Polypeptides having glucoamylase activity and method of producing the same

09677058 · 2017-06-13

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to polypeptides having glucoamylase activity with improved properties and to compositions comprising these polypeptides suitable for use in the production of a food, beverage (e.g. beer), feed, or biofuel. Also described is an improved and cost-effective process for isolating glucoamylases suitable for large scale protein purification procedures. Furthermore, different methods and uses related to glucoamylases according to the invention are disclosed, such as in a brewing process.

Claims

1. An isolated polypeptide having glucoamylase activity comprising an amino acid sequence having at least 90% sequence identity to an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6.

2. The polypeptide according to claim 1, wherein the amino acid sequence comprises at least one or more amino acid residue(s) selected from the following groups: a) an amino acid residue selected from the group consisting of A and P at a position corresponding to position 459 in SEQ ID NO: 3 or 6, b) an amino acid residue selected from the group consisting of C and S at a position corresponding to position 473 in SEQ ID NO: 3 or 6, c) an amino acid residue selected from the group consisting of A and R at a position corresponding to position 474 in SEQ ID NO: 3 or 6, d) an amino acid residue selected from the group consisting of A and P at a position corresponding to position 475 in SEQ ID NO: 3 or 6, e) an amino acid residue selected from the group consisting of T and Y at a position corresponding to position 476 in SEQ ID NO: 3 or 6, f) an amino acid residue selected from the group consisting of P and G at a position corresponding to position 477 in SEQ ID NO: 3 or 6, g) an amino acid residue selected from the group consisting of A and G at a position corresponding to position 479 in SEQ ID NO: 3 or 6 and/or h) an amino acid residue selected from the group consisting of V and R at a position corresponding to position 480 in SEQ ID NO: 3 or 6.

3. The polypeptide according to claim 1, comprising the mature polypeptide of SEQ ID NO:3 or 6.

4. The polypeptide according to claim 1, wherein the polypeptide is inactivated by pasteurisation.

5. The polypeptide according to claim 1, wherein the polypeptide is obtained by recombinant expression in a host cell.

6. A composition comprising the polypeptide of claim 1.

7. The composition according to claim 6, wherein the composition is selected from the group consisting of a starch hydrolyzing composition, a saccharifying composition, a detergent composition, an alcohol fermentation enzymatic composition, and an animal feed composition.

8. The composition according to claim 6 further comprising an additional enzyme.

9. The composition according to claim 8, wherein the additional enzyme is selected from the group consisting of alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, and combinations thereof.

10. The polypeptide according to claim 2, wherein the polypeptide is inactivated by pasteurisation.

11. The polypeptide according to claim 3, wherein the polypeptide is inactivated by pasteurisation.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 depicts an SDS-PAGE analysis of the fermentation broth of various wild type fungal strains, including Monascus kaoliang.

(2) FIG. 2 depicts a SDS-PAGE analysis of the fermentation broth of Monascus kaoliang, showing two protein bands, one of a size similar to the size range as glucoamylases of other filamentous fungi (62 kDa), and a second of about 49 kDa.

(3) FIG. 3 depicts another SDS-PAGE analysis of fermentation broth samples of Monascus kaoliang, showing a protein band of about 62 kDa.

(4) FIG. 4 depicts a SDS-PAGE analysis of the fermentation broth of Monascus kaoliang (left sample) as compared to that of Aspergillus niger (right sample). The fermentation broth of Aspergillus niger (right sample) contains a secreted alpha amylase, whereas the fermentation broth of Monascus kaoliang (left sample) shows only the glucoamylase.

(5) FIG. 5 depicts the rate and yield of ethanol production in the presence of glucoamylase from Monascus kaoliang (MkGA) compared to glucoamylase from Aspergillus niger (AnGA). The rate of ethanol production is faster with MkGA than with AnGA when dosed equally at 0.325 glucoamylase units/g dry solids (DS) of liquefied starch. When dosed at 0.4 glucoamylase units/g DS, the rate of ethanol production with MkGA was even faster. The final alcohol yield was comparable regardless of dose or enzyme.

(6) FIG. 6 depicts the amount of insoluble residual starch remaining after yeast fermentation of liquefied starch in the presence of glucoamylase from Aspergillus niger (AnGA) or Monascus kaoliang (MkGA). Dosing of glycoamylase: 325 units of AnGA per gram dry solids of liquefied starch in the left-hand tube; 325 units and 400 units MkGA per gram dry solids of liquefied starch in the central and right-hand tube, respectively.

(7) FIG. 7 depicts the weight loss during yeast fermentation of a wort in the presence or absence of DIAZYME X4 or an equal number of units of Monascus kaoliang glucoamylase (MkGA) over a period of 175 h. The control is without enzyme.

(8) FIG. 8 depicts HPLC carbohydrate analysis of fermented worts with addition of: MkGA I, MkGA II, DIAZYME X4 and no enzyme. The listed components were quantified (% w/v) by HPLC (Phenomenex RSO Oligosaccharide column, RI detector) from external standards of ethanol, glycerol and glucose at different time points during fermentation.

(9) FIG. 9 depicts residual glucoamylase activity of A) MkGA I, B) MkGA II and C) DIAZYME X4 (using a -D-maltoside substrate) as function of pasteurisation time and pasteurisation units (PU) at 72 C. Residual glucoamylase activity was measured in Royal Pilsner (filled square), Budweiser Pilsner (triangle), Newcastle Brown ale (filled circle), Thisted bryghus Porter (square) beer and 0.1 M Na-Acetate pH (4.7) (dotted line). Results are shown as an average of 2 determinations.

(10) FIG. 10 is a schematic map of MkGA I/II genomic and CDS sequences.

(11) FIG. 11 is schematic maps of 5 expression plasmids for different M. kaoliang glucoamylase sequences and a schematic map of the destination vector pTTT-pyrG13.

(12) FIG. 12 depicts SDS-PAGE of Hypocrea jecorina fermentation samples expressing different M. kaoliang GA encoding sequences: 1, MkGA II genomic clone; 2, MkGA II cDNA clone; 3, MkGA I genomic clone; 4, MkGA I cDNA clone; 5, MkGA I genomic clone starting from the upstream ATG; 6, Recipient strain. 20 ul of filtered culture samples were loaded per lane on 10% SDS-PAGE. GA specific bands are indicated with arrows.

(13) FIG. 13 depicts SDS-PAGE of H. jecorina fermentation samples expressing two different M. kaoliang GA encoding sequences (MkGAI and MkGAII) and the purified two GA's from M. kaoliang.

(14) FIG. 14 depicts RDF values determined for listed GA (ferments, purified proteins and products) applied to the FV with similar activity (10M-GAU), using a malt extract wort. Results are an average of 2 determinations. Error bars are std.

DETAILED DESCRIPTION

(15) Glucoamylases are commercially important enzymes in a wide variety of applications that require the hydrolysis of starch. Disclosed herein is polypeptides having glucoamylase activity based on characterization of Monascus kaoliang derived glucoamylase MkGA I and MkGA II, including the amino acid sequences and DNA sequences encoding glucoamylase MkGA I and MkGA II, purified from Monascus kaoliang. Also described is an improved and cost-effective process for isolating the herein disclosed glucoamylases, or variants thereof, suitable for large scale protein purification procedures.

