controlled study. To achieve masking, all personnel involved in daily observations, clinical scoring, assessment of gross and microscopic lung pathology and the processing of samples and interpretation of laboratory results remained masked throughout the experimental phase study.
(138) Twenty-four 6-weeks old pigs were purchased from the University of Illinois Veterinary Research Farm. The herd of swine at this farm is known to be free of all major swine pathogens including PRRS virus, influenza, mycoplasma and circovirus. The negative status for PRRS antibodies of the study animals was confirmed by serology prior to the start of the study. All 24 animals were ear tagged and randomly assigned to a treatment group (four groups and 6 pigs per group) and then transferred to a BSL2 animal containment facility. All of the pigs allocated to the same treatment group (6 pigs) were penned together. After a 7-day period of acclimation each group of pigs was vaccinated according to their treatment allocation as follows:
(139) Group 1: Each pig in the mock vaccine was injected intramuscularly with 2 ml of vaccine diluent.
(140) Group 2: Each pig in this group received one dose of Ingelvac PRRS MLV (Serial No. 245-D45). The vaccine was reconstituted and administered intramuscularly according to the manufacturer instructions (titration of the inoculum indicated that the total dose administered was 410.sup.4 TCID.sup.50).
(141) Group 3: Each pig in this group received an intramuscular injection of 2 ml containing a total of 410.sup.4 TCID.sub.50 of G16X live PRRS virus vaccine.
(142) The fourth group served as a strict (environmental) control and was not vaccinated. Twenty-eight days after vaccination all of the animals in groups 1, 2 and 3 were challenged with 410.sup.4 TCID.sub.50 of the highly virulent PRRS virus isolate LTX1. Based on a phylogenetic analysis of nucleotide sequence of the GP5 gene, the LTX1 virus is thought to belong to lineage 1 of the type 2 (North American-like) PRRSV. The GP5 of the LTX1 virus has a <88% homology with either of the two vaccines used. The LTX1 virus was isolated in 2012 from a sow farm in Illinois, which was suffering from a severe outbreak of PRRS virus. The syndrome observed was characterized by a conception rate of 60%, late term abortions and stillbirths. In addition, there was a 6 week period with 100% pre-wean mortality, followed by 2 more weeks of 80% mortality of pre-wean pigs. The outbreak was so severe that the owner of the farm and the attending veterinarian decided to depopulate the farm. Half the dose of the challenge virus was given intranasally using a nasal sprayer and the other half by intramuscular injection. Subsequently the animals were monitored daily for the next 14 days for clinical signs. Blood samples were collected immediately before and at 7, 10 and 14 days after the virus challenge. Body weight was recorded on the day of challenge and at 7, 10 and 14 days after the challenge. At 14 days after the challenge the animals were euthanized and the lungs examined for gross pathology. Samples were taken for histopathology and a bronchoalveolar lavage performed. All method used were as previously described in the art, except that the BAL fluid collected was tested for infectious virus load using the porcine alveolar macrophage cell line ZMAC.
(143) a. Vaccination with the G16X Virus Stimulates a Strong Interferon-Alpha Response at 4 Days Post-Vaccination.
(144) In this study, it was discovered that the G16X virus has a unique biological property, namely that 4 days after the intramuscular administration of G16X vaccine virus into pigs, a vigorous systemic interferon alpha response was detectable in their serum. This response began to subside 4 days later (day 8 post vaccination) and was still present at 14 days post vaccination (
(145) b. Efficacy of the G16X Vaccine in Regards to Pig Weight Gain in Pigs Challenged with a Highly Virulent PRRS Virus
(146) At the time of challenge, the average body weight of the 24 pigs in the study was 514 kg, and there no differences in the average body weight between groups. Likewise, no clinical signs were observed in the animals immunized with either the commercial PRRS MLV vaccine or the G16X virus. These results indicate that just like the commercially available MLV vaccine, the G16X virus, which was derived from a naturally non-virulent virus, is also not virulent. Thus, exposure of the pigs to either vaccine G16X or Ingelvac PRRS MLV had no obvious impact on their growth or health.
(147) To measure the protective immunity elicited by the two vaccines being examined with regards to pig growth, the % body weight gain was calculated for each animal from the day of virus challenge to 7, 10 and 14 days after virus challenge. The pigs in the unchallenged (strict control) group exhibited a steady rate of growth with an average increase of 32% in 14 days (
(148) c. Efficacy of the G16X Vaccine in Regards to the Control of Viremia in Pigs Infected with a Heterologous Highly Virulent PRRS Virus
(149) At the time of challenge (28 days post vaccination) none of the pigs in the trial had a detectable infectious virus in their serum. All of the animals that were mock vaccinated and then challenged with the LTX1 virus exhibited high levels of viremia at 7, 10 and 14 days after challenge (
(150) d. Efficacy of the G16X Vaccine in Regards to the Control of Virus Load in the Lungs of Pigs Infected with a Highly Virulent PRRS Virus
(151) At 14 days after challenge with the LTX1 virus, not surprisingly the greatest virus load in the pigs' BAL fluids was found for all members of the non-vaccinated group (
(152) In summary this example demonstrates that the G16X virus, akin to the commercial MLV vaccine is not virulent, but has superior efficacy to the commercially available MLV vaccine in a heterologous challenge with virulent type 2 PRRS virus of a different lineage.
Example 6
Sequence Information
(153) Example 6. Embodiments of the invention can relate to one or more nucleic acid or protein sequences including the items described herein. Any sequence information, including such submitted separately in electronic format, is considered part of the description herewith and is incorporated herein by reference.
(154) TABLE-US-00003 TABLE3 SEQIDNO:1 catttgtgttgtcaggagctgtgaccattggcacagcccaaaacttgctgcacggaagcg 60 cccttctgtgacagcctccttcaggggagcttgggggtctttccctagcaccttgcttcc 120 ggagttgcactgctttacggtctctccacccctttaaccatgtctgggatacttgatcgg 180 tgcacgtgtacccccaatgccagggtgtttatggcggagggccaagtctactgcacacga 240 tgcctcagtgcacggtctctccttcctctgaatctccaagtttctgaactcggggtgcta 300 ggcctattctacaggcccgaagagccactccggtggacgttgccacgtgcattccccact 360 gttgagtgctcccccgccggggcctgctggctttctgcaatttttccaattgcacgaatg 420 accagtggaaacctgaacttccaacaaagaatggtacgggtcgcagctgaactttacaga 480 gccggccagctcacccctacagtcttaaagactttacaagtttatgaacggggttgccgc 540 tggtaccccatcgtaggacctgtccctggagtggccgttttcgccaactccctacatgtg 600 agtgataaacctttcccgggagcaactcacgtgttaaccaacctgccgctcccgcagaga 660 cccaagcctgaagacttttgcccctttgagtgtgctatggctaccgtctatgacattggt 720 catgacgccgtcatgtatgtggccgaagggaaagtctcctgggcccctcgtggcggggat 780 gaagtgaaatttgaaactgtccccggggagttggagttgattgcgaatcgactccgcacc 840 tccttcccgccccaccacacagtggacatgtctaagttcgccttcacagcccctgggcgt 900 ggtgtttctatgcgggtcgaacgccaacacggctgcctccccgctgacactgtccctgaa 960 ggcaactgctggtggagcttgtttaacttgctcccactggaagttcagaacaaagaaatt 1020 cgccatgctaaccaatttggctaccagaccaagcatggtgtctctggcaagtacctacag 1080 cggaggctgcaagttaatggtctccgagcagtaactgacctgaatggacctatcgtcgta 1140 cagtacttctccgttaaggagagttggatccgccacttgaaactggcggaagaacccagc 1200 taccctgggtttgaggacctcctcagaataagggttgagcccaacacgtcgccattggct 1260 gacaaggatgaaaaaattttccggtttggcagtcacaagtggtacggcgctggaaagaga 1320 gcaaggaaagcacgctctagtgcgactgctacagtcgctggccgcgctttgtccgttcgt 1380 gaaacccggcaggccaaggagcacgaggttgccggcgccaacaaggctgggcacctcaaa 1440 cattactccccgcctgccgaagggaattgtggttggcactgcatttccgccatcgccaac 1500 cggatggtgaattccaaatttgaaaccacccttcccgaaagagtgagaccttcagatgac 1560 tgggctactgacgaggatcttgtgaatgccatccaaatcctcaggctccctgcggccttg 