(16) Furthermore, it is described herein that especially one of the two glucoamylases from Monascus kaoliang, MkGA I, and variants thereof are very useful for addition into a fermentation vessel during for example beer fermentation because of the suitable thermolability of the enzyme which makes inactivation by pasteurisation possible.

(17) Pasteurisation experiments have been performed on beer in lab-, pilot- and full-scale to assess the ability to inactivate the polypeptides described herein in the brewing process. Lab-scale pasteurisations were validated on bottled beer with glucoamylases in a full-scale tunnel pasteuriser (data not shown). MkGA I has shown to be significant more thermolabile than several other tested glucoamylases and may as the only tested glucoamylase be completely inactivated with less than 50 units (PU), which is the average upper limit for pasteurisation of a regular beer. Thermostability of MkGA I and MKGA II has previously been studied in buffer (Iizuka et al., (1977), J. Gen. Appl. Microbiol., 23(5): 217-230; Iizuka et al., (1978), J. Gen. Appl. Microbiol., 24: 185-192), however, it was observed that the stability of MkGA I is lower in beer compared to a buffered solution. MkGA I is significantly less thermostable in various kinds of degassed beers (pH 4.3-4.6) compared to the previously used 0.1M Na-Acetate buffer (pH 4.7) (Iizuka et al., (1977), J. Gen. Appl. Microbiol., 23(5): 217-230; Iizuka et al., (1978), J. Gen. Appl. Microbiol., 24: 185-192) resulting in complete inactivation of MkGA I in the beer but not in the acetate buffer with less than 50 PU. The present inventors have thus surprisingly found that MkGA I is sufficiently thermolabile in beer to be completely inactivated by pasteurisation and at the same time maintain high performance throughout the beer fermentation.

(18) However, the low expression of MkGA I in Monascus kaoliang makes it commercially unattractive. The present inventors have thus further identified the genomic DNA sequence of MkGA I including the specific signal peptide sequence that together enables heterologous expression of for example MkGA I and MkGA II, such as expression in Trichoderma reesei.

1. DEFINITIONS

(19) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Singleton et al., Dictionary of Microbiology And Molecular Biology, 2.sup.nd ed., John Wiley and Sons, New York (1994), and Hale & Markham, The Harper Collins Dictionary Of Biology, Harper Perennial, N.Y. (1991) provide one of skill with the general meaning of many of the terms used herein. Still, certain terms are defined below for the sake of clarity and ease of reference.

(20) As used herein, the term glucoamylase (EC 3.2.1.3) refers to an enzyme that catalyzes the release of D-glucose from the non-reducing ends of starch and related oligo- and polysaccharides.

(21) As used herein, the term MkGA refers to the mixture of both glucoamylase variants MkGA I and MkGA II produced from the fermentation of Monascus kaoliang.

(22) As used herein, the term MkGA I refers to a smaller glucoamylase variant from Monascus kaoliang without a starch binding domain (SBD).

(23) As used herein, the term MkGA II refers to a glucoamylase variant from Monascus kaoliang which has a starch binding domain (SBD).

(24) As used herein, a homologous sequence and sequence identity with regard to a nucleic acid or polypeptide sequence means having about at least 100%, at least 99%, at least 98%, at least 97%, at least 96%, at least 95%, at least 94%, at least 93%, at least 92%, at least 91%, at least 90%, at least 88%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, at least 50%, or at least 45% sequence identity to a nucleic acid sequence or polypeptide sequence when optimally aligned for comparison, wherein the function of the candidate nucleic acid sequence or polypeptide sequence is essentially the same as the nucleic acid sequence or polypeptide sequence the candidate homologous sequence is being compared with. In some embodiments, homologous sequences have between at least about 85% and 100% sequence identity, while in other embodiments there is between about 90% and 100% sequence identity, and in other embodiments, there is at least about 95% and 100% sequence identity.

(25) Homology is determined using standard techniques known in the art (see e.g., Smith and Waterman, Adv. Appl. Math. 2: 482 (1981); Needleman and Wunsch, J. Mol. Biol. 48: 443 (1970); Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85: 2444 (1988); programs such as GAP, BESTHT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, Wis.); and Devereux el al., Nucleic Acid Res., 12: 387-395 (1984)).

(26) The percent (%) nucleic acid sequence identity or percent (%) amino acid sequence identity is defined as the percentage of nucleotide residues or amino acid residues in a candidate sequence that is identical with the nucleotide residues or amino acid residues of the starting sequence. The sequence identity can be measured over the entire length of the starting sequence

(27) Homologous sequences are determined by known methods of sequence alignment. A commonly used alignment method is BLAST described by Altschul et al., (Altschul et al., J. Mol. Biol. 215: 403-410 (1990); and Karlin et al, Proc. Natl. Acad. Sci. USA 90: 5873-5787 (1993)). A particularly useful BLAST program is the WU-BLAST-2 program (see Altschul et al, Meth. Enzymol. 266: 460-480 (1996)). WU-BLAST-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=1, overlap fraction=0.125, word threshold (T)=11. The HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the particular sequence and composition of the particular database against which the sequence of interest is being searched. However, the values may be adjusted to increase sensitivity.

(28) A % amino acid sequence identity value is determined by the number of matching identical residues divided by the total number of residues of the longer sequence in the aligned region. The longer sequence is the one having the most actual residues in the aligned region (gaps introduced by WU-Blast-2 to maximize the alignment score are ignored).

(29) Other methods find use in aligning sequences. One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (Feng and Doolittle, J. Mol. Evol. 35: 351-360 (1987)). The method is similar to that described by Higgins and Sharp (Higgins and Sharp, CABIOS 5: 151-153 (1989)). Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.

(30) In another aspect, the percentage of identity of one amino acid sequence with, or to, another amino acid sequence is determined by the use of the protein-protein Blast search (http://blast.ncbi.nlm.nih.gov) with default settings: score matrix: blosum62, non-redundant protein sequences database and the blast algorithm

(31) TABLE-US-00001 Settings Expect threshold 10 Max matches in a query range 0 Gap opening penalty 11 Gap extension penalty 1 Compositional adjustment: Conditional compositional score matrix adjustment Mask and filters No

(32) The term optimal alignment refers to the alignment giving the highest percent identity score.

(33) As used herein, the terms glucoamylase variant or variant are used in reference to glucoamylases that are similar to a glucoamylase sequence (e.g., the Monascus kaoliang glucoamylase I and II sequences) but have at least one substitution, deletion, or insertion in their amino acid sequence that makes them different in sequence from glucoamylase I and/or II. In some cases, they have been manipulated and/or engineered to include at least one substitution, deletion, or insertion in their amino acid sequence that makes them different in sequence from glucoamylase I and/or II.

(34) As used herein the term catalytic domain refers to a structural region of a polypeptide, which contains the active site for the catalysis of substrate hydrolysis.

(35) The term linker refers to a short amino acid sequence generally having between 3 and 40 amino acids residues that covalently bind an amino acid sequence comprising a starch binding domain with an amino acid sequence comprising a catalytic domain.

(36) The term starch binding domain (SBD) refers to an amino acid sequence that binds preferentially to a starch substrate. It is well known for a person skilled in the art how to identify a SBDthe SBD is an example of a carbohydrate-binding modules (CBM) and CBMs have been classified into the CBM families using a sequence-based classification system (http://www.cazy.orci/Carbohydrate-Binding-Modules.html). In addition, it is well known for a person skilled in the art to isolate materials containing for example an SBD using raw starch or beta-cyclodextrin affinity chromatography (Hamilton et al. (2000) Enzyme and Microbial Technology 26 p 561-567). In one aspect, the domain definition of SBD is adopted from the Pfam database (http://pfam.sancier.ac.uk/ or www.sanqer.ac.uk/resources/databases/pfam.html) which database of protein domain families are generated from sequence similarity. Thus, in one aspect the SBD is as defined by the Carbohydrate binding module 20 family in the Pfam database

(37) As used herein, the term fragment is defined as a polypeptide having one or more (several) amino acids deleted from the amino and/or carboxyl terminus for example of the polypeptide of SEQ ID NO:3 or 6; wherein the fragment has glucoamylase activity. In one aspect, the fragment has one or more (several) amino acids deleted from the amino terminus of SEQ ID NO:3. In one aspect, the polypeptide contains fewer residues in the N- or C-terminus compared to wildtype and in the case of MkGA I also compared to MkGA II.

(38) In one aspect, a polypeptide as described herein has at the most 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 495, 500, 505, 507, 515, 525, 535, 545, 555, 565 or 573 amino acid residues.

(39) As used herein the term truncated refers to a polypeptide that compared to a wild type protein (or another variant) does not achieve its full translated length and is therefore missing some of the amino acids present in the wild type protein. Truncation is normally brought about by a premature termination mutation, but could be caused by another mechanismsuch as a post-translational modification.

(40) As used herein, the terms mutant sequence and mutant gene are used interchangeably and refer to a polynucleotide sequence that has an alteration in at least one codon occurring in a host cell's parent sequence. The expression product of the mutant sequence is a variant protein with an altered amino acid sequence relative to glucoamylase I and/or II. The expression product may have an altered functional capacity (e.g., enhanced enzymatic activity or greater thermostability).

(41) The term property or grammatical equivalents thereof in the context of a polypeptide, as used herein, refers to any characteristic or attribute of a polypeptide that can be selected or detected. These properties include, but are not limited to, oxidative stability, substrate specificity, catalytic activity, thermal stability, pH activity profile, resistance to proteolytic degradation, K.sub.M, K.sub.CAT, K.sub.CAT/K.sub.M ratio, protein folding, ability to bind a substrate and ability to be secreted.

(42) The term property of grammatical equivalent thereof in the context of a nucleic acid, as used herein, refers to any characteristic or attribute of a nucleic acid that can be selected or detected. These properties include, but are not limited to, a property affecting gene transcription (e.g., promoter strength or promoter recognition), a property affecting RNA processing (e.g., RNA splicing and RNA stability), a property affecting translation (e.g., regulation, binding of mRNA to ribosomal proteins).

(43) The terms thermally stable and thermostable refer to glucoamylase variants of the present disclosure that retain a specified amount of enzymatic activity after exposure to a temperature over a given period of time under conditions prevailing during the hydrolysis of starch substrates, for example, while exposed to altered temperatures.

(44) The term enhanced stability in the context of a property such as thermostability refers to a higher retained catalytic activity, or starch hydrolytic activity however measured, over time as compared to glucoamylase I and/or II.

(45) The term thermolabile glucoamylase refers to a glucoamylase of the present disclosure that loses detectable hydrolytic enzymatic activity after exposure to a temperature over a given period of time under conditions prevailing during pasteurisation of the product of a brewing process. The precise conditions of pasteurization (e.g. Pasteurization Units) will depend on the type of beer produced by the brewing process. Loss of detectable hydrolytic activity of the thermolabile glucoamylase in a pasteurized beer may be detected using a glucoamylase enzyme assay as described herein and defined by loss of activity measured by that assay. An example of a thermolabile glucoamylase is a glucoamylase having SEQ ID NO: 6.

(46) The term specific activity is defined as the activity per mg of glucoamylase protein. In some embodiments, the activity for glucoamylase is determined by an ethanol assay and expressed as the amount of glucose that is produced from the starch substrate. In some embodiments, the protein concentration can be determined using the Caliper assay.

(47) The terms active and biologically active refer to a biological activity associated with a particular protein. It follows that the biological activity of a given protein refers to any biological activity typically attributed to that protein by those skilled in the art. For example, an enzymatic activity associated with a glucoamylase is hydrolytic and, thus an active glucoamylase has hydrolytic activity.

(48) As used herein, the term glucoamylase activity refers to the activity of an enzyme that catalyzes the release of D-glucose from the non-reducing ends of starch and related oligo- and polysaccharides. In particular, glucoamylase activity may be assayed by the 3,5-dinitrosalicylic acid (DNS) method (see Goto et al., Biosci. Biotechnol. Biochem. 58:49-54 (1994)).

(49) The terms polynucleotide and nucleic acid, used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. These terms include, but are not limited to, a single-, double- or triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, or a polymer comprising purine and pyrimidine bases, or other natural, chemically, biochemically modified, non-natural or derivatized nucleotide bases.

(50) As used herein, the terms DNA construct, transforming DNA and expression vector are used interchangeably to refer to DNA used to introduce sequences into a host cell or organism. The DNA may be generated in vitro by PCR or any other suitable technique(s) known to those in the art. The DNA construct, transforming DNA, or recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Typically, the recombinant expression cassette portion of an expression vector, DNA construct, or transforming DNA includes, among other sequences, a nucleic acid sequence to be transcribed, and a promoter. In some embodiments, expression vectors have the ability to incorporate and express heterologous DNA fragments in a host cell.

(51) As used herein, the term vector refers to a polynucleotide construct designed to introduce nucleic acids into one or more cell types. Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, cassettes, and the like.

(52) As used herein in the context of introducing a nucleic acid sequence into a cell, the term introduced refers to any method suitable for transferring the nucleic acid sequence into the cell. Such methods for introduction include but are not limited to protoplast fusion, transfection, transformation, conjugation, and transduction.

(53) As used herein, the terms transformed and stably transformed refers to a cell that has a non-native (heterologous) polynucleotide sequence integrated into its genome or as an episomal plasmid that is maintained for at least two generations.

(54) As used herein, the terms selectable marker and selective marker refer to a nucleic acid (e.g., a gene) capable of expression in host cells that allows for ease of selection of those hosts containing the vector. Typically, selectable markers are genes that confer antimicrobial resistance or a metabolic advantage on the host cell to allow cells containing the exogenous DNA to be distinguished from cells that have not received any exogenous sequence during the transformation.

(55) As used herein, the term promoter refers to a nucleic acid sequence that functions to direct transcription of a downstream gene. The promoter, together with other transcriptional and translational regulatory nucleic acid sequences (also termed control sequences) is necessary to express a given gene. In general, the transcriptional and translational regulatory sequences include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.

(56) A nucleic acid is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA encoding a secretory leader (i.e., a signal peptide), can be operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide. Generally, operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase.

(57) As used herein the term gene refers to a polynucleotide (e.g., a DNA segment), that encodes a polypeptide and includes regions preceding and following the coding regions, as well as intervening sequences (introns) between individual coding segments (exons).

(58) As used herein, ortholog and orthologous genes refer to genes in different species that have evolved from a common ancestral gene (i.e., a homologous gene) by speciation. Typically, orthologs retain the same function during the course of evolution. Identification of orthologs finds use in the reliable prediction of gene function in newly sequenced genomes.