1620 aacaggaacggcgcttgtgctagcgccaagtacgtacttaagctggaaggtgagcattgg 1680 actgtcactgtgacccctgggatgtccccttctttgctccctcttgaatgtgttcagggc 1740 tgttgtgagcataagggcagtcttggttccccagatgcagtcgaggttttcggatttgac 1800 cctgcttgccttgaccggctggctgaggtgatgcacctgcctagcagtgctatcccagcc 1860 gctctggccgaaatgtccggcgattccgatcgttcggcttccccggtcaccaccgtgtgg 1920 actgtttcgcagttctttgcccgccacaatggagggaatcaccctgaccaagtgcgctta 1980 gggaaaattatcagcctttgtcaggtgattgaggactgctgctgttcccagaacaaaacc 2040 aaccgggtcaccccggaggaggtcgcagcaaagattgacctgtaccttcgtggcgcaaca 2100 aatcttgaagaatgcttggccaggcttgagaaagcgcgcccgccacgcgtaatggacacc 2160 tcctttgattgggatgttgtgctccctggggttgaggcggcaactcagacgaccgaactg 2220 ccccaggtcaaccagtgtcgcgctctggtccctgttgtaactcaaaagtccttggacaac 2280 aactcggtccccctgaccgccttttcactggctaactactactaccgtgcgcaaggtgac 2340 gaagttcgtcaccgtgaaagactaaccgccgtgctctccaagttggaaggggttgttcga 2400 gaagaatatgggctcatgccaaccgggcctggtccacggcccacactgccacgcgggctc 2460 gacgaactcaaagaccagatggaggaggacttgctgaaactggctaacgcccagacgact 2520 tcggacatgatggcctgggcagtcgagcaggttgacctaaaaacttgggtcaagaactac 2580 ccgcggtggacaccaccaccccctccgccaaaagttcagcctcgaaaaacgaagcctgtc 2640 aagagcttgccagagagaaagcctgtccccgccccgcgcaggaaggttgggtccgattgt 2700 ggcagcccgatttcattgggcgacgatgtccctaacagttgggaagatttggctgttggt 2760 agcccctttgatctcccgaccccacctgagccggcaacaccttcaagtgagctggtgatt 2820 gtgtccgcaccgcaatgcatcttcaggccggcgacacccttgagtgagccggctccaatt 2880 cccgcaccccgcggggttgtgtctcgaccggtgacacccttgaatgagccgatacctgtg 2940 cccgcaccgcggcgtaagtttcagcagatgagaagattgagttcggcggcggtaatcccg 3000 ccgtaccaggacgagcccctagatttgtctgcttcctcacagactgaatatgaggcctct 3060 cccctagcaccgccgcagagcgagggtgttctgggagtagaggggcaggaagctgaggaa 3120 gccctaagtgaaatctcggacatgtcgggtaacattaaacctgcgtccgtatcatcaagc 3180 agctccttgtccagcgtgagaatcactcgcccaaaatactcagctcaagccatcatcgac 3240 tcgggcgggccctgcagtgggcatctccaagaggtaaaggaaacatgcctcagtatcatg 3300 cgcgaggcatgtgatgcgactaagcttgatgaccctgctacgcaggagtggctttctcgc 3360 atgtgggatcgggtggacatgctgacttggcgcaacacgtctgcttaccaggcgtttcgc 3420 accttagatggcaggttaaagttcctcccaaaaatgatactcgagacaccgccgccctat 3480 ccgtgtgagtttgtgatgatgcctcacacgcctgcaccttccgtaggtgcggagagcgac 3540 cttaccattggctcagtcgctactgaagatgttccacgcatcctcgagaaaatagaaaat 3600 gtcggcgagatgaccaaccagggacccttggccttctccgaggataaaccggtagatgac 3660 caacttgccaaagacccccggatatcgtcgcagaggtctgacgagagcacatcagctccg 3720 cccgcaggcacaggtggcgccggctcatttaccgatttgccgccttcggacggcgtggat 3780 gcggacggaggggggccgttttggacggtaaaaagaaaagctgaaaggctctttgaccaa 3840 ctgagccgtcaggtttttgacctcgtctcccatctccctgttttcttctcacgccttttc 3900 aaccctggcggtggttattctccgggtgattggggttttgcagcttttactctattgtgc 3960 ctctttttatgttacagttacccagcctttggtattgctcccctcttgggtgtgttttct 4020 gggtcttctcggcgcgttcgaatgggggtttttggctgctggttggcttttgctgttggt 4080 ctgttcaagcctgtgtccgacccagtcggcgctgcttgtgagtttgactcgccagagtgt 4140 agaaatatccttcattcttttgagcttctcaaaccttgggaccctgttcgcagccttgtt 4200 gtgggccccgtcggtctcggtcttgccattcttggcaggttactgggcggggcacgcagc 4260 atctggcactttttgcttaggcttggcattgttgcagactgtgtcttggctggagcttat 4320 gtgctttctcaaggtaggtgtaaaaagtgctggggatcttgtataagaactgctcctaat 4380 gaggtcgcttttaacgtgtttccttttacacgtgcgaccaggtcgtcactaatcgacctg 4440 tgcgatcggttttgtgcgccaaaaggcatggaccccatttttctcgccactgggtggcgc 4500 gggtgctgggccggccgaagccccattgagcaaccctctgaaaaacccatcgcgtttgcc 4560 cagttggatgaaaagaagattacggctaggactgtggtcgcccagccttatgaccccaac 4620 caagccgtaaagtgcttgcgggtattgcaggcgggtggggtgatggtggctaaggcagtc 4680 ccaaaagtggtcaaggtttccgctgttccattccgagcccccttctttcccaccggagtg 4740 aaagttgaccctgaatgcagggtcgtggttgaccccgacactttcaccgcagctctccgg 4800 tctggctactccaccacaaacctcgtcctcggtgtaggggattttgcccagctgaatgga 4860 ttaaaaatcaggcaaatttccaagccttcaggaggaggcccacacctcatggctgccctg 4920 catgttgcctgctcgatggctttgcacatgcttgctgggatttatgtgactgcggtgggt 4980 tcttgcggcaccggcaccaacgacccgtggtgcgctaacccgtttgccgtccctggctac 5040 ggacctggctctctctgcacgtccagattgtgcatttcccaacatggccttaccctgccc 5100 ttgacagcactcgtggcgggattcggtattcaagaaattgccttggtcgttttgattttt 5160 gtttccatcggaggcatggctcacaggttgagttgtaaggctgatatgctgtgtgttttg 5220 cttgcaattgccagctatgtttgggtacctcttacctggttgctttgtgtgtttccttgc 5280 tggttgcgctgtttttctttgcatcccctcaccatcctatggttggtgtttttcttgatt 5340 tctgtgaatatgccttcaggaatcttggccatggtgttgttggtttctctttggcttctt 5400 ggtcgttatactaatgttgctggtcttgtcaccccctacgacattcatcattacactagt 5460 ggcccccgcggtgttgccgccttggctaccgcaccagatgggacctacttggccgctgtc 5520 cgccgcgctgcgttgactggccgcaccatgctgtttaccccgtcccagcttgggtctctt 5580 cttgagggtgctttcagaactcgaaaaccctcactgaacaccgtcaatgtggtcgggtcc 5640 tccatgggctctggcggggtgttcaccatcgacggaaaaattaagtgcgtaactgccgca 5700 catgtccttacgggcaattcagctagggtttccggggtcggcttcaatcaaatgcttgac 5760 tttgacgtaaagggagatttcgccatagctgattgcccgaattggcaaggggctgccccc 5820 aagacccaattctgcaaggatgggtggactggccgtgcctattggctaacatcctctggc 5880 gtcgaacccggcgtcattggaaaaggattcgccttctgcttcaccgcgtgcggcgattcc 5940 gggtccccagtgatcaccgaggccggtgagcttatcggcgttcacacgggatcaaataaa 6000 caaggaggaggcatcgttacgcgcccctcaggccagttttgtaatgtggcacccatcaag 6060 ctaagcgaattaagtgaattctttgctgggcctaaggtcccgctcggtgatgtgaaggtt 6120 ggcagccacataattaaagacataggcgaggtgccttcagatctttgtgccttgcttgct 6180 gccaaacctgaactggaaggaggcctctccaccgtccaacttctttgtgtgtttttcctc 6240 ctgtggagaatgatgggacatgcctggacgcccttggttgctgtgggtttctttatcttg 6300 aatgaggttctcccagccgtcctggtccggagtgttttctcctttggaatgtttgtgcta 6360 tcctggctcacgccatggtctgcgcaagttctgatgatcaggcttctaacagcagccctt 6420 aacaggaacagatggtcacttgcctttttcagcctcggtgcagtgaccggttttgtcgca 6480 gatcttgcggctactcaggggcatccgttgcaggcagttatgaatttgagcacctatgca 6540 ttcctgcctcggatgatggttgtgacctcaccagtcccagtgattgcgtgtggtgttgtg 6600 cacctacttgccatcattttgtacttgtttaagtaccgtggcctgcaccaaatccttgtt 6660 ggtgatggagtgttctctgcggctttcttcctgcgatactttgccgagggaaagttgagg 6720 gaaggggtgtcgcaatcctgcggaatgaatcatgagtctctgactggtgccctcgctatg 6780 agactcaatgacgaggacttggatttccttacgaaatggactgattttaagtgctttgtt 6840 tctgcgtccaacatgaggaatgcagcgggtcaatttatcgaggctgcctatgctaaagca 6900 cttagagtagagcttgcccagttggtgcaggttgataaagttcgaggaactttggccaaa 6960 cttgaagcctttgctgataccgtggcaccccaactctcgcccggtgacattgttgtcgct 7020 ctcggccatacgcctgttggcagtatcttcgacctaaaggttggtagcaccaagcatacc 7080 ctccaagccattgagaccagagtccttgctgggtccaaaatgaccgtggcgcgcgtcgtc 7140 gacccgacccccacgcccccacccgcacctgtgcccatccccctcccaccgaaagttctg 7200 gagaatggccccaacgcttggggggatgaggaccgtttgaataagaagaagaggcgcagg 7260 atggaagccctcggcatctatgttatgggcgggaaaaagtaccagaaattttgggataag 7320 aattccggtgatgtgttttatgaggaggtccataataacacagatgagtgggagtgtctc 7380 agagttggcgaccctgccgactttgaccctgagaagggaactctgtgtggacatgtcacc 7440 attgaagataaggcttaccatgtttacacctcatcatctggtaagaagttcttggtcccc 7500 gtcaatccagagaatggaagagtccaatgggaagctgcaaagctttccgtagagcaggcc 7560 cttggtatgatgaacgtcgacggcgaactgactaccaaagaactggagaaactgaaaaga 7620 ataattgacaaactccagggcctgactaaggagcagtgtttaaactgctagccgccagcg 7680 gcttgacccgctgtggtcgcggcggcttggttgttactgaaacagcggtaaaaatagtca 7740 aatttcacaaccggaccttcaccctgggacctgtgaatttaaaagtggccagtgaggttg 7800 agctaaaagacgcggttgagcacaaccaacacccggttgcgagaccggtcgatggtggtg 7860 ttgtgctcctgcgttccgcggttccttcgcttatagacgtcttgatctccggtgctgatg 7920 catctcccaagttgcttgcccatcacgggccgggaaacactgggatcgatggcacgctct 7980 gggattttgagtccgaagccactaaagaggaagtcgcacttagtgcgcaaataatacagg 8040 cttgtgacattaggcgcggcgacgctcctgaaattggtctcccttacaagctgtaccctg 8100 ttaggggtaaccctgagcgggtaaaaggagttctacagaatacaaggtttggagacatac 8160 cttacaaaacccccagtgatactggaaacccagtgcacgcggctgcctgccttacgccca 8220 acgccactccggtgactgatgggcgctccgtcttggccacgaccatgccctccgggtttg 8280 agttgtatgtaccaaccataccagcgtctgtccttgattaccttgattctaggcctgact 8340 gccctaaacagttgacagagcacggctgtgaagatgccgcactgagagacctctccaaat 8400 atgacttgtccacccaaggctttgttttacctggagtttttcgccttgtacggaaatacc 8460 tgtttgcccatgtaggtaagtgcccacccgttcatcggccttctacttaccctgctaaga 8520 attctatggctggaataaatgggaataggttcccaaccaaggatattcagagcgtccctg 8580 aaatcgacgttctgtgtgcacaggctgtgcgggaaaactggcaaactgttaccccttgta 8640 ctcttaagaaacagtattgcgggaagaagaagactaggaccatactcggcaccaataatt 8700 ttatcgcgctagcccaccgagcagcgttgagtggtgtcacccagggcttcatgaaaaagg 8760 cgtttaactcgcccatcgccctcggaaaaaacaagtttaaggagctacagaccccggtcc 8820 taggcaggtgccttgaagctgatcttgcatcctgcgaccgatccacacctgcaattgtcc 8880 gctggtttgccgccaacctcctttatgaacttgcctgcgctgaagagcatttaccgtcgt 