(59) As used herein, paralog and paralogous genes refer to genes that are related by duplication within a genome. While orthologs retain the same function through the course of evolution, paralogs evolve new functions, even though some functions are often related to the original one. Examples of paralogous genes include, but are not limited to genes encoding trypsin, chymotrypsin, elastase, and thrombin, which are all serine proteinases and occur together within the same species.

(60) As used herein, the term hybridization refers to the process by which a strand of nucleic acid joins with a complementary strand through base pairing, as known in the art.

(61) A nucleic acid sequence is considered to be selectively hybridizable to a reference nucleic acid sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions. Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe. For example, maximum stringency typically occurs at about Tm5 C. (5 C. below the Tm of the probe); high stringency at about 5-10 C. below the Tm; intermediate stringency at about 10-20 C. below the Tm of the probe; and low stringency at about 20-25 C. below the Tm. Functionally, maximum stringency conditions may be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while an intermediate or low stringency hybridization can be used to identify or detect polynucleotide sequence homologs.

(62) Moderate and high stringency hybridization conditions are well known in the art. An example of high stringency conditions includes hybridization at about 42 C. in 50% formamide, 5 SSC, 5Denhardt's solution, 0.5% SDS and 100 g/ml denatured carrier DNA followed by washing two times in 2SSC and 0.5% SDS at room temperature and two additional times in 0.1SSC and 0.5% SDS at 42 C. An example of moderate stringent conditions include an overnight incubation at 37 C. in a solution comprising 20% formamide, 5SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5Denhardt's solution, 10% dextran sulfate and 20 mg/ml denaturated sheared salmon sperm DNA, followed by washing the filters in 1SSC at about 37-50 C. Those of skill in the art know how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.

(63) As used herein, recombinant includes reference to a cell or vector, that has been modified by the introduction of a heterologous or homologous nucleic acid sequence or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found in identical form within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all as a result of deliberate human intervention.

(64) In one embodiment, mutated DNA sequences are generated with site saturation mutagenesis in at least one codon and/or nucleotide. In another embodiment, site saturation mutagenesis is performed for two or more codons. In a further embodiment, mutant DNA sequences have more than about 50%, more than 55%, more than 60%, more than 65%, more than 70%, more than 75%, more than 80%, more than 85%, more than 90%, more than 95%, or more than 98% identity with the glucoamylase I and/or II DNA sequence. In alternative embodiments, mutant DNA can be generated in vivo using any known mutagenic procedure such as, for example, radiation, nitrosoguanidine, and the like. The desired DNA sequence can then be isolated and used in the methods provided herein.

(65) As used herein, heterologous protein refers to a protein or polypeptide that does not naturally occur in the host cell.

(66) An enzyme is over-expressed in a host cell if the enzyme is expressed in the cell at a higher level than the level at which it is expressed in a corresponding wild-type cell.

(67) The terms protein and polypeptide are used interchangeability herein. In the present disclosure and claims, the conventional one-letter and three-letter codes for amino acid residues are used. The 3-letter code for amino acids as defined in conformity with the IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN). It is also understood that a polypeptide may be coded for by more than one nucleotide sequence due to the degeneracy of the genetic code.

(68) Variants of the disclosure are described by the following nomenclature: [original amino acid residue/position/substituted amino acid residue]. For example, the substitution of leucine for arginine at position 76 is represented as R76L. When a position suitable for substitution is identified herein without a specific amino acid suggested, it is to be understood that any amino acid residue may be substituted for the amino acid residue present in the position.

(69) A prosequence is an amino acid sequence between the signal sequence and mature protein that is necessary for the secretion of the protein. Cleavage of the pro sequence will result in a mature active protein.

(70) The term precursor form of a protein or peptide refers to a mature form of the protein having a prosequence operably linked to the amino or carbonyl terminus of the protein. The precursor may also have a signal sequence operably linked, to the amino terminus of the prosequence. The precursor may also have additional polynucleotides that are involved in post-translational activity (e.g., polynucleotides cleaved therefrom to leave the mature form of a protein or peptide).

(71) Host strain or host cell refers to a suitable host for an expression vector comprising DNA according to the present disclosure.

(72) The terms derived from and obtained from refer to not only a glucoamylase produced or producible by a strain of the organism in question, but also a glucoamylase encoded by a DNA sequence isolated from such strain and produced in a host organism containing such DNA sequence. Additionally, the term refers to a glucoamylase that is encoded by a DNA sequence of synthetic and/or cDNA origin and that has the identifying characteristics of the glucoamylase in question.

(73) A derivative within the scope of this definition generally retains the characteristic hydrolyzing activity observed in glucoamylase I and/or II to the extent that the derivative is useful for similar purposes as the wild-type, native or parent form. Functional derivatives of glucoamylases encompass naturally occurring, synthetically or recombinantly produced peptides or peptide fragments that have the general characteristics of the glucoamylases of the present disclosure.

(74) The term isolated refers to a material that is removed from the natural environment if it is naturally occurring. A purified protein refers to a protein that is at least partially purified to homogeneity. In some embodiments, a purified protein can be more than about 10% pure, optionally more than about 20% pure, and optionally more than about 30% pure, as determined by SDS-PAGE. Further aspects of the disclosure encompass the protein in a highly purified form (i.e., more than about 40% pure, more than about 60% pure, more than about 80% pure, more than about 90% pure, more than about 95% pure, more than about 97% pure, and even more than about 99% pure), as determined by SDS-PAGE.

(75) As used herein, the term, combinatorial mutagenesis refers to methods in which libraries of variants of a starting sequence are generated. In these libraries, the variants contain one or several mutations chosen from a predefined set of mutations. In addition, the methods provide means to introduce random mutations that were not members of the predefined set of mutations. In some embodiments, the methods include those set forth in U.S. Pat. No. 6,582,914, hereby incorporated by reference. In alternative embodiments, combinatorial mutagenesis methods encompass commercially available kits (e.g., QuikChange Multisite, Stratagene, San Diego, Calif.).

(76) As used herein the term composition relates to a preparation in the form of for example a beverage, food or feed ingredient prepared according to the present invention, and may be in the form of a solution or as a soliddepending on the use and/or the mode of application and/or the mode of administration. The solid form can be either as a dried enzyme powder or as a granulated enzyme. The composition may comprise a polypeptide according to the invention, an enzyme carrier and optionally a stabilizer and/or a preservative. The enzyme carrier may be selected from the group consisting of glycerol or water. The preparation may comprise a stabilizer. The stabilizer may be selected from the group consisting of inorganic salts, polyols, sugars and combinations thereof. Further, the stabilizer may be an inorganic salt such as potassium chloride. In another aspect, the polyol is glycerol, propylene glycol, or sorbitol. The sugar is a small-molecule carbohydrate, in particular any of several sweet-tasting ones such as glucose, fructose and saccharose. In yet at further aspect, the preparation may comprise a preservative. In one aspect, the preservative is methyl paraben, propyl paraben, benzoate, sorbate or other food approved preservatives or a mixture thereof.

(77) In the present context, the term fermentation refers to providing a composition such as a fermented beverage and/or substance by growing microorganisms in a culture. In the context of enzyme (e.g. glucoamylase) production, the term fermentation refers to a process involving the production of the enzyme in a microbial culture process. In the context of brewing, the term fermentation refers to transformation of sugars in a wort, by enzymes in the brewing yeast, into ethanol and carbon dioxide with the formation of other fermentation by-products.

(78) As used herein, the process for production of a fermented beverage such as beer comprises in general a step of preparing a mash such as based on a grist, filtering the mash to obtain a wort and spent grain, and fermenting the wort to obtain a fermented beverage.

(79) As used herein the term starch and/or sugar containing plant material refers to starch and/or sugar containing plant material derivable from any plant and plant part, including tubers, roots, stems, leaves and seeds. Starch and/or sugar comprising plant material can e.g. be one or more cereal, such as barley, wheat, maize, rye, sorghum, millet, or rice, and any combination thereof. The starch- and/or sugar comprising plant material can be processed, e.g. milled, malted, partially malted or unmalted. Unmalted cereal is also called raw grain. Examples of non-cereal starch-containing plant material comprise e.g. tubers,

(80) As used herein, the term grist refers to any processed starch and/or sugar containing plant material suitable for mashing. The grist, as contemplated herein, may comprise any starch and/or sugar containing plant material derivable from any plant and plant part, including tubers, roots, stems, leaves and seeds. Examples of processing comprise milling and/or grinding, usually providing a material that is more coarse than flour. In the present context grist may comprise processed material from grain, such as grain from barley, wheat, rye, oat, corn, rice, milo, millet and sorghum, and more preferably, at least 10%, or more preferably at least 15%, even more preferably at least 25%, or most preferably at least 35%, such as at least 50%, at least 75%, at least 90% or even 100% (w/w) of the grist of the wort is derived from grain. In some embodiments the grist may comprise the starch and/or sugar containing plant material obtained from cassava [Manihot esculenta] roots. The grist may comprise malted grain, such as barley malt. Preferably, at least 10%, or more preferably at least 15%, even more preferably at least 25%, or most preferably at least 35%, such as at least 50%, at least 75%, at least 90% or even 100% (w/w) of the grist of the wort is derived from malted grain.

(81) As used herein the term malt is understood as any malted cereal grain, such as malted barley or wheat.

(82) In one aspect, when using malt produced principally from selected varieties of barley in connection with production of beer, the malt has the greatest effect on the overall character and quality of the beer. First, the malt is the primary flavoring agent in beer. Second, the malt provides the major portion of the fermentable sugar. Third, the malt provides the proteins, which will contribute to the body and foam character of the beer. Fourth, the malt provides enzymatic activities during mashing, optionally complemented by addition of exogenous enzymes. Fifth, the malt spent grains provide a filtration medium for the separation of the wort after mashingtypically by lautering or mash filtration.

(83) As used herein the term adjunct refers to any starch and/or sugar containing plant material which is not barley malt. As examples of adjuncts, mention can be made of materials such as common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, potato, tapioca, and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like may be used as a source of starch. The starch will eventually be converted into dextrins and fermentable sugars. In one aspect, adjunct includes the starch and/or sugar containing plant material obtained from cassava [Manihot esculenta] roots.

(84) As used herein, the term mash refers to an aqueous slurry of any starch and/or sugar containing plant material such as grist, e.g. comprising crushed barley malt, crushed barley, and/or other adjunct or a combination hereof, mixed with water later to be separated into wort and spent grains.

(85) As used herein, the term wort refers to the unfermented liquor run-off following extracting the grist during mashing.

(86) As used herein, the term spent grains refers to the drained solids remaining when the grist has been extracted and the wort is separated from the mash. Spent grains can be used e.g. as feed.

(87) As used herein, the term extract recovery in the wort refers to the sum of soluble substances extracted from the grist (malt and/or adjuncts) expressed in percentage based on dry matter.

(88) As used herein, the term hops refers to its use in contributing significantly to beer quality, including flavoring. In particular, hops (or hops constituents) add desirable bittering substances to the beer. In addition, the hops may act as protein precipitant, establish preservative agents and aid in foam formation and stabilization.

(89) As used herein, the terms beverage(s) and beverage(s) product includes beers such as full malted beer, beer brewed under the Reinheitsgebot, ale, IPA, lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, non-alcoholic malt liquor and the like. The term beverage(s) or beverages product also includes alternative cereal and malt beverages such as fruit flavoured malt beverages, e.g., citrus flavoured, such as lemon-, orange-, lime-, or berry-flavoured malt beverages, liquor flavoured malt beverages, e.g., vodka-, rum-, or tequila-flavoured malt liquor, or coffee flavoured malt beverages, such as caffeine-flavoured malt liquor, and the like. In a further aspect, the beverage or beverage product is an alcoholic or non-alcoholic beverage, such as a cereal- or malt-based beverage like beer or whiskey, such as wine, cider, vinegar, rice wine, soya sauce, or juice.

(90) As used herein, the term malt beverage includes such malt beverages as full malted beer, ale, IPA, lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic malt liquor and the like. The term malt beverages also includes alternative malt beverages such as fruit flavored malt beverages, e.g., citrus flavored, such as lemon-, orange-, lime-, or berry-flavored malt beverages, liquor flavored malt beverages, e.g., vodka-, rum-, or tequila-flavored malt liquor, or coffee flavored malt beverages, such as caffeine-flavored malt liquor, and the like.

(91) In the context of the present invention, the term beer is meant to comprise any fermented wort, produced by fermentation/brewing of a starch-containing plant material, thus in particular also beer produced exclusively from malt or adjunct, or any combination of malt and adjunct.

(92) Beer can be made from a variety of starch and/or sugar containing plant material, often cereal grains and/or malt by essentially the same process. Grain starches are believed to be glucose homopolymers in which the glucose residues are linked by either alpha-1,4- or alpha-1,6-bonds, with the former predominating.

(93) As used herein, the term Pilsner beer refers to a pale bottom-fermented lager (made from Pilsner malt) usually with a more pronounced hop character than normal (e.g. helles) pale lagers.

(94) As used herein, the term light beers, reduced calorie beers or low calorie beers, refers to the recent, widespread popularization of brewed beverages, particularly in the U.S. market. As defined in the U.S., these highly attenuated beers have approximately 30% fewer calories than a manufacturer's normal beer.

(95) As used herein, the term non-alcoholic beer or low-alcohol beer refers to a beer containing a maximum of 0.1%, 0.2%, 0.3%, 0.4%, 0.5% alcohol by volume. Non-alcoholic beer may be brewed by special methods (stopped fermentation), with special non-alcohol producing yeasts or by traditional methods, but during the finishing stages of the brewing process the alcohol is removed e.g. by vacuum evaporation, by taking advantage of the different boiling points of water and alcohol.

(96) As used herein, the term low-calorie beer or beer with a low carbohydrate content is defined as a beer with a carbohydrate content of 0.75 g/100 g or less and with fermentation degree of around 90-92%.

(97) As used herein, the term pasteurisation means the killing of micro-organisms in aqueous solution by heating. Implementation of pasteurisation in the brewing process is typically through the use of a flash pasteuriser or tunnel pasteuriser. As used herein, the term pasteurisation units or PU refers to a quantitative measure of pasteurisation. One pasteurisation unit (1 PU) for beer is defined as a heat retention of one minute at 60 degrees Celsius. One calculates that:
PU=t1.393^(T60), where: t=time, in minutes, at the pasteurisation temperature in the pasteuriser T=temperature, in degrees Celsius, in the pasteuriser [^(T60) represents the exponent of (T60)]

(98) Different minimum PU may be used depending on beer type, raw materials and microbial contamination, brewer and perceived effect on beer flavour. Typically, for beer pasteurisation, 14-15 PU are required. Depending on the pasteurising equipment, pasteurisation temperatures are typically in the range of 64-72 degrees Celsius with a pasteurisation time calculated accordingly. Further information may be found in Technology Brewing and Malting by Wolfgang Kunze of the Research and Teaching Institute of Brewing, Berlin (VLB), 3rd completely updated edition, 2004, ISBN 3-921690-49-8.