8940 acgtgctgaactgctgccacgacttactggtcacgcaatccggcgcagtgactaagagag 9000 gtggcctgtcgtctggcgacccgatcacctctgtgtctaacaccatttacagtttggtga 9060 tctatgcacagcatatggtgctcagttacttcaaaagtggtcacccccatggcctcttgt 9120 tcttacaagaccagctaaagtttgaggacatgctcaaggttcaacccctgatcgtctatt 9180 cggacgacctcgtgctgtatgccgagtctcccaccatgccaaactatcactggtgggttg 9240 aacacctgaattcgatgctggggtttcagacggatccaaaaaagacagccataacagact 9300 cgccatcatttctaggctgtagaataataaatggacgccagctagtccccaaccgtgaca 9360 ggattctcgcggccctcgcctaccacatgaaggcgagtaatgtttctgaatactacgcct 9420 cagcggctgcaatactcatggacagctgtgcttgtttggagtatgatcctgaatggtttg 9480 aagaacttgtagttggaatagcgcaatgcgcccgcaaggacggttacagctttcccggca 9540 cgccgttctttatgtccatgtgggaaaaactcaggtccaattatgaggggaagaagtcga 9600 gagtgtgcgggtactgcggggccccggccccgtacgctactgcctgtggcctcgacgtct 9660 gcatttaccacacccacttccaccagcattgtccagtcacaatctggtgtggccatccag 9720 cgggttctggttcttgtagtgagtgcaaatcccctgtagggaaaggcacaagccctttag 9780 acgaggtgctggaacaagtcccgtacaagcccccacggaccgttatcatgcgtgtggagc 9840 agggtcttaccccccttgacccaggtagataccagactcgccgcggattagtctccgtca 9900 ggcgtggaatcaggggaaatgaggttgaactaccagacggtgattatgctagtaccgcct 9960 tgctccctacctgtaaagagatcaacatggtcgctgttgcttccaatgtattgcgcagca 10020 ggttcatcattggtccacccggtgctgggaaaacatactggctccttcaacaggtccagg 10080 atggtgatgttatttacacaccaacccaccagaccatgcttgacatgattagggctttgg 10140 ggacgtgccggttcaacgtcccggcaggcacaacgctgcaattccccgtcccctcccgta 10200 ccggtccgtgggttcgcatcctggccggcggttggtgtcctggcaagaattccttcctgg 10260 atgaagcagcgtattgcaatcaccttgatgtcttgaggcttcttagcaaaactaccctca 10320 cctgtctgggagacttcaaacaactccacccagtgggttttgattctcattgctatgttt 10380 ttaacatcatgcctcaaactcaactgaagaccatctggaggtttggacagaatatctgtg 10440 atgccatccagccagattacagggacaaactcatgtccatggtcaacacaacccgtgtga 10500 cctacgtggaaaagcctgtcaggtatgggcaagtcctcaccccctaccacagggaccgag 10560 aggacgacgccatcactattgactccagtcaaggcgccacattcgatgtggttacactgc 10620 atttgcccacaaaagattcactcaacaggcagagagcccttgttgctatcaccagggcaa 10680 gacatgctatctttgtgtatgacccacacaggcagctgcagagcctgtttgatcttcctg 10740 caaaaggtacacccgtcaaccttgcagtgcaccgcgacgggcagctgatcgtgctagata 10800 gaaataacaaagaatgcacggttgctcaggctctaggtaacggagataaatttagggcca 10860 cagacaaacgcgttgtagattctctccgcgccatttgtgctgatctagaagggtcgagct 10920 ctccgctccccaaggtcgcacacaacttgggattttatttttcacctgatttaacacagt 10980 ttgctaaactcccagcagaacttgcacctcactggcctgtggtgacaacccagaacaatg 11040 aaaagtggccagatcggctggttaccagccttcgccctatccataaatatagccgcgcgt 11100 gcatcggtgccggctatatggtgggcccctcggtgtttctaggcactcctggggttgtgt 11160 catactatctcacaaaatttgttaagggcgaggctcaagtgcttccggagacggttttca 11220 gcaccggccgaattgaggtagactgccgggaatatcttgatgatcgggagcgagaggttg 11280 ctgcgtccctcccacatgccttcattggcgacgtcaaaggcactaccgttggaggatgcc 11340 accatgtcacctccagatacctcccgcgcttccttcccaaggaatcggttgcggtagtcg 11400 gggtttcaagtcccggaaaagccgcgaaagcattgtgcacactgacagatgtgtacctcc 11460 cagaccttgaagcctatttccacccggagacccagtccaagtgctggagaatgatgttgg 11520 acttcaaggaagttcgactaatggtctggaaagacaaaacagcctatttccaacttgaag 11580 gtcgctatttcacctggtatcagcttgctagctatgcctcgtacatccgtgttcctgtca 11640 actccacggtgtacttggacccttgcatgggccccgccctttgcaacaggaaagtcgtcg 11700 ggtccactcattggggagctgacctcgctgtcaccccttatgattacggcgctaaaatta 11760 tcctgtctagcgcgtaccatagtgaaatgccccccggatacaagattctggcgtgcgcgg 11820 aattctcgttggatgacccagtcaagtacaaacatacctgggggtttgaatcggatacag 11880 cgtatctgtatgagttcaccggaaacggtgaggactgggaggattacaatgatgcgtttc 11940 gtgcgcgccaggaagggaaaatttataaggctactgccaccagcatgaagttttattttc 12000 ccccgggccctgtcattgaaccaactttaggcctgaattgaaatgaaatggggtccatgc 12060 aaagcctttttgacaaaattggccaactttttgtggatgctttcacggagttcttggtgt 12120 ccattgttgatatcattgtatttttggccattttgtttggcttcaccatcgccggttggt 12180 tggtggtcttttgcatcagattggtttgctccgcgatactccgtgcgcgccctgccattc 12240 actctgagcaattacagaagatcttatgaagcctttctttcccagtgccaagtggacatt 12300 cccacctggggaactaaacatcctttggggatgttttggcaccataaggtgtcaaccctg 12360 attgatgagatggtgtcgcgtcgaatgtaccgcatcatggaaaaagcaggacaggctgcc 12420 tggaaacaggtggtgagcgaggctacgctgtctcgcattagtagtttggatgtggtggct 12480 cattttcagcatcttgccgccattgaagccgagacctgtaaatatttggcctcccggctg 12540 cccatgctacacaacctgcgcatgacagggtcaaatgtaaccatagtgtataatagtact 12600 ttgcatcaggtgtttgctatttttccaacccctggttcccggccaaagcttcatgatttt 12660 cagcaatggttaatagctgtacattcctccatattttcctctgttgcagcttcttgtact 12720 ctctttgttgtgctgtggttgcgggttccaatactacgtactgtttttggtttccgctgg 12780 ttaggggcaatttttctttcgaactcacagtgaattacacggtgtgtccaccttgcctca 12840 cccggcaagcagccgcagaggcctacgaacccggtaggtctctttggtgcaggatagggt 12900 atgaccgatgtggggaggacgatcatgacgagctagggtttatggtaccgtctggcctct 12960 ccagcgaaggccacttgaccagtgtttacgcctggttggcgttcttgtccttcagctaca 13020 cggcccagttccatcccgagatattcgggatagggaatgtgagtcgagtttatgttgaca 13080 tcgaacatcaactcatctgcgccgaacatgacgggcagaacaccaccttgcctcgtcatg 13140 acaacatttcagccgtgtttcagacctattaccaacatcaagtcgacggcggcaattggt 13200 ttcacctagaatggctgcgtcccttcttttcctcatggttggttttaaatgtctcttggt 13260 ttctcaggcgttcgcctgcaaaccatgtttcagttcgagtcttgcagacattaagaccaa 13320 caccaccgcagcggcaagctttgctgtcctccaagacatcagttgccttaggcatcgcaa 13380 ctcggcctctgaggcgattcgcaaaatccctcagtgccgtacggcgatagggacacccgt 13440 gtatattaccatcacagccaatgttacagatgagaattatttacattcttctgatctcct 13500 catgctttcttcttgccttttctatgcttctgagatgagtgaaaagggatttaaggtggt 13560 atttggcaatgtgtcaggcatcgtggctgtgtgtgtcaattttaccagctacgtccaaca 13620 tgtcagggagtttacccaacgctccttgatggtcgaccatgtgcggctgctccatttcat 13680 gacacctgagaccatgaggtgggcaactgttttagcctgtctttttgccattctgttggc 13740 aatttgaatgtttaagtatgttggggaaatgcttgaccgcgggctgttgctcgcgattgc 13800 tttctttgtggtgtatcgtgccgttctgttttgctgtgctcgtcaacgccaacagcaaca 13860 gcagctctcatctacagttgatttacaacttgacgctatgtgagctgaatggcacagatt 13920 ggctatctaataaatttgattgggcagtggagagttttgtcatctttcccgttttgactc 13980 acattgtctcctatggtgccctcactaccagccatttccttgacacagtcgctttagtca 14040 ctgtgtctaccgccgggtttgttcacgggcggtatgtcctgagcagcatctacgcggtct 14100 gtgccctggctgcgttgacttgcttcgtcattaggtttgcaaagaattgcatgtcctggc 14160 gctactcatgtaccagatatactaactttcttctggacactaagggcagactctatcgtt 14220 ggcggtcgcctgtcatcatagagaaaaggggcaaagttgaggtcgaaggtcatctgatcg 14280 acctcaaaagagttgtgcttgatggttccgtggcaacccctataaccagagtttcagcgg 14340 aacaatggggtcgtccttagatgacttttgttatgatagcacggctccacaaaaggtgct 14400 tttggcgttttctattacctacacgccagtgatgatatatgccctaaaagtgagtcgcgg 14460 ccgactgttagggcttctgcaccttttgatcttcctgaactgtgctttcaccttcgggta 14520 catgacattcgcgcactttcagagtacaaataaggtcgcgctcactatgggagcagtagt 14580 tgcactcctttggggggtgtattcagccatagaaacctggaaattcatcacctccagatg 14640 ccgtttgtgcttgctaggccgcaagtacattctggcccctgcccaccacgttgagagtgc 14700 cgcaggctttcatccgattgcggcaaatgataaccacgcatttgtcgtccggcgtcccgg 14760 ctccactacggtcaacggcacattggtgcccgggttgaaaggcctcgtgttgggtggcag 14820 aaaagctgttaaacagggagtggtaaaccttgtcaaatatgccaaataacaacggcaagc 14880 agcagaagagaaagaagggggatggccagccagtcaatcagctgtgccagatgctgggta 14940 agatcatcgcccagcaaaaccagtccagaggcaagggaccgggaaagaaaaataagaaga 15000 aaaacccggagaagccccattttcctctagcgactgaagatgatgtcagacatcacttta 15060 cccctagtgagcggcaattgtgtctgtcgtcaatccagactgcctttaatcaaggcgctg 15120 ggacttgcaccctgtcagattcagggaggataagttacactgtggagtttagtttgccta 15180 cgcatcatactgtgcgcctgatccgcgtcacagcatcaccctcagcatgatgggctggca 15240 ttcttgaggcatctcagtgtttgaattggaagaatgtgtggtgaatggcactgattgaca 15300 ttgtgcctctaagtcacctattcaattagggcgaccgtgtgggggtaagatttaattggc 15360 gagaaccatacggccgaaatt 15381
(155) TABLE-US-00004 TABLE4 SEQIDNO:2 N(11766)...(11766)<223> A,G,T,orC catttgtgttgtcaggagctgtgaccattggcacagcccaaaacttgctgcacggaagcg 60 cccttctgtgacagcctccttcaggggagcttgggggtctgtccctagcaccttgcttcc 120 ggagttgcactgctttacggtctctccacccctttaaccatgtctgggatacttgatcgg 180 tgcacgtgtacccccaatgccagggtgtttatggcggagggccaagtctactgcacacga 240 tgcctcagtgcacggtctctccttcctctgaatctccaagtttctgaactcggggtgcta 300 ggcctattctacaggcccgaagagccactccggtggacgttgccacgtgcattccccact 360 gttgagtgctcccccgccggggcctgctggctttctgcaatttttccaattgcacgaatg 420 accagtggaaacctgaacttccaacaaagaatggtacgggtcgcagctgaactttacaga 480 gccggccagctcacccctacagtcttaaagactttacaagtttatgaacggggttgccgc 540 tggtaccccatcgtaggacctgtccctggagtggccgttttcgccaactccctacatgtg 600 agtgataaacctttcccgggagcaactcacgtgttaaccaacctgccgctcccgcagaga 660 cccaagcctgaagacttttgcccctttgagtgtgctatggctaccgtctatgacattggt 720 catgacgccgtcatgtatgtggccgaagggaaagtctcctgggcccctcgtggcggggat 780 gaagtgaaatttgaaactgtccccggggagttggagttgattgcgaatcgactccgcacc 840 tccttcccgccccaccacacagtggacatgtctaagttcgccttcacagcccctgggcgt 900 ggtgtttctatgcgggtcgaacgccaacacggctgcctccccgctgacactgtccctgaa 960 ggcaactgctggtggagcttgtttaacttgctcccactggaagttcagaacaaagaaatt 1020 cgccatgctaaccaatttggctaccagaccaagcatggtgtctctggcaagtacctacgg 1080 cggaggctgcaagttaatggtctccgagcagtaactgacctgaatggacctatcgtcgta 1140 cagtacttctccgttaaggagagttggatccgccacttgaaactggcggaagaacccagc 1200 taccctgggtttgaggacctcctcagaataagggttgagcccaacacgtcgccattggct 1260 gacaaggatgaaaaaattttccggtttggcagtcacaagtggtacggcgctggaaagaga 1320 gcaaggaaagcacgctctagtgcgactgctacagtcgctggccgcgctttgtccgttcgt 1380 gaaacccggcaggccaaggagcacgaggttgccggcgccaacaaggctgggcacctcaaa 1440 cattactccccgcctgccgaagggaattgtggttggcactgcatttccgccatcgccaac 1500 cggatggtgaattccaaatttgaaaccacccttcccgaaagagtgagaccttcagatgac 1560 tgggctactgacgaggatcttgtgaatgccatccaaatcctcaggctccctgcggccttg 1620 aacaggaacggcgcttgtgctagcgccaagtacgtacttaagctggaaggtgagcattgg 1680 actgtcactgtgacccctgggatgtccccttctttgctccctcttgaatgtgttcagggc 1740 tgttgtgagcataagggcagtcttggttccccagatgcagtcgaggttttcggatttgac 1800 cctgcctgccttgaccggctggctgaggtgatgcacctgcctagcagtgctatcccagcc 1860 gctctggccgaaatgtccggcgattccgatcgttcggcttccccggtcaccaccgtgtgg 1920 actgtttcgcagttctttgcccgccacaatggagggaatcaccctgaccaagtgcgctta 1980 gggaaaattatcagcctttgtcaggtgattgaggactgctgctgttcccagaacaaaacc 2040 aaccgggtcaccccggaggaggtcgcagcaaagattgacctgtaccttcgtggcgcaaca 2100 aatcttgaagaatgcttggccaggcttgagaaagcgcgcccgccacgcgtaatggacacc 2160 tcctttgattgggatgttgtgctccctggggttgaggcggcaactcagacgaccgaactg 2220 ccccaggtcaaccagtgtcgcgctctggtccctgttgtaactcaaaagtccttggacaac 2280 aactcggtccccctgaccgccttttcactggctaactactactaccgtgcgcaaggtgac 2340 gaagttcgtcaccgtgaaagactaaccgccgtgctctccaagttggaaggggttgttcga 2400 gaagaatatgggctcatgccaaccgggcctggtccacggcccacactgccacgcgggctc 2460 gacgaactcaaagaccagatggaggaggacttgctgaaactggctaacgcccagacgact 2520 tcggacatgatggcctgggcagtcgagcaggttgacctaaaaacttgggtcaagaactac 2580 ccgcggtggacaccaccaccccctccgccaaaagttcagcctcgaaaaacgaagcctgtc 2640 aagagcttgccagagagaaagcctgtccccgccccgcgcaggaaggttgggtccgattgt 2700 ggcagcccgatttcattgggcgacgatgtccctaacagttgggaagatttggctgttggt 2760 agcccctttgatctctcgaccccacctgagctggcaacaccttcaagtgagctggtgatt 2820 gtgtccgcaccgcaatgcatcttcaggccggcgacacccttgagtgagccggctccaatt 2880 cccgcaccccgcggggttgtgtctcgaccggtgacacccttgaatgagccgatacctgtg 2940 cccgcaccgcggcgtaagtttcagcagatgagaagattgagttcggcggcggtaatcccg 3000 ccgtaccaggacgagcccctagatttgtctgcttcctcacagactgaatatgaggcctct 3060 cccctagcaccgccgcagagcgagggtgttctgggagtagaggggcaggaagctgaggaa 3120 gccctaagtgaaatctcggacatgtcgggtaacattaaacctgcgtccgtatcatcaagc 3180 agctccttgtccagcgtgagaatcactcgcccaaaatactcagctcaagccatcatcgac 3240 tcgggcgggccctgcagtgggcatctccaagaggtaaaggaaacatgcctcagtatcatg 3300 cgcgaggcatgtgatgcgactaagcttaagttcctcccaaaaatgatactcgagacaccg 3360 ccgccctatccgtgtgagtttgtgatgatgcctcacacgcctgcaccttccgtaggtgcg 3420 gagagcgaccttaccattggctcagtcgctactgaagatgttccacgcatcctcgagaaa 3480 atagaaaatgtcggcgagatgaccaaccagggacccttggccttctccgaggataaaccg 3540 gtagatgaccaacttgccaaagacccccggatatcgtcgcagaggtctgacgagagcaca 3600 tcagctccgcccgcaggcacaggtggcgccggctcatttaccgatttgccgccttcggac 3660 ggcgtggatgcggacggaggggggccgttttggacggtaaaaagaaaagctgaaaggctc 3720 tttgaccaactgagccgtcaggtttttgacctcgtctcccatctccctgttttcttctca 3780 cgccttttcaaccctggcggtggttattctccgggtgattggggttttgcagcttttact 3840 ctattgtgcctctttttatgttacagttacccagcctttggtattgctcccctcttgggt 3900 gtgttttctgggtcttctcggcgcgttcgaatgggggtttttggctgctggttggctttt 3960 gctgttggtctgttcaagtctgtgtccgacccagtcggcgctgcttgtgagtttgactcg 4020 ccagagtgtagaaatatccttcattcttttgagcttctcaaaccttgggaccctgttcgc 4080 agccttgttgtgggccccgtcggtctcggtcttgccattcttggcaggttactgggcggg 4140 gcacgcagcatctggcactttttgcttaggcttggcattgttgcagactgtgtcttggct 4200 ggagcttatgtgctttctcaaggtaggtgtaaaaagtgctggggatcttgtataagaact 4260 gctcctaatgaggtcgcttttaacgtgtttccttttacacgtgcgaccaggtcgtcacta 4320 atcgacctgtgcgatcggttttgtgcgccaaaaggcatggaccccatttttctcgccact 4380 gggtggcgcgggtgctgggccggccgaagccccattgagcaaccctctgaaaaacccatc 4440 gcgtttgcccagttggatgaaaagaagattacggctaggactgtggtcgcccagccttat 4500 gaccccaaccaagccgtaaagtgcttgcgggtattgcaggcgggtggggtgatggtggct 4560 aaggcagtcccaaaagtggtcaaggtttccgctgttccattccgagcccccttctttccc 4620 accggagtgaaagttgaccctgaatgcagggtcgtggttgaccccgacactttcaccgca 4680 gctctccggtctggctactccaccacaaacctcgtcctcggtgtaggggattttgcccag 4740 ctgaatggattaaaaatcaggcaaatttccaagccttcaggaggaggcccacacctcatg 4800 gctgccctgcatgttgcctgctcgatggctttgcacatgcttgctgggatttatgtgact 4860 gcggtgggttcttgcggcaccggcaccaacgacccgtggtgcgctaacccgtttgccgtc 4920 cctggctacggacctggctctctctgcacgtccagattgtgcatttcccaacatggcctt 4980 accctgcccttgacagcactcgtggcgggattcggtattcaagaaattgccttggtcgtt 5040 ttgatttttgtttccatcggaggcatggctcacaggttgagttgtaaggctgatatgctg 5100 tgtgttttgcttgcaattgccagctatgtttgggtacctcttacctggttgctttgtgtg 5160 tttccttgctggttgcgctgtttttctttgcatcccctcaccatcctatggttggtgttt 5220 ttcttgatttctgtgaatatgccttcaggaatcttggccatggtgttgttggtttctctt 5280 tggcttcttggtcgttatactaatgttgctggtcttgtcaccccctacgacattcatcat 5340 tacactagtggcccccgcggtgttgccgccttggctaccgcaccagatgggacctacttg 5400 gccgctgtccgccgcgctgcgttgactggccgcaccatgctgtttaccccgtcccagctt 5460 gggtctcttcttgagggtgctttcagaactcgaaaaccctcactgaacaccgtcaatgtg 5520 gtcgggtcctccatgggctctggcggggtgttcaccatcgacggaaaaattaagtgcgta 5580 actgccgcacatgtccttacgggcaattcagctagggtttccggggtcggcttcaatcaa 5640 atgcttgactttgacgtaaagggagatttcgccatagctgattgcccgaattggcaaggg 5700 gctgcccccaagacccaattctgcaaggatgggtggactggccgtgcctattggctaaca 5760 tcctctggcgtcgaacccggcgtcattggaaaaggattcgccttctgcttcaccgcgtgc 5820 ggcgattccgggtccccagtgatcaccgaggccggtgagcttatcggcgttcacacggga 5880 tcaaataaacaaggaggaggcatcgttacgcgcccctcaggccagttttgtaatgtggca 5940 cccatcaagctaagcgaattaagtgaattctttgctgggcctaaggtcccgctcggtgat 6000 gtgaaggttggcagccacataattaaagacataggcgaggtgccttcagatctttgtgcc 6060 ttgcttgctgccaaacctgaactggaaggaggcctctccaccgtccaacttctttgtgtg 6120 tttttcctcctgtggagaatgatgggacatgcctggacgcccttggttgctgtgggtttc 6180 tttatcttgaatgaggttctcccagccgtcctggtccggagtgttttctcctttggaatg 6240 tttgtgctatcctggctcacgccatggtctgcgcaagttctgatgatcaggcttctaaca 6300 gcagcccttaacaggaacagatggtcacttgcctttttcagcctcggtgcagtgaccggt 6360 tttgtcgcagatcttgcggctactcaggggcatccgttgcaggcagttatgaatttgagc 6420 acctatgcattcctgcctcggatgatggttgtgacctcaccagtcccagtgattgcgtgt 6480 ggtgttgtgcacctacttgccatcattttgtacttgtttaagtaccgtggcctgcaccaa 6540 atccttgttggcgatggagtgttctctgcggctttcttcctgcgatactttgccgaggga 6600 aagttgagggaaggggtgtcgcaatcctgcggaatgaatcatgagtctctgactggtgcc 6660 ctcgctatgagactcaatgacgaggacttggatttccttacgaaatggactgattttaag 6720 tgctttgtttctgcgtccaacatgaggaatgcagcgggtcaatttatcgaggctgcctat 6780 gctaaagcacttagagtagagcttgcccagttggtgcaggttgataaagttcgaggaact 6840 ttggccaaacttgaagcctttgctgataccgtggcaccccaactctcgcccggtgacatt 6900 gttgtcgctctcggccatacgcctgttggcagtatcttcgacctaaaggttggtagcacc 6960 aagcataccctccaagccattgagaccagagtccttgctgggtccaaaatgaccgtggcg 7020 cgcgtcgtcgacccgacccccacgcccccacccgcacctgtgcccatccccctcccaccg 7080 aaagttctggagaatggccccaacgcttggggggatgaggaccgtttgaataagaagaag 7140 aggcgcaggatggaagccctcggcatctatgttatgggcgggaaaaagtaccagaaattt 7200 tgggataagaattccggtgatgtgttttatgaggaggtccataataacacagatgagtgg 7260 gagtgtctcagagttggcgaccctgccgactttgaccctgagaagggaactctgtgtgga 7320 catgtcaccattgaagataaggcttaccatgtttacacctcaccatctggtaagaagttc 7380 ttggtccccgtcaatccagagaatggaagagtccaatgggaagctgcaaagctttccgta 7440 gagcaggcccttggtatgatgaacgtcgacggcgaactgactaccaaagaactggagaaa 7500 ctgaaaagaataattgacaaactccagggcctgactaaggagcagtgtttaaactgctag 7560 ccgccagcggcttgacccgctgtggtcgcggcggcttggttgttactgaaacagcggtaa 7620 aaatagtcaaatttcacaaccggaccttcaccctgggacctgtgaatttaaaagtggcca 7680 gtgaggttgagctaaaagacgcggttgagcacaaccaacacccggttgcgagaccggtcg 7740 atggtggtgttgtgctcctgcgttccgcggttccttcgcttatagacgtcttgatctccg 7800 gtgctgatgcatctcccaagttgcttgcccatcacgggccgggaaacactgggatcgatg 7860 gcacgctctgggattttgagtccgaagccactaaagaggaagtcgcacttagtgcgcaaa 7920 taatacaggcttgtgacattaggcgcggcgacgctcctgaaattggtctcccttacaagc 7980 tgtaccctgttaggggtaaccctgagcgggtaaaaggagttctacagaatacaaggtttg 8040 