(99) Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.

(100) Before the exemplary embodiments are described in more detail, it is to be understood that this disclosure is not limited to particular embodiments described, as such may, of course, vary. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, exemplary methods, and materials are now described.

(101) As used herein and in the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a gene includes a plurality of such candidate agents and reference to the cell includes reference to one or more cells and equivalents thereof known to those skilled in the art, and so forth.

(102) The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior invention.

2. ABBREVIATIONS

(103) GA glucoamylase GAU glucoamylase unit wt weight percent C. degrees Centigrade rpm revolutions per minute aa or AA amino acid by base pair kb kilobase pair kD kilodaltons g or gm grams g micrograms mg milligrams l and L microliters ml and mL milliliters mm millimeters micrometer M molar mM millimolar M micromolar U units V volts MW molecular weight sec(s) or s(s) second/seconds min(s) or m(s) minute/minutes hr(s) or h(s) hour/hours DO dissolved oxygen ABS Absorbance EtOH ethanol PSS physiological salt solution m/v mass/volume MTP microtiter plate N Normal DP1 monosaccharides DP2 disaccharides DP>3 oligosaccharides, sugars having a degree of polymerization greater than 3 ppm parts per million SBD starch binding domain CD catalytic domain PCR polymerase chain reaction WT wild-type RDF Real Degree of Attenuation SG Specific gravity PU Pasteurisation Units MkGA I Monascus kaoliang glucoamylase I MkGA II Monascus kaoliang glucoamylase II H. jecorina Hypocrea jecorina T. reesei Trichoderma reesei AnGA Aspergillus Niger

3. MONASCUS KAOLIANG DERIVED GLUCOAMYLASE

(104) In one embodiment the invention relates to an isolated polypeptide having glucoamylase activity selected from the group consisting of:

(105) a) a polypeptide comprising an amino acid sequence having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6;
b) a polypeptide encoded by i) the nucleic acid sequence comprised in SEQ ID NO:1 or SEQ ID NO:4, or ii) the cDNA sequence of i), or iii) the sequence of SEQ ID NO:2 or SEQ ID NO:5; or iv) by a polynucleotide that hybridizes under at least low stringency conditions with the complementary strand of i), ii), or iii);
c) a polypeptide comprising a conservative substitution, deletion and/or insertion of one or more amino acids of an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6;
d) a polypeptide encoded by a polynucleotide comprising a nucleotide sequence sequence having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the mature polypeptide coding sequence of SEQ ID NO: 3 or 6; and
e) a fragment of a polypeptide of a), b), c) or d) that has glucoamylase activity.

(106) In one aspect, the polypeptide as contemplated herein is obtained by recombinant expression in a host cell. In a further aspect, the polypeptide as contemplated herein does not have a starch binding domain.

(107) Another aspect is directed to the characterization of glucoamylase(s) from Monascus kaoliang. Glucoamylases consist of as many as three distinct structural domains, including a catalytic domain of approximately 450 residues that is structurally conserved, which is generally followed by a linker region consisting of between 30 and 80 residues, that are in turn connected to a starch binding domain of approximately 100 residues. Monascus kaoliang has been found to produce two forms of glucoamylase, denoted herein as glucoamylase I and II (Iizuka et al., (1977), J. Gen. Appl. Microbiol., 23(5): 217-230; Iizuka et al., (1978), J. Gen. Appl. Microbiol., 24: 185-192). As characterized herein, glucoamylase I (MkGA I) has the amino acid sequence appended hereto as SEQ ID NO:6, the related genomic DNA sequence encoding glucoamylase I (including the identified signal peptide sequence), appended hereto as SEQ ID NO:4, and the related cDNA sequence encoding glucoamylase I, appended hereto as SEQ ID NO:5. Additionally, glucoamylase II (MkGA II) is characterized herein as having the amino acid sequence appended hereto as SEQ ID NO:3, the related genomic DNA sequence encoding glucoamylase II (including the identified signal peptide sequence), appended hereto as SEQ ID NO:1, and the related cDNA sequence encoding glucoamylase II, appended hereto as SEQ ID NO:2. Results of a sequence analysis of these glucoamylase cDNA fragments demonstrated that there were two different variants of glucoamylase. A first, longer variant, referred to herein as glucoamylase II, codes for glucoamylase with a Starch Binding Domain (SBD), and a second, shorter variant, referred to herein as glucoamylase I, codes for a glucoamylase without a SBD. The difference between the two variants is a gap of 162 base pairs at the end of the linker region that separates the catalytic core and the SBD. The mature MkGA I protein contain 480 residues (SEQ ID NO:6) compared to the mature MkGA II protein having 581 residues (SEQ ID NO:3). The two proteins are highly similar and in an ungapped alignment they differ at the following 8 positions: 459, 473, 474, 475, 476, 477, 479, and 480. At these positions the amino acids composition are as follows: MkGA I: A459, C473, A474, A475, T476, P477, A479 and V480, and MkGA II: P459, S473, R474, P475, Y476, G477, G479 and R480. In a further aspect, the invention relates to a polypeptide as described here wherein the amino acid sequence comprises at least one or more amino acid residue(s) selected from the following groups: an amino acid residue selected from the group consisting of A and P at a position corresponding to position 459 in SEQ ID NO: 3 or 6, an amino acid residue selected from the group consisting of C and S at a position corresponding to position 473 in SEQ ID NO: 3 or 6, an amino acid residue selected from the group consisting of A and R at a position corresponding to position 474 in SEQ ID NO: 3 or 6, an amino acid residue selected from the group consisting of A and P at a position corresponding to position 475 in SEQ ID NO: 3 or 6, an amino acid residue selected from the group consisting of T and Y at a position corresponding to position 476 in SEQ ID NO: 3 or 6, an amino acid residue selected from the group consisting of P and G at a position corresponding to position 477 in SEQ ID NO: 3 or 6, an amino acid residue selected from the group consisting of A and G at a position corresponding to position 479 in SEQ ID NO: 6 and/or an amino acid residue selected from the group consisting of V and R at a position corresponding to position 480 in SEQ ID NO: 3 or 6.

(108) In one aspect, the polypeptide described herein is a polypeptide, wherein the amino acid sequence has at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 6. In a further aspect, the polypeptide described herein comprises or consist of the amino acid sequence of SEQ ID NO: 3 or 6, or a fragment thereof having glucoamylase activity.

(109) In one aspect, the polypeptide described herein has a glucoamylase activity (GAU) of at least 0.05 GAU/mg, 0.1 GAU/mg, 0.2 GAU/mg, 0.3 GAU/mg, 0.4 GAU/mg, 0.5 GAU/mg, 0.6 GAU/mg, 0.7 GAU/mg, 0.8 GAU/mg, 0.9 GAU/mg, 1 GAU/mg, 2 GAU/mg, 3 GAU/mg, 5 GAU/mg, or 10 GAU/mg.

(110) In another aspect, the polypeptide described herein has a glucoamylase activity (GAU) of 0.05-10 GAU/mg, such as 0.1-5 GAU/mg, such as 0.5-4 GAU/mg, such as 0.7-3 GAU/mg, or such as 1-3 GAU/mg.