gagacataccttacaaaacccccagtgatactggaaacccagtgcacgcggctgcctgcc 8100 ttacgcccaacgccactccggtgactgatgggcgctccgtcttggccacgaccatgccct 8160 ccgggtttgagttgtatgtaccaaccataccagcgtctgtccttgattaccttgattcta 8220 ggcctgactgccctaaacagttgacagagcacggctgtgaagatgccgcactgagagacc 8280 tctccaaatatgacttgtccacccaaggctttgttttacctggagtttttcgccttgtac 8340 ggaaatacctgtttgcccatgtaggtaagtgcccacccgttcatcggccttctacttacc 8400 ctgctaagaattctatggctggaataaatgggaataggttcccaaccaaggatattcaga 8460 gcgtccctgaaatcgacgttctgtgtgcacaggctgtgcgggaaaactggcaaactgtta 8520 ccccttgtactcttaagaaacagtattgcgggaagaagaagactaggaccatactcggca 8580 ccaataattttatcgcgctagcccaccgagcagcgttgagtggtgtcacccagggcttca 8640 tgaaaaaggcgtttaactcgcccatcgccctcggaaaaaacaagtttaaggagctacaga 8700 ccccggtcctaggcaggtgccttgaagctgatcttgcatcctgcgaccgatccacacctg 8760 caattgtccgctggtttgccgccaacctcctttatgaacttgcctgcgctgaagagcatt 8820 taccgtcgtacgtgctgaactgctgccacgacttactggtcacgcagtccggcgcagtga 8880 ctaagagaggtggcctgtcgtctggcgacccgatcacctctgtgtctaacaccatttaca 8940 gtttggtgatctatgcacagcatatggtgctcagttacttcaaaagtggtcacccccatg 9000 gcctcttgttcttacaagaccagctaaagtttgaggacatgctcaaggttcaacccctga 9060 tcgtctattcggacgacctcgtgctgtatgccgagtctcccaccatgccaaactatcact 9120 ggtgggttgaacacctgaatttgatgctggggtttcagacggatccaaaaaagacagcca 9180 taacagactcgccatcatttctaggctgtagaataataaatggacgccagctagtcccca 9240 accgtgacaggattctcgcggccctcgcctaccacatgaaggcgagtaatgtttctgaat 9300 actacgcctcagcggctgcaatactcatggacagctgtgcttgtttggagtatgatcctg 9360 aatggtttgaagaacttgtagttggaatagcgcaatgcgcccgcaaggacggttacagct 9420 ttcccggcacgccgttctttatgtccatgtgggaaaaactcaggtccaattatgagggga 9480 agaagtcgagagtgtgcgggtactgcggggccccggccctgtacgctactgcctgtggcc 9540 tcgacgtctgcatttaccacacccacttccaccagcattgtccagtcacaatctggtgtg 9600 gccatccagcgggttctggttcttgtagtgagtgcaaatcccctgtagggaaaggcacaa 9660 gccctttagacgaggtgctggaacaagtcccgtacaagcccccacggaccgttatcatgc 9720 atgtggagcagggtctcaccccccttgacccaggtagataccagactcgccgcggattag 9780 tctccgtcaggcgtggaatcaggggaaatgaggttgaactaccagacggtgattatgcta 9840 gtaccgccttgctccctacctgtaaagagatcaacatggtcgctgttgcttccaatgtat 9900 tgcgcagcaggttcatcattggtccacccggtgctgggaaaacatactggctccttcaac 9960 aggtccaggatggtgatgttatttacacaccaacccaccagaccatgcttgacatgatta 10020 gggctttggggacgtgccggttcaacgtcccggcaggcacaacgctgcaattccccgtcc 10080 cctcccgtaccggtccgtgggttcgcatcctggccggcggttggtgtcctggcaagaatt 10140 ccttcctggatgaagcagcgtattgcaatcaccttgatgtcttgaggcttcttagcaaaa 10200 ctaccctcacctgtctgggagacttcaaacaactccacccagtgggttttgattctcatt 10260 gctatgtttttaacatcatgcctcaaactcaactgaagaccatctggaggtttggacaga 10320 atatctgtgatgccatccagccagattacagggacaaactcatgtccatggtcaacacaa 10380 cccgtgtgacctacgtggaaaagcctgtcaggtatgggcaagtcctcaccccctaccaca 10440 gggaccgagaggacgacgccatcactattgactccagtcaaggcgccacattcgatgtgg 10500 ttacactgcatttgcccacaaaagattcactcaacaggcagagagcccttgttgctatca 10560 ccagggcaagacatgctatctttgtgtatgacccacacaggcagctgcagagcctgtttg 10620 atcttcctgcaaaaggtacacccgtcaaccttgcagtgcaccgcgacgggcagctgatcg 10680 tgctagatagaaataacaaagaatgcacggttgctcaggctctaggtaacggagataaat 10740 ttagggccacagacaaacgcgttgtagattctctccgcgccatttgtgctgatctagaag 10800 ggtcgagctctccgctccccaaggtcgcacacaacttgggattttatttctcacctgatt 10860 taacacagtttgctaaactcccagcagaacttgcacctcactggcccgtggtgacaaccc 10920 agaacaatgaaaagtggccagatcggctggttaccagccttcgccctatccataaatata 10980 gccgcgcgtgcatcggtgccggctatatggtgggcccctcggtgtttctaggcactcctg 11040 gggtcgtgtcatactatctcacaaaatttgttaagggcgaggctcaagtgcttccggaga 11100 cggttttcagcaccggccgaattgaggtagactgccgggaatatcttgatgatcgggagc 11160 gagaggttgctgcgtccctcccacatgccttcattggcgacgtcaaaggcactaccgttg 11220 gaggatgccaccatgtcacctccagatacctcccgcgcttccttcccaaggaatcggttg 11280 cggtagtcggggtttcaagtcccggaaaagccgcgaaagcattgtgcacactgacagatg 11340 tgtacctcccagaccttgaagcctatttccacccggagacccagtccaagtgctggagaa 11400 tgatgttggacttcaaggaagttcgactaatggtctggaaagacaaaacagcctatttcc 11460 aacttgaaggtcgctatttcacctggtatcagcttgctagctatgcctcgtacatccgtg 11520 ttcctgtcaactccacggtgtacttggacccctgcatgggccccgccctttgcaacagga 11580 aagtcgtcgggtccactcattggggagctgacctcgctgtcaccccttatgattacggcg 11640 ctaaaattatcctgtctagcgcgtaccatagtgaaatgccccccggatacaagattctgg 11700 cgtgcgcggaattctcgttggatgacccagtcaagtacaaacatacctgggggtttgaat 11760 cggatncagcgtatctgtatgagttcaccggaaacggtgaggactgggaggattacaatg 11820 atgcgtttcgtgcgcgccaggaagggaaaatttataaggctactgccaccagcatgaagt 11880 tttattttcccccgggccctgtcattgaaccaactttaggcctgaattgaaatgaaatgg 11940 ggtccatgcaaagcctttttgacaaaattggccaactttttgtggatgctttcacggagt 12000 tcttggtgtccattgttgatatcattatatttttggccattttgtttggcttcaccatcg 12060 ccggttggttggtggtcttttgcatcagattggtttgctccgcgatactccgtacgcgcc 12120 ctgccattcactctgagcaattacagaagatcttatgaagcctttctttcccagtgccaa 12180 gtggacattcccacctggggaactaaacatcctttggggatgttttggcaccataaggtg 12240 tcaaccctgattgatgagatggtgtcgcgtcgaatgtaccgcatcatggaaaaagcagga 12300 caggctgcctggaaacaggtggtgagcgaggctacgctgtctcgcattagtagtttggat 12360 gtggtggctcattttcagcatcttgccgccattgaagccgagacctgtaaatatttggcc 12420 tcccggctgcccatgctacacaacctgcgcatgacagggtctaatgtaaccatagtgtat 12480 aatagtactttgcatcaggtgtttgctatttttccaacccctggttcccggccaaagctt 12540 catgattttcagcaatggttaatagctgtacattcctccatattttcctctgttgcagct 12600 tcttgtactctctttgttgtgctgtggttgcgggttccaatactacgtactgtttttggt 12660 ttccgctggttaggggcaatttttctttcgaactcacagtgaattacacggtgtgtccac 12720 cttgcctcacccggcaagcagccgcagaggcctacgaacccggtaggtctctttggtgca 12780 ggatagggtatgaccgatgtggggaggacgatcatgacgagctagggtttatggtaccgt 12840 ctggcctctccagcgaaggccacttgaccagtgtttacgcctggttggcgttcttgtcct 12900 tcagctacacggcccagttccatcccgagatattcgggatagggaatgtgagtcgagttt 12960 atgttgacatcgaacatcaactcatctgcgccgaacatgacgggcagaacaccaccttgc 13020 ctcgtcatgacaacatttcagccgtgtttcagacctattaccaacatcaagtcgacggcg 13080 gcaattggtttcacctagaatggctgcgtcccttcttttcctcatggttggttttaaatg 13140 tctcttggtttctcaggcgttcgcctgcaaaccatgtttcagttcgagtcttgcagacat 13200 taagaccaacaccaccgcagcggcaagctttgctgtcctccaagacatcagttgccttag 13260 gcatcgcaactcggcctctgaggcgattcgcaaaatccctcagtgccgtacggcgatagg 13320 gacacccgtgtatattaccatcacagccaatgtgacagatgagaattatttacattcttc 13380 tgatctcctcatgctttcttcttgccttttctatgcttctgagatgagtgaaaagggatt 13440 taaggtggtatttggcaatgtgtcaggcatcgtggctgtgtgtgtcaattttaccagcta 13500 cgtccaacatgtcagggagtttacccaacgctccttgatggtcgaccatgtgcggctgct 13560 ccatttcatgacacctgagaccatgaggtgggcaactgttttagcctgtctttttgccat 13620 tctgttggcaatttgaatgtttaagtatgttggggaaatgcttgaccgcgggctgttgct 13680 cgcgattgctttctttgtggtgtatcgtgccgttctgttttgctgtgctcgtcaacgcca 13740 acagcaacagcagctctcatctacagttgatttacaacttgacgctatgtgagctgaatg 13800 gcacggattggctatctaataaatttgattgggcagtggagagttttgtcatctttcccg 13860 ttttgactcacattgtctcctatggtgccctcactaccagccatttccttgacacagtcg 13920 ctttagtcactgtgtctaccgccgggtttgttcacgggcggtatgtcctgagcagcatct 13980 acgcggtctgtgccctggctgcgttgacttgcttcgtcatcaggtttgcaaagaattgca 14040 tgtcctggcgctactcatgtaccagatatactaactttcttctggacactaagggcagac 14100 tctatcgttggcggtcgcctgtcatcatagagaaaaggggcaaagttgaggtcgaaggtc 14160 atctgatcgacctcaaaagagttgtgcttgatggttccgtggcaacccctataaccagag 14220 tttcagcggaacaatggggtcgtccttagatgacttttgttatgatagcacggctccaca 14280 aaaggtgcttttggcgttttctattacctacacgccagtgatgatatatgccctaaaagt 14340 gagtcgcggccgactgttagggcttctgcaccttttgatcttcctgaactgtgctttcac 14400 cttcgggtacatgacattcgcgcactttcagagtacaaataaggtcgcgctcactatggg 14460 agcagtagttgcactcctttggggggtgtattcagccatagaaacctggaaattcatcac 14520 ctccagatgccgtttgtgcttgctaggccgcaagtacattctggcccctgcccaccacgt 14580 tgagagtgccgcaggctttcatccgattgcggcaaatgataaccacgcatttgtcgtccg 14640 gcgtcccggctccactacggtcaacggcacattggtgcccgggttgaaaggcctcgtgtt 14700 gggtggcagaaaagctgttaaacagggagtggtaaaccttgtcaaatatgccaaataaca 14760 acggcaagcagcagaagagaaagaagggggatggccagccagtcaatcagctgtgccaga 14820 tgctgggtaagatcatcgcccagcaaaaccagtccagaggcaagggaccgggaaagaaaa 14880 ataagaagaaaaacccggagaagccccattttcctctagcgactgaagatgatgtcagac 14940 atcactttacccctagtgagcggcaattgtgtctgtcgtcaatccagactgcctttaatc 15000 aaggcgctgggacttgcaccctgtcagattcagggaggataagttacactgtggagttta 15060 gtttgcctacgcatcatactgtgcgcctgatccgcgtcacagcatcaccctcagcatgat 15120 gggctggcattcttgaggcatctcagtgtttgaattggaagaatgtgtggtgaatggcac 15180 tgattgacattgtgcctctaagtcacctattcaattagggcgaccgtgtgggggtaagat 15240 ttaattggcgagaaccatacggccgaaatt 15270
(156) TABLE-US-00005 TABLE5 SEQIDNO:3 catttgtgttgtcaggagctgtgaccattggcacagcccaaaacttgctgcacggaagcg 60 cccttctgtgacagcctccttcaggggagcttgggggtctgtccctagcaccttgcttcc 120 ggagttgcactgctttacggtctctccacccctttaaccatgtctgggatacttgatcgg 180 tgcacgtgtacccccaatgccagggtgtttatggcggagggccaagtctactgcacacga 240 tgcctcagtgcacggtctctccttcctctgaatctccaagtttctgaactcggggtgcta 300 ggcctattctacaggcccgaagagccactccggtggacgttgccacgtgcattccccact 360 gttgagtgctcccccgccggggcctgctggctttctgcaatttttccaattgcacgaatg 420 accagtggaaacctgaacttccaacaaagaatggtacgggtcgcagctgaactttacaga 480 gccggccagctcacccctacagtcttaaagactttacaagtttatgaacggggttgccgc 540 tggtaccccatcgtaggacctgtccctggagtggccgttttcgccaactccctacatgtg 600 agtgataaacctttcccgggagcaactcacgtgttaaccaacctgccgctcccgcagaga 660 cccaagcctgaagacttttgcccctttgagtgtgctatggctaccgtctatgacattggt 720 catgacgccgtcatgtatgtggccgaagggaaagtctcctgggcccctcgtggcggggat 780 gaagtgaaatttgaaactgtccccggggagttggagttgattgcgaatcgactccgcacc 840 tccttcccgccccaccacacagtggacatgtctaagttcgccttcacagcccctgggcgt 900 ggtgtttctatgcgggtcgaacgccaacacggctgcctccccgctgacactgtccctgaa 960 ggcaactgctggtggagcttgtttaacttgctcccactggaagttcagaacaaagaaatt 1020 cgccatgctaaccaatttggctaccagaccaagcatggtgtctctggcaagtacctacag 1080 cggaggctgcaagttaatggtctccgagcagtaactgacctgaatggacctatcgtcgta 1140 cagtacttctccgttaaggagagttggatccgccacttgaaactggcggaagaacccagc 1200 taccctgggtttgaggacctcctcagaataagggttgagcccaacacgtcgccattggct 1260 gacaaggatgaaaaaattttccggtttggcagtcacaagtggtacggcgctggaaagaga 1320 gcaaggaaagcacgctctagtgcgactgctacagtcgctggccgcgctttgtccgttcgt 1380 gaaacccggcaggccaaggagcacgaggttgccggcgccaacaaggctgggcacctcaaa 1400 cattactccccgcctgccgaagggaattgtggttggcactgcatttccgccatcgccaac 1500 cggatggtgaattccaaatttgaaaccacccttcccgaaagagtgagaccttcagatgac 1560 tgggctactgacgaggatcttgtgaatgccatccaaatcctcaggctccctgcggccttg 1620 aacaggaacggcgcttgtgctagcgccaagtacgtacttaagctggaaggtgagcattgg 1680 actgtcactgtgacccctgggatgtccccttctttgctccctcttgaatgtgttcagggc 1740 tgttgtgagcataagggcagtcttggttccccagatgcagtcgaggttttcggatttgac 1800 cctgcttgccttgaccggctggctgaggtgatgcacctgcctagcagtgctatcccagcc 1860 gctctggccgaaatgtccggcgattccgatcgttcggcttccccggtcaccaccgtgtgg 1920 actgtttcgcagttctttgcccgccacaatggagggaatcaccctgaccaagtgcgctta 1980 gggaaaattatcagcctttgtcaggtgattgaggactgctgctgttcccagaacaaaacc 2040 aaccgggtcaccccggaggaggtcgcagcaaagattgacctgtaccttcgtggcgcaaca 2100 aatcttgaagaatgcttggccaggcttgagaaagcgcgcccgccacgcgtaatggacacc 2160 tcctttgattgggatgttgtgctccctggggttgaggcggcaactcagacgaccgaactg 2220 ccccaggtcaaccagtgtcgcgctctggtccctgttgtaactcaaaagtccttggacaac 2280 aactcggtccccctgaccgccttttcactggctaactaacactaccgtgcgcaaggtgac 2340 gaagttcgtcaccgtgaaagactaaccgccgtgctctccaagttggaaggggttgttcga 2400 gaagaatatgggctcatgccaaccgggcctggtccacggcccacactgccacgcgggctc 2460 gacgaactcaaagaccagatggaggaggacttgctgaaactggctaacgcccagacgact 2520 tcggacatgatggcctgggcagtcgagcaggttgacctaaaaacttgggtcaagaactac 2580 ccgcggtggacaccaccaccccctccgccaaaagttcagcctcgaaaaacgaagcctgtc 2640 aagagcttgccagagagaaagcctgtccccgccccgcgcaggaaggttgggtccgattgt 2700 ggcagcccgatttcattgggcgacgatgtccctaacagttgggaagatttggctgttggt 2760 agcccctttgatctctcgaccccacctgagctggcaacaccttcaagtgagctggtgatt 2820 gtgtccgcaccgcaatgcatcttcaggccggcgacacccttgagtgagccggctccaatt 2880 cccgcaccccgcggggttgtgtctcgaccggtgacacccttgaatgagccgatacctgtg 2940 cccgcaccgcggcgtaagtttcagcagatgagaagattgagttcggcggcggtaatcccg 3000 ccgtaccaggacgagcccctagatttgtctgcttcctcacagactgaatatgaggcctct 3060 cccctagcaccgccgcagagcgagggtgttctgggagtagaggggcaggaagctgaggaa 3120 gccctaagtgaaatctcggacatgtcgggtaacattaaacctgcgtccgtatcatcaagc 3180 agctccttgtccagcgtgagaatcactcgcccaaaatactcagctcaagccatcatcgac 3240 tcgggcgggccctgcagtgggcatctccaagaggtaaaggaaacatgcctcagtatcatg 3300 cgcgaggcatgtgatgcgactaagcttgatgaccctgctacgcaggagtggctttctcgc 3360 atgtgggatcgggtggacatgctgacttggcgcaacacgtctgcttaccaggcgtttcgc 3420 accttagatggcaggttaaagttcctcccaaaaatgatactcgagacaccgccgccctat 3480 ccgtgtgagtttgtgatgatgcctcacacgcctgcaccttccgtaggtgcggagagcgac 3540 cttaccattggctcagtcgctactgaagatgttccacgcatcctcgagaaaatagaaaat 3600 gtcggcgagatgaccaaccagggacccttggccttctccgaggataaaccggtagatgac 3660 caacttgccaaagacccccggatatcgtcgcagaggtctgacgagagcacatcagctccg 3720 cccgcaggcacaggtggcgccggctcatttaccgatttgccgccttcggacggcgtggat 3780 gcggacggaggggggccgttttggacggtaaaaagaaaagctgaaaggctctttgaccaa 3840 ctgagccgtcaggtttttgacctcgtctcccatctccctgttttcttctcacgccttttc 3900 aaccctggcggtggttattctccgggtgattggggttttgcagcttttactctattgtgc 3960 ctctttttatgttacagttacccagcctttggtattgctcccctcttgggtgtgttttct 4020 gggtcttctcggcgcgttcgaatgggggtttttggctgctggttggcttttgctgttggt 4080 ctgttcaagcctgtgtccgacccagtcggcgctgcttgtgagtttgactcgccagagtgt 4140 agaaatatccttcattcttttgagcttctcaaaccttgggaccctgttcgcagccttgtt 4200 gtgggccccgtcggtctcggtcttgccattcttggcaggttactgggcggggcacgcagc 4260 atctggcactttttgcttaggcttggcattgttgcagactgtgtcttggctggagcttat 4320 gtgctttctcaaggtaggtgtaaaaagtgctggggatcttgtataagaactgctcctaat 4380 gaggtcgcttttaacgtgtttccttttacacgtgcgaccaggtcgtcactaatcgacctg 4440 tgcgatcggttttgtgcgccaaaaggcatggaccccatttttctcgccactgggtggcgc 4500 gggtgctgggccggccgaagccccattgagcaaccctctgaaaaacccatcgcgtttgcc 4560 cagttggatgaaaagaagattacggctaggactgtggtcgcccagccttatgaccccaac 4620 caagccgtaaagtgcttgcgggtattgcaggcgggtggggtgatggtggctaaggcagtc 4680 ccaaaagtggtcaaggtttccgctgttccattccgagcccccttctttcccaccggagtg 4740 aaagttgaccctgaatgcagggtcgtggttgaccccgacactttcaccgcagctctccgg 4800 tctggctactccaccacaaacctcgtcctcggtgtaggggattttgcccagctgaatgga 4860 ttaaaaatcaggcaaatttccaagccttcaggaggaggcccacacctcatggctgccctg 4920 catgttgcctgctcgatggctttgcacatgcttgctgggatttatgtgactgcggtgggt 4980 tcttgcggcaccggcaccaacgacccgtggtgcgctaacccgtttgccgtccctggctac 5040 ggacctggctctctctgcacgtccagattgtgcatttcccaacatggccttaccctgccc 5100 ttgacagcactcgtggcgggattcggtattcaagaaattgccttggtcgttttgattttt 5160 gtttccatcggaggcatggctcacaggttgagttgtaaggctgatatgctgtgtgttttg 5220 cttgcaattgccagctatgtttgggtacctcttacctggttgctttgtgtgtttccttgc 5280 tggttgcgctgtttttctttgcatcccctcaccatcctatggttggtgtttttcttgatt 5340 tctgtgaatatgccttcaggaatcttggccatggtgttgttggtttctctttggcttctt 5400 ggtcgttatactaatgttgctggtcttgtcaccccctacgacattcatcattacactagt 5460 ggcccccgcggtgttgccgccttggctaccgcaccagatgggacctacttggccgctgtc 5520 cgccgcgctgcgttgactggccgcaccatgctgtttaccccgtcccagcttgggtctctt 5580 cttgagggtgctttcagaactcgaaaaccctcactgaacaccgtcaatgtggtcgggtcc 5640 tccatgggctctggcggggtgttcaccatcgacggaaaaattaagtgcgtaactgccgca 5700 catgtccttacgggcaattcagctagggtttccggggtcggcttcaatcaaatgcttgac 5760 tttgacgtaaagggagatttcgccatagctgattgcccgaattggcaaggggctgccccc 5820 aagacccaattctgcaaggatgggtggactggccgtgcctattggctaacatcctctggc 5880 gtcgaacccggcgtcattggaaaaggattcgccttctgcttcaccgcgtgcggcgattcc 5940 gggtccccagtgatcaccgaggccggtgagcttatcggcgttcacacgggatcaaataaa 6000 caaggaggaggcatcgttacgcgcccctcaggccagttttgtaatgtggcacccatcaag 6060 ctaagcgaattaagtgaattctttgctgggcctaaggtcccgctcggtgatgtgaaggtt 6120 ggcagccacataattaaagacataggcgaggtgccttcagatctttgtgccttgcttgct 6180 gccaaacctgaactggaaggaggcctctccaccgtccaacttctttgtgtgtttttcctc 6240 ctgtggagaatgatgggacatgcctggacgcccttggttgctgtgggtttctttatcttg 6300 aatgaggttctcccagccgtcctggtccggagtgttttctcctttggaatgtttgtgcta 6360 tcctggctcacgccatggtctgcgcaagttctgatgatcaggcttctaacagcagccctt 6420 aacaggaacagatggtcacttgcctttttcagcctcggtgcagtgaccggttttgtcgca 6480 gatcttgcggctactcaggggcatccgttgcaggcagttatgaatttgagcacctatgca 6540 ttcctgcctcggatgatggttgtgacctcaccagtcccagtgattgcgtgtggtgttgtg 6600 cacctacttgccatcattttgtacttgtttaagtaccgtggcctgcaccaaatccttgtt 6660 ggcgatggagtgttctctgcggctttcttcctgcgatactttgccgagggaaagttgagg 6720 gaaggggtgtcgcaatcctgcggaatgaatcatgagtctctgactggtgccctcgctatg 6780 agactcaatgacgaggacttggatttccttacgaaatggactgattttaagtgctttgtt 6840 tctgcgtccaacatgaggaatgcagcgggtcaatttatcgaggctgcctatgctaaagca 6900 cttagagtagagcttgcccagttggtgcaggttgataaagttcgaggaactttggccaaa 6960 cttgaagcctttgctgataccgtggcaccccaactctcgcccggtgacattgttgtcgct 7020 ctcggccatacgcctgttggcagtatcttcgacctaaaggttggtagcaccaagcatacc 7080 ctccaagccattgagaccagagtccttgctgggtccaaaatgaccgtggcgcgcgtcgtc 7140 gacccgacccccacgcccccacccgcacctgtgcccatccccctcccaccgaaagttctg 7200 gagaatggccccaacgcttggggggatgaggaccgtttgaataagaagaagaggcgcagg 7260 atggaagccctcggcatctatgttatgggcgggaaaaagtaccagaaattttgggataag 7320 