(111) In yet a further aspect, the polypeptide described herein comprises or consist of the mature polypeptide of SEQ ID NO:3 or 6.

(112) In one embodiment, essentially purified glucoamylase I or II can be produced from wild type, natural, or otherwise unmodified strains of Monascus kaoliang, which may provide for a non-GMO produced glucoamylase.

(113) A further aspect relates to isolated polynucleotides encoding Monascus kaoliang glucoamylase I or II, or any variants thereof, such that nucleotide substitutions, deletions or insertions encode an alternative form of glucoamylase that maintains the biochemical characteristics of glucoamylase I or II, or other host glucoamylase. The polynucleotides may be prepared by established techniques known in the art. The polynucleotides may be prepared synthetically, such as by an automatic DNA synthesizer. The DNA sequence may be of mixed genomic (or cDNA) and synthetic origin prepared by ligating fragments together. The polynucleotides may also be prepared by polymerase chain reaction (PCR) using specific primers. In general, reference to such techniques is made to Minshull J. et al., Methods 32(4):416-427 (2004). DNA may also be synthesized by a number of commercial companies such as Geneart AG, Regensburg, Germany.

(114) Another embodiment provides isolated polynucleotides comprising a nucleotide sequence (i) having at least 50% identity to SEQ ID NOS: 1, 2, 4 or 5, including at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, and at least 99%, or (ii) being capable of hybridizing to a probe derived from the nucleotide sequence set forth in SEQ ID NOS: 1, 2, 4 or 5, under conditions of intermediate to high stringency, or (iii) being complementary to a nucleotide sequence having at least 90% sequence identity to the sequence set forth in SEQ ID NOS: 1, 2, 4 or 5. Probes useful according to the disclosure may include at least 50, 100, 150, 200, 250, 300 or more contiguous nucleotides of SEQ ID NOS: 1, 2, 4 or 5.

(115) These isolated polynucleotides may encode the glucoamylases as contemplated herein that comprise an amino acid sequence comprising at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 93%, at least 95%, at least 97%, at least 98%, or at least 99% amino acid sequence identity to SEQ ID NOS: 3 or 6. Expression vectors are provided which can comprise any of the polynucleotides described herein. Also disclosed are fragments (i.e., portions) of the DNA encoding the variant glucoamylases provided herein. These fragments find use in obtaining partial length DNA fragments capable of being used to isolate or identify polynucleotides encoding mature glucoamylase enzymes as described hereinthroughout.

(116) In yet another embodiment, a glucoamylase variant can be inserted into the organism, such as a variant having altered thermostability, such as higher thermostability and/or improved specific activity.

(117) The conservation of structure in the glucoamylase molecule correlates with the conservation of activity and a conserved mechanism of action for all glucoamylases. Given this high homology, site specific variants of glucoamylases as contemplated herein may result in altered function, and are expected to have similar structural and therefore functional consequences in other glucoamylase variants.

(118) Glucoamylase variants, as contemplated herein, may have amino acid substitutions at positions that are equivalent to the particular identified residues in Monascus kaoliang glucoamylase I or II (SEQ ID NOS: 6 AND 3, respectively).

(119) Structural identity determines whether the amino acid residues are equivalent. Structural identity is a one-to-one topological equivalent when the two structures (three dimensional and amino acid structures) are aligned. A residue (amino acid) position of a glucoamylase is equivalent to a residue of Monascus kaoliang glucoamylase if it is either homologous (i.e., corresponding in position in either primary or tertiary structure) or analogous to a specific residue or portion of that residue in Monascus kaoliang glucoamylase (having the same or similar functional capacity to combine, react, or interact chemically).

(120) To establish identity to the primary structure, the amino acid sequence of a particular glucoamylase can be compared directly to Monascus kaoliang glucoamylase I or II sequence, and particularly to a set of residues known to be invariant in glucoamylases for which sequence is known. After aligning the conserved residues, allowing for necessary insertions and deletions in order to maintain alignment (i.e. avoiding the elimination of conserved residues through arbitrary deletion and insertion), the residues equivalent to particular amino acids in the primary sequence of Monascus kaoliang glucoamylase are defined. Equivalent residues may be defined by 100% conservation with Monascus kaoliang glucoamylase I or II. However, alignment of greater than 75% or as little as 50% of conserved residues can be also adequate to define equivalent residues, particularly when alignment based on structural identity is included.

(121) Structural identity involves the identification of equivalent residues between the two structures. Equivalent residues can be defined by determining homology at the level of tertiary structure (structural identity) for an enzyme whose tertiary structure has been determined by X-ray crystallography. Equivalent residues are defined as those for which the atomic coordinates of two or more of the main chain atoms of a particular amino acid residue of the Monascus kaoliang glucoamylase (N on N, CA on CA, C on C and O on O) are within 0.13 nm and optionally 0.1 nm after alignment. Alignment is achieved after the best model has been oriented and positioned to give the maximum overlap of atomic coordinates of non-hydrogen protein atoms of the glucoamylase in question to Monascus kaoliang glucoamylase I or II. The best model is the crystallographic model giving the lowest R factor for experimental diffraction data at the highest resolution available.

(122) R factor = .Math. h .Math. Fo ( h ) .Math. - .Math. Fc ( h ) .Math. .Math. h .Math. Fo ( h ) .Math.

(123) Equivalent residues that are functionally analogous to a specific residue of Monascus kaoliang glucoamylase I or II are defined as those amino acids of the enzyme that may adopt a conformation such that they either alter, modify or contribute to protein structure, substrate binding or catalysis in a manner defined and attributed to a specific residue of Monascus kaoliang glucoamylase I or II. Further, they are those residues of the enzyme (for which a tertiary structure may be obtained by X-ray crystallography) that occupy an analogous position to the extent that, although the main chain atoms of the given residue may not satisfy the criteria of equivalence on the basis of occupying a homologous position, the atomic coordinates of at least two of the side chain atoms of the residue lie with 0.13 nm of the corresponding side chain atoms of Monascus kaoliang glucoamylase I or II. In some embodiments, variant glucoamylases as contemplated herein may have at least 50% sequence identity, at least 60% sequence identity, at least 70% sequence identity, at least 80% sequence identity, at least 85% sequence identity, at least 88% sequence identity, at least 90% sequence identity, at least 93% sequence identity, at least 95% sequence identity, at least 96% sequence identity, at least 97% sequence identity, at least 98% sequence identity and also at least 99% sequence identity with the Monascus kaoliang glucoamylase amino acid sequences of either SEQ ID NOS: 3 or 6.

(124) In some embodiments, a glucoamylase variant will have more than one amino acid substitution. For example, the variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 amino acid substitutions, deletions, or insertions as compared to Monascus kaoliang glucoamylase I or II. In some embodiments, a glucoamylase variant comprises a substitution, deletion, or insertion in at least one amino acid position in a position corresponding to the regions of non-conserved amino acids. As contemplated herein, the glucoamylase variants can have substitutions, deletions, or insertions in any position in the mature protein sequence.