aattccggtgatgtgttttatgaggaggtccataataacacagatgagtgggagtgtctc 7380 agagttggcgaccctgccgactttgaccctgagaagggaactctgtgtggacatgtcacc 7440 attgaagataaggcttaccatgtttacacctcaccatctggtaagaagttcttggtcccc 7500 gtcaatccagagaatggaagagtccaatgggaagctgcaaagctttccgtagagcaggcc 7560 cttggtatgatgaacgtcgacggcgaactgactaccaaagaactggagaaactgaaaaga 7620 ataattgacaaactccagggcctgactaaggagcagtgtttaaactgctagccgccagcg 7680 gcttgacccgctgtggtcgcggcggcttggttgttactgaaacagcggtaaaaatagtca 7740 aatttcacaaccggaccttcaccctgggacctgtgaatttaaaagtggccagtgaggttg 7800 agctaaaagacgcggttgagcacaaccaacacccggttgcgagaccggtcgatggtggtg 7860 ttgtgctcctgcgttccgcggttccttcgcttatagacgtcttgatctccggtgctgatg 7920 catctcccaagttgcttgcccatcacgggccgggaaacactgggatcgatggcacgctct 7980 gggattttgagtccgaagccactaaagaggaagtcgcacttagtgcgcaaataatacagg 8040 cttgtgacattaggcgcggcgacgctcctgaaattggtctcccttacaagctgtaccctg 8100 ttaggggtaaccctgagcgggtaaaaggagttctacagaatacaaggtttggagacatac 8160 cttacaaaacccccagtgatactggaaacccagtgcacgcggctgcctgccttacgccca 8220 acgccactccggtgactgatgggcgctccgtcttggccacgaccatgccctccgggtttg 8280 agttgtatgtaccaaccataccagcgtctgtccttgattaccttgattctaggcctgact 8340 gccctaaacagttgacagagcacggctgtgaagatgccgcactgagagacctctccaaat 8400 atgacttgtccacccaaggctttgttttacctggagtttttcgccttgtacggaaatacc 8460 tgtttgcccatgtaggtaagtgcccacccgttcatcggccttctacttaccctgctaaga 8520 attctatggctggaataaatgggaataggttcccaaccaaggatattcagagcgtccctg 8580 aaatcgacgttctgtgtgcacaggctgtgcgggaaaactggcaaactgttaccccttgta 8640 ctcttaagaaacagtattgcgggaagaagaagactaggaccatactcggcaccaataatt 8700 ttatcgcgctagcccaccgagcagcgttgagtggtgtcacccagggcttcatgaaaaagg 8760 cgtttaactcgcccatcgccctcggaaaaaacaagtttaaggagctacagaccccggtcc 8820 taggcaggtgccttgaagctgatcttgcatcctgcgaccgatccacacctgcaattgtcc 8880 gctggtttgccgccaacctcctttatgaacttgcctgcgctgaagagcatttaccgtcgt 8940 acgtgctgaactgctgccacgacttactggtcacgcagtccggcgcagtgactaagagag 9000 gtggcctgtcgtctggcgacccgatcacctctgtgtctaacaccatttacagtttggtga 9060 tctatgcacagcatatggtgctcagttacttcaaaagtggtcacccccatggcctcttgt 9120 tcttacaagaccagctaaagtttgaggacatgctcaaggttcaacccctgatcgtctatt 9180 cggacgacctcgtgctgtatgccgagtctcccaccatgccaaactatcactggtgggttg 9240 aacacctgaatttgatgctggggtttcagacggatccaaaaaagacagccataacagact 9300 cgccatcatttctaggctgtagaataataaatggacgccagctagtccccaaccgtgaca 9360 ggattctcgcggccctcgcctaccacatgaaggcgagtaatgtttctgaatactacgcct 9420 cagcggctgcaatactcatggacagctgtgcttgtttggagtatgatcctgaatggtttg 9480 aagaacttgtagttggaatagcgcaatgcgcccgcaaggacggttacagctttcccggca 9540 cgccgttctttatgtccatgtgggaaaaactcaggtccaattatgaggggaagaagtcga 9600 gagtgtgcgggtactgcggggccccggccccgtacgctactgcctgtggcctcgacgtct 9660 gcatttaccacacccacttccaccagcattgtccagtcacaatctggtgtggccatccag 9720 cgggttctggttcttgtagtgagtgcaaatcccctgtagggaaaggcacaagccctttag 9780 acgaggtgctggaacaagtcccgtacaagcccccacggaccgttatcatgcgtgtggagc 9840 agggtcttaccccccttgacccaggtagataccagactcgccgcggattagtctccgtca 9900 ggcgtggaatcaggggaaatgaggttgaactaccagacggtgattatgctagtaccgcct 9960 tgctccctacctgtaaagagatcaacatggtcgctgttgcttccaatgtattgcgcagca 10020 ggttcatcattggtccacccggtgctgggaaaacatactggctccttcaacaggtccagg 10080 atggtgatgttatttacacaccaacccaccagaccatgcttgacatgattagggctttgg 10140 ggacgtgccggttcaacgtcccggcaggcacaacgctgcaattccccgtcccctcccgta 10200 ccggtccgtgggttcgcatcctggccggcggttggtgtcctggcaagaattccttcctgg 10260 atgaagcagcgtattgcaatcaccttgatgtcttgaggcttcttagcaaaactaccctca 10320 cctgtctgggagacttcaaacaactccacccagtgggttttgattctcattgctatgttt 10380 ttaacatcatgcctcaaactcaactgaagaccatctggaggtttggacagaatatctgtg 10440 atgccatccagccagattacagggacaaactcatgtccatggtcaacacaacccgtgtga 10500 cctacgtggaaaagcctgtcaggtatgggcaagtcctcaccccctaccacagggaccgag 10560 aggacgacgccatcactattgactccagtcaaggcgccacattcgatgtggttacactgc 10620 atttgcccacaaaagattcactcaacaggcagagagcccttgttgctatcaccagggcaa 10680 gacatgctatctttgtgtatgacccacacaggcagctgcagagcctgtttgatcttcctg 10740 caaaaggtacacccgtcaaccttgcagtgcaccgcgacgggcagctgatcgtgctagata 10800 gaaataacaaagaatgcacggttgctcaggctctaggtaacggagataaatttagggcca 10860 cagacaaacgcgttgtagattctctccgcgccatttgtgctgatctagaagggtcgagct 10920 ctccgctccccaaggtcgcacacaacttgggattttatttctcacctgatttaacacagt 10980 ttgctaaactcccagcagaacttgcacctcactggcccgtggtgacaacccagaacaatg 11040 aaaagtggccagatcggctggttaccagccttcgccctatccataaatatagccgcgcgt 11100 gcatcggtgccggctatatggtgggcccctcggtgtttctaggcactcctggggtcgtgt 11160 catactatctcacaaaatttgttaagggcgaggctcaagtgcttccggagacggttttca 11220 gcaccggccgaattgaggtagactgccgggaatatcttgatgatcgggagcgagaggttg 11280 ctgcgtccctcccacatgccttcattggcgacgtcaaaggcactaccgttggaggatgcc 11340 accatgtcacctccagatacctcccgcgcttccttcccaaggaatcggttgcggtagtcg 11400 gggtttcaagtcccggaaaagccgcgaaagcattgtgcacactgacagatgtgtacctcc 11460 cagaccttgaagcctatttccacccggagacccagtccaagtgctggagaatgatgttgg 11520 acttcaaggaagttcgactaatggtctggaaagacaaaacagcctatttccaacttgaag 11580 gtcgctatttcacctggtatcagcttgctagctatgcctcgtacatccgtgttcctgtca 11640 actccacggtgtacttggacccctgcatgggccccgccctttgcaacaggaaagtcgtcg 11700 ggtccactcattggggagctgacctcgctgtcaccccttatgattacggcgctaaaatta 11760 tcctgtctagcgcgtaccatagtgaaatgccccccggatacaagattctggcgtgcgcgg 11820 aattctcgttggatgacccagtcaagtacaaacatacctgggggtttgaatcggatacag 11880 cgtatctgtatgagttcaccggaaacggtgaggactgggaggattacaatgatgcgtttc 11940 gtgcgcgccaggaagggaaaatttataaggctactgccaccagcatgaagttttattttc 12000 ccccgggccctgtcattgaaccaactttaggcctgaattgaaatgaaatggggtccatgc 12060 aaagcctttttgacaaaattggccaactttttgtggatgctttcacggagttcttggtgt 12120 ccattgttgatatcattatatttttggccattttgtttggcttcaccatcgccggttggt 12180 tggtggtcttttgcatcagattggtttgctccgcgatactccgtacgcgccctgccattc 12240 actctgagcaattacagaagatcttatgaagcctttctttcccagtgccaagtggacatt 12300 cccacctggggaactaaacatcctttggggatgttttggcaccataaggtgtcaaccctg 12360 attgatgagatggtgtcgcgtcgaatgtaccgcatcatggaaaaagcaggacaggctgcc 12420 tggaaacaggtggtgagcgaggctacgctgtctcgcattagtagtttggatgtggtggct 12480 cattttcagcatcttgccgccattgaagccgagacctgtaaatatttggcctcccggctg 12540 cccatgctacacaacctgcgcatgacagggtcaaatgtaaccatagtgtataatagtact 12600 ttgcatcaggtgtttgctatttttccaacccctggttcccggccaaagcttcatgatttt 12660 cagcaatggttaatagctgtacattcctccatattttcctctgttgcagcttcttgtact 12720 ctctttgttgtgctgtggttgcgggttccaatactacgtactgtttttggtttccgctgg 12780 ttaggggcaatttttctttcgaactcacagtgaattacacggtgtgtccaccttgcctca 12840 cccggcaagcagccgcagaggcctacgaacccggtaggtctctttggtgcaggatagggt 12900 atgaccgatgtggggaggacgatcatgacgagctagggtttatggtaccgtctggcctct 12960 ccagcgaaggccacttgaccagtgtttacgcctggttggcgttcttgtccttcagctaca 13020 cggcccagttccatcccgagatattcgggatagggaatgtgagtcgagtttatgttgaca 13080 tcgaacatcaactcatctgcgccgaacatgacgggcagaacaccaccttgcctcgtcatg 13140 acaacatttcagccgtgtttcagacctattaccaacatcaagtcgacggcggcaattggt 13200 ttcacctagaatggctgcgtcccttcttttcctcatggttggttttaaatgtctcttggt 13260 ttctcaggcgttcgcctgcaaaccatgtttcagttcgagtctttcagacattaagaccaa 13320 caccaccgcagcggcaagctttgctgtcctccaagacatcagttgccttaggcatcgcaa 13380 ctcggcctctgaggcgattcgcaaaatccctcagtgccgtacggcgatagggacacccgt 13440 gtatattaccatcacagccaatgtgacagatgagaattatttacattcttctgatctcct 13500 catgctttcttcttgccttttctatgcttctgagatgagtgaaaagggatttaaggtggt 13560 atttggcaatgtgtcaggcatcgtggctgtgtgtgtcaattttaccagctacgtccaaca 13620 tgtcagggagtttacccaacgctccttgatggtcgaccatgtgcggctgctccatttcat 13680 gacacctgagaccatgaggtgggcaactgttttagcctgtctttttgccattctgttggc 13740 aatttgaatgtttaagtatgttggggaaatgcttgaccgcgggctgttgctcgcgattgc 13800 tttctttgtggtgtatcgtgccgttctgttttgctgtgctcgtcaacgccaacagcaaca 13860 gcagctctcatctacagttgatttacaacttgacgctatgtgagctgaatggcacagatt 13920 ggctatctaataaatttgattgggcagtggagagttttgtcatctttcccgttttgactc 13980 acattgtctcctatggtgccctcactaccagccatttccttgacacagtcgctttagtca 14040 ctgtgtctaccgccgggtttgttcacgggcggtatgtcctgagcagcatctacgcggtct 14100 gtgccctggctgcgttgacttgcttcgtcattaggtttgcaaagaattgcatgtcctggc 14160 gctactcatgtaccagatatactaactttcttctggacactaagggcagactctatcgtt 14220 ggcggtcgcctgtcatcatagagaaaaggggcaaagttgaggtcgaaggtcatctgatcg 14280 acctcaaaagagttgtgcttgatggttccgtggcaacccctataaccagagtttcagcgg 14340 aacaatggggtcgtccttagatgacttttgttatgatagcacggctccacaaaaggtgct 14400 tttggcgttttctattacctacacgccagtgatgatatatgccctaaaagtgagtcgcgg 14460 ccgactgttagggcttctgcaccttttgatcttcctgaactgtgctttcaccttcgggta 14520 catgacattcgcgcactttcagagtacaaataaggtcgcgctcactatgggagcagtagt 14580 tgcactcctttggggggtgtattcagccatagaaacctggaaattcatcacctccagatg 14640 ccgtttgtgcttgctaggccgcaagtacattctggcccctgcccaccacgttgagagtgc 14700 cgcaggctttcatccgattgcggcaaatgataaccacgcatttgtcgtccggcgtcccgg 14760 ctccactacggtcaacggcacattggtgcccgggttgaaaggcctcgtgttgggtggcag 14820 aaaagctgttaaacagggagtggtaaaccttgtcaaatatgccaaataacaacggcaagc 14880 agcagaagagaaagaagggggatggccagccagtcaatcagctgtgccagatgctgggta 14940 agatcatcgcccagcaaaaccagtccagaggcaagggaccgggaaagaaaaataagaaga 15000 aaaacccggagaagccccattttcctctagcgactgaagatgatgtcagacatcacttta 15060 cccctagtgagcggcaattgtgtctgtcgtcaatccagactgcctttaatcaaggcgctg 15120 ggacttgcaccctgtcagattcagggaggataagttacactgtggagtttagtttgccta 15180 cgcatcatactgtgcgcctgatccgcgtcacagcatcaccctcagcatgatgggctggca 15240 ttcttgaggcatctcagtgtttgaattggaagaatgtgtggtgaatggcactgattgaca 15300 ttgtgcctctaagtcacctattcaattagggcgaccgtgtgggggtaagatttaattggc 15360 gagaaccatacggccgaaatt 15381
(157) TABLE-US-00006 TABLE6 FurtherSEQIDNO:itemsandcertainsequencelistinginformation. SeqIDNo: Sequence 4 ANRMXNSKFEXaaisValorMet 5 ANRMVNSKFE 6 LANYYYRAQG 7 LANYHYRAQG 8 DLXTPPEPAT<223> XaaisProorSer 9 DLSTPPELAT 10 DLPTPPEPAT 11 VDIIIFLAIL 12 VDIIVFLAIL 13 AILRTRPAIH 14 AILRARPAIH 15 LGFMIPXGLS<223> XaaisProorSer 16 LGFMVPSGLS 17 SVRVLQTLRP 18 SVRVFQTLRP 19 SSSLADIKTN 20 SSSLSDIKTN 21 MVNSCTFLHIFLCCSFLYSLCCAVVAGSNTTYCFWFPLVRGNFSFELTVNYTVCPPCLTR 60 QAAAEAYEPGRSLWCRIGYDRCGEDDHDELGFMIPXGLSSEGHLTSVYAWLAFLSFSYTA 120 QFHPEIFGIGNVSRVYVDIEHQLICAEHDGQNTTLPRHDNISAVFQTYYQHQVDGGNWFH 180 LEWLRPFFSSWLVLNVSWFLRRSPANHVSVRVLQTLRPTPPQRQALLSSKTSVALGIATR 240 PLRRFAKSLSAVRR 254 <222> (96)...(96)<223> XaaisProorSer 22 MVNSCTFLHIFLCCSFLYSLCCAVVAGSNTTYCFWFPLVRGNFSFELTVNYTVCPPCLTR 60 QAAAEAYEPGRSLWCRIGYDRCGEDDHDELGFMVPSGLSSEGHLTSVYAWLAFLSFSYTA 120 QFHPEIFGIGNVSRVYVDIEHQLICAEHDGQNTTLPRHDNISAVFQTYYQHQVDGGNWFH 180 LEWLRPFFSSWLVLNVSWFLRRSPANHVSVRVLQTLRPTPPQRQALLSSKTSVALGIATR 240 PLRRFAKSLSAVRR 254 23 MAASLLFLMVGFKCLLVSQAFACKPCFSSSLADIKTNTTAAASFAVLQDISCLRHRNSAS 60 EAIRKIPQCRTAIGTPVYITITANVTDENYLHSSDLLMLSSCLFYASEMSEKGFKVVFGN 120 VSGIVAVCVNFTSYVQHVREFTQRSLMVDHVRLLHFMTPETMRWATVLACLFAILLAI 178 24 MAASLLFLMVGFKCLLVSQAFACKPCFSSSLSDIKTNTTAAASFAVLQDISCLRHRNSAS 60 EAIRKIPQCRTAIGTPVYITITANVTDENYLHSSDLLMLSSCLFYASEMSEKGFKVVFGN 120 VSGIVAVCVNFTSYVQHVREFTQRSLMVDHVRLLHFMTPETMRWATVLACLFAILLAI 178 25 MGSMQSLFDKIGQLFVDAFTEFLVSIVDIIIFLAILFGFTIAGWLVVFCIRLVCSAILRT 60 RPAIHSEQLQKIL 73 26 MGSMQSLFDKIGQLFVDAFTEFLVSIVDIIVFLAILFGFTIAGWLVVFCIRLVCSAILRA 60 RPAIHSEQLQKIL 73 27 cacacggtcgccctaattg 19 28 tggtgaatggcactgattgac 21 29 tgtgcctctaagtcacc 17 30 caactgcagagctcatatgcat 22 31 MKWGPCKAFLTKLANFLWMLSRSSWCPLLISLYFWPFCLASPSPVGWWSFASDWFAPRYS 60 VRALPFTLSNYRRSYEAFLSQCQVDIPTWGTKHPLGMFWHHKVSTLIDEMVSRRMYRIME 120 KAGQAAWKQVVSEATLSRISSLDVVAHFQHLAAIEAETCKYLASRLPMLHNLRMTGSNVT 180 IVYNSTLHQVFAIFPTPGSRPKLHDFQQWLIAVHSSIFSSVAASCTLFVVLWLRVPILRT 240 VFGFRWLGAIFLSNSQ 256 32 MLGKCLTAGCCSRLLSLWCIVPFCFAVLVNANSNSSSHLQLIYNLTLCELNGTDWLSNKF 60 DWAVESFVIFPVLTHIVSYGALTTSHFLDTVALVTVSTAGFVHGRYVLSSIYAVCALAAL 120 TCFVIRFAKNCMSWRYSCTRYTNFLLDTKGRLYRWRSPVIIEKRGKVEVEGHLIDLKRVV 180 LDGSVATPITRVSAEQWGRP 200 33 MGSSLDDFCYDSTAPQKVLLAFSITYTPVMIYALKVSRGRLLGLLHLLIFLNCAFTFGYM 60 TFAHFQSTNKVALTMGAVVALLWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESAA 120 GFHPIAANDNHAFVVRRPGSTTVNGTLVPGLKGLVLGGRKAVKQGVVNLVKYAK 174 34 MPNNNGKQQKRKKGDGQPVNQLCQMLGKIIAQQNQSRGKGPGKKNKKKNPEKPHFPLATE 60 DDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTAS 120 PSA 123 35 MSGILDRCTCTPNARVFMAEGQVYCTRCLSARSLLPLNLQVSELGVLGLFYRPEEPLRWT 60 LPRAFPTVECSPAGACWLSAIFPIARMTSGNLNFQQRMVRVAAELYRAGQLTPTVLKTLQ 120 VYERGCRWYPIVGPVPGVAVFANSLHVSDKPFPGATHVLTNLPLPQ 166 36 RPKPEDFCPFECAMATVYDIGHDAVMYVAEGKVSWAPRGGDEVKFETVPGELELIANRLR 60 TSFPPHHTVDMSKFAFTAPGRGVSMRVERQHGCLPADTVPEGNCWWSLFNLLPLEVQNKE 120 IRHANQFGYQTKHGVSGKYLQRRLQVNGLRAVTDLNGPIVVQYFSVKESWIRHLKLAEEP 180 SYPGFEDLLRIRVEPNTSPLADKDEKIFRFGSHKWY 216 37 AGKRARKARSSATATVAGRALSVRETRQAKEHEVAGANKAGHLKHYSPPAEGNCGWHCIS 60 AIANRMVNSKFETTLPERVRPSDDWATDEDLVNAIQILRLPAALNRNGACASAKYVLKLE 120 GEHWTVTVTPGMSPSLLPLECVQGCCEHKGSLGSPDAVEVFGFDPACLDRLAEVMHLPSS 180 AIPAALAEMSGDSDRSASPVTTVWTVSQFFARHNGGNHPDQVRLGKIISLCQVIEDCCCS 240 QNKTNRVTPEEVAAKIDLYLRGATNLEECLARLEKARPPRVMDTSFDWDVVLPGVEAATQ 300 TTELPQVNQCRALVPVVTQKSLDNNSVPLTAFSLANYYYRAQGDEVRHRERLTAVLSKLE 360 GVVREEYGLMPTGPGPRPTLPRGLDELKDQMEEDLLKLANAQTTSDMMAWAVEQVDLKTW 420 VKNYPRWTPPPPPPKVQPRKTKPVKSLPERKPVPAPRRKVGSDCGSPISLGDDVPNSWED 480 LAVGSPFDLPTPPEPATPSSELVIVSAPQCIFRPATPLSEPAPIPAPRGVVSRPVTPLNE 540 PIPVPAPRRKFQQMRRLSSAAVIPPYQDEPLDLSASSQTEYEASPLAPPQSEGVLGVEGQ 600 EAEEALSEISDMSGNIKPASVSSSSSLSSVRITRPKYSAQAIIDSGGPCSGHLQEVKETC 660 LSIMREACDATKLDDPATQEWLSRMWDRVDMLTWRNTSAYQAFRTLDGRLKFLPKMILET 720 PPPYPCEFVMMPHTPAPSVGAESDLTIGSVATEDVPRILEKIENVGEMTNQGPLAFSEDK 780 PVDDQLAKDPRISSQRSDESTSAPPAGTGGAGSFTDLPPSDGVDADGGGPFWTVKRKAER 840 LFDQLSRQVFDLVSHLPVFFSRLFNPGGGYSPGDWGFAAFTLLCLFLCYSYPAFGIAPLL 900 GVFSGSSRRVRMGVFGCWLAFAVGLFKPVSDPVGAACEFDSPECRNILHSFELLKPWDPV 960 RSLVVGPVGLGLAILGRLLG 980 38 GARSIWHFLLRLGIVADCVLAGAYVLSQGRCKKCWGSCIRTAPNEVAFNVFPFTRATRSS 60 LIDLCDRFCAPKGMDPIFLATGWRGCWAGRSPIEQPSEKPIAFAQLDEKKITARTVVAQP 120 YDPNQAVKCLRVLQAGGVMVAKAVPKVVKVSAVPFRAPFFPTGVKVDPECRVVVDPDTFT 180 AALRSGYSTTNLVLGVGDFAQLNGLKIRQISKPSGGGPHLMAALHVACSMALHMLAGIYV 240 TAVGSCGTGTNDPWCANPFAVPGYGPGSLCTSRLCISQHGLTLPLTALVAGFGIQEIALV 300 VLIFVSIGGMAHRLSCKADMLCVLLAIASYVWVPLTWLLCVFPCWLRCFSLHPLTILWLV 360 FFLISVNMPSGILAMVLLVSLWLLGRYTNVAGLVTPYDIHHYTSGPRGVAALATAPDGTY 420 LAAVRRAALTGRTMLFTPSQLGSLLE 446 39 GAFRTRKPSLNTVNVVGSSMGSGGVFTIDGKIKCVTAAHVLTGNSARVSGVGFNQMLDFD 60 VKGDFAIADCPNWQGAAPKTQFCKDGWTGRAYWLTSSGVEPGVIGKGFAFCFTACGDSGS 120 PVITEAGELIGVHTGSNKQGGGIVTRPSGQFCNVAPIKLSELSEFFAGPKVPLGDVKVGS 180 HIIKDIGEVPSDLCALLAAKPELE 204 40 GGLSTVQLLCVFFLLWRMMGHAWTPLVAVGFFILNEVLPAVLVRSVFSFGMFVLSWLTPW 60 SAQVLMIRLLTAALNRNRWSLAFFSLGAVTGFVADLAATQGHPLQAVMNLSTYAFLPRMM 120 VVTSPVPVIACGVVHLLAIILYLFKYRGLHQILVGDGVFSAAFFLRYFAE 170 41 GKLREGVSQSCGMNHE 16 42 SLTGALAMRLNDEDLDFLTKWTDFKCFVSASNMRNAAGQFIEAAYAKALRVELAQLVQVD 60 KVRGTLAKLEAFADTVAPQLSPGDIVVALGHTPVGSIFDLKVGSTKHTLQAIETRVLAGS 120 KMTVARVVDPTPTPPPAPVPIPLPPKVLENGPNAWGDEDRLNKKKRRRMEALGIYVMGGK 180 KYQKFWDKNSGDVFYEEVHNNTDEWECLRVGDPADFDPEKGTLCGHVTIEDKAYHVYTSS 240 SGKKFLVPVNPENGRVQWE 259 43 AAKLSVEQALGMMNVDGELTTKELEKLKRIIDKLQGLTKEQCLNC 45 44 AAKLSVEQALGMMNVDGELTTKELEKLKRIIDKLQGLTKEQCLNLLAASGLTRCGRGGLV 60 VTETAVKIVKFHNRTFTLGPVNLKVASEVELKDAVEHNQHPVARPVDGGVVLLRSAVPSL 120 IDVLISGADASPKLLAHHGPGNTGIDGTLWDFESEATKEEVALSAQIIQACDIRRGDAPE 180 IGLPYKLYPVRGNPERVKGVLQNTRFGDIPYKTPSDTGNPVHAAACLTPNATPVTDGRSV 240 LATTMPSGFELYVPTIPASVLDYLDSRPDCPKQLTEHGCEDAALRDLSKYDLSTQGFVLP 300 GVFRLVRKYLFAHVGKCPPVHRPSTYPAKNSMAGINGNRFPTKDIQSVPEIDVLCAQAVR 360 ENWQTVTPCTLKKQYCGKKKTRTILGTNNFIALAHRAALSGVTQGFMKKAFNSPIALGKN 420 KFKELQTPVLGRCLEADLASCDRSTPAIVRWFAANLLYELACAEEHLPSYVLNCCHDLLV 480 TQSGAVTKRGGLSSGDPITSVSNTIYSLVIYAQHMVLSYFKSGHPHGLLFLQDQLKFEDM 540 LKVQPLIVYSDDLVLYAESPTMPNYHWWVEHLNSMLGFQTDPKKTAITDSPSFLGCRIIN 600 GRQLVPNRDRILAALAYHMKASNVSEYYASAAAILMDSCACLEYDPEWFEELVVGIAQCA 660 RKDGYSFPGTPFFMSMWEKLRSNYE 685 45 GKKSRVCGYCGAPAPYATACGLDVCIYHTHFHQHCPVTIWCGHPAGSGSCSECKSPVGKG 60 TSPLDEVLEQVPYKPPRTVIMRVEQGLTPLDPGRYQTRRGLVSVRRGIRGNEVELPDGDY 120 ASTALLPTCKEINMVAVASNVLRSRFIIGPPGAGKTYWLLQQVQDGDVIYTPTHQTMLDM 180 IRALGTCRFNVPAGTTLQFPVPSRTGPWVRILAGGWCPGKNSFLDEAAYCNHLDVLRLLS 240 KTTLTCLGDFKQLHPVGFDSHCYVFNIMPQTQLKTIWRFGQNICDAIQPDYRDKLMSMVN 300 TTRVTYVEKPVRYGQVLTPYHRDREDDAITIDSSQGATFDVVTLHLPTKDSLNRQRALVA 360 ITRARHAIFVYDPHRQLQSLFDLPAKGTPVNLAVHRDGQLIVLDRNNKECTVAQALGNGD 420 KFRATDKRVVDSLRAICADLE 441 46 GSSSPLPKVAHNLGFYFSPDLTQFAKLPAELAPHWPVVTTQNNEKWPDRLVTSLRPIHKY 60 SRACIGAGYMVGPSVFLGTPGVVSYYLTKFVKGEAQVLPETVFSTGRIEVDCREYLDDRE 120 REVAASLPHAFIGDVKGTTVGGCHHVTSRYLPRFLPKESVAVVGVSSPGKAAKALCTLTD 180 VYLPDLEAYFHPETQSKCWRMMLDFKEVRLMVWKDKTAYFQLE 223 47 GRYFTWYQLASYASYIRVPVNSTVYLDPCMGPALCNRKVVGSTHWGADLAVTPYDYGAKI 60 ILSSAYHSEMPPGYKILACAEFSLDDPVKYKHTWGFESDTAYLYEFTGNGEDWEDYNDAF 120 RARQEGKIYKATATSMKFYFPPGPVIEPTLGLN 153 48 MVNSCTFLHIFLCCSFLYSLCCAVVAGSNTTYCFWFPLVRGNFSFELTVNYTVCPPCLTR 60 QAAAEAYEPGRSLWCRIGYDRCGEDDHDELGFMVPSGLSSEGHLTSVYAWLAFLSFSYTA 120 QFHPEIFGIGNVSRVYVDIEHQLICAEHDGQNTTLPRHDNISAVFQTYYQHQVDGGNWFH 180 LEWLRPFFSSWLVLNVSWFLRRSPANHVSVRVFQTLRPTPPQRQALLSSKTSVALGIATR 240 PLRRFAKSLSAVRR 254