(125) As contemplated herein, a DNA sequence encoding glucoamylase or a glucoamylase variant can be expressed, in enzyme form, using an expression vector which typically includes control sequences encoding a promoter, operator, ribosome binding site, translation initiation signal, and, optionally, a repressor gene or various activator genes. The recombinant expression vector carrying the DNA sequence encoding a glucoamylase as contemplated herein may be any vector which may conveniently be subjected to recombinant DNA procedures. The vector may be one which, when introduced into Monascus kaoliang, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated. For example, the fungal cell may be transformed with the DNA construct encoding the glucoamylase, and integrating the DNA construct, in one or more copies, in the host chromosome(s). This integration is generally considered to be an advantage, as the DNA sequence is more likely to be stably maintained. Integration of the DNA constructs into the host chromosome may be performed according to conventional methods, such as by homologous or heterologous recombination.

(126) In an embodiment incorporating use of a vector, the DNA sequence should be operably connected to a suitable promoter sequence. The promoter may be any DNA sequence which shows transcriptional activity in Monascus kaoliang and may be derived from genes encoding proteins either homologous or heterologous to Monascus kaoliang. Examples of suitable promoters for directing the transcription of the DNA sequence encoding a glucoamylase variant are, by non-limiting example only, those derived from the gene encoding A. oryzae TAKA amylase, the T. reesei cellobiohydrolase I, Rhizomucor miehei aspartic proteinase, A. niger neutral -amylase, A. niger acid stable -amylase, A. niger glucoamylase, Rhizomucor miehei lipase, A. oryzae alkaline protease, or A. nidulans glyceraldehyde-3-phosphate dehydrogenase A. Any expression vector as contemplated may also comprise a suitable transcription terminator and polyadenylation sequences operably connected to the DNA sequence encoding the glucoamylase or variant. Termination and polyadenylation sequences may suitably be derived from the same sources as the promoter. The vector may further comprise any DNA sequence enabling or effectuating the vector to replicate in the fungal host. The vector may also comprise additional genes, the product of which may complement a defect in the fungal host. For example, selectable markers may be incorporated to provide drug resistance. As contemplated herein, all procedures used to ligate DNA constructs encoding a glucoamylase, the promoter, terminator and other elements, respectively, and to insert them into suitable vectors containing the information necessary for replication, are those as may be understood by persons skilled in the art.

(127) In one aspect the invention relates to a host cell having heterologous expression of a polypeptide as described herein such as a fungal cell for example of the genus Trichoderma such as Trichoderma reesei. In another aspect, the fungal cell is of the species Hypocrea jecorina.

(128) In one aspect, the host cell comprises, or is preferably transformed with, a plasmid or an expression vector and is therefore capable of expressing a polypeptide as contemplated herein. In one aspect, the expression vector comprises a nucleic acid and the expression vector or plasmid as contemplated herein may comprise a promoter derived from Trichoderma such as a T. reesei cbhI-derived promoter and/or the a terminator derived from Trichoderma such as a T. reesei cbhI-derived terminator and/or one or more selective markers such as Aspergillus nidulans amdS and pyrG and/or one or more telomere regions allowing for a non-chromosomal plasmid maintenance in a host cell.

(129) In one aspect, the invention relates to a method of isolating a polypeptide as described herein, the method comprising the steps of inducing synthesis of the polypeptide in a host cell having heterologous expression of said polypeptide, recovering extracellular protein secreted by said host cell, and optionally purifying the polypeptide. In another embodiment, glucoamylases can be produced from genetically modified Monascus kaoliang. For example, Monascus kaoliang may be genetically modified so as to produce enriched or overexpressed glucoamylases. Extraction methods may include those as described in the experimental examples provided below, or by any other means for extracting glucoamylases from a culture as would be understood by those skilled in the art. In one embodiment, glucoamylase may be overproduced from a genetically modified Monascus kaoliang strain having multiple copies of the glucoamylase gene. In another embodiment, the fungal strain may be genetically modified to inactivate other secreted enzymes. In a further embodiment, one or more copies of the glucoamylase genes may be operably linked to a different promoter, such as a highly efficient promoter region from another gene. In yet another embodiment, the fungal strain may be protease deficient or a protease minus strain.

(130) A further aspect is directed to an improved and cost-effective process for isolating glucoamylase I and II suitable for large scale protein purification procedures. In one embodiment, the method includes the steps of growing a culture of Monascus kaoliang, and inducing synthesis of a glucoamylase. The DNA sequence encoding glucoamylase may be the natural or unmodified sequence, or it may be a modified sequence. Monascus kaoliang may be transformed by processes involving protoplast formation and transformation of the protoplasts followed by regeneration of the cell wall, according to standard methods and procedures as understood by those skilled in the art. Any standard method of transforming Monascus kaoliang may also be used. The medium used to cultivate Monascus kaoliang may be any conventional medium suitable for growing the fungal host and inducing expression of the glucoamylase or variant thereof. Suitable media are available from commercial suppliers or may be prepared according to published formulae. Glucoamylase or variants thereof secreted from Monascus kaoliang may conveniently be recovered from the culture medium by standard procedures, including separating the cells from the medium by centrifugation or filtration, and precipitating proteinaceous components of the medium by means of a salt such as ammonium sulphate, followed by the use of chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like. Because glucoamylase is the only dominant enzyme secreted by Monascus kaoliang, any additional separation steps to remove unwanted enzymes, such as alpha amylases, are either minimized or unnecessary. By removing the need to isolate the glucoamylase from other unwanted proteinaceous components, a significant efficiency and cost saving procedure is created. Additionally, the Monascus kaoliang host provides at least a similar yield of glucoamylase as other glucoamylase host cells, and in another embodiment, the use of Monascus kaoliang as a host provides a greater yield of glucoamylase or variant thereof, as compared to historical glucoamylase host cells.

(131) In one aspect, the invention relates to a method of isolating a polypeptide as described herein, the method comprising the steps of inducing synthesis of the polypeptide in a host cell having heterologous expression of said polypeptide, recovering extracellular protein secreted by said host cell, and optionally purifying the polypeptide.

(132) The activity and/or specific activity of any glucoamylase as contemplated herein is determined by standard methods as would be understood by those skilled in the art.

4. COMPOSITIONS AND USES

(133) The glucoamylases as contemplated herein may be used in compositions including but not limited to starch hydrolyzing and saccharifying compositions, cleaning and detergent compositions (e.g., laundry detergents, dish washing detergents, and hard surface cleaning compositions), alcohol fermentation compositions, and in animal feed compositions, for example. Further, these glucoamylases may be used in baking applications, such as bread and cake production, brewing, healthcare, textile, environmental waste conversion processes, biopulp processing, and biomass conversion applications.

(134) In some embodiments, a composition comprising a glucoamylase as contemplated herein will be optionally used in combination with any one or in any combination with the following enzymesalpha amylases, beta-amylases, peptidases (proteases, proteinases, endopeptidases, exopeptidases), pullulanases, isoamylases, cellulases, hemicellulases, endo-glucanases and related beta-glucan hydrolytic accessory enzymes, xylanases and xylanase accessory enzymes, acetolactate decarboxylases, cyclodextrin glycotransferases, lipases, phytases, laccases, oxidases, esterases, cutinases, granular starch hydrolyzing enzymes and other glucoamylases.

(135) In some embodiments, the composition will include the one or more further enzyme(s). In some embodiments, the composition will include the one or more further enzyme(s) selected among alpha-amylase, beta-amylase, peptidase (such as protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof.

(136) In another embodiment, the polypeptide(s) contemplated herein and/or one or more further enzyme(s) is inactivated by pasteurisation, such as by using less than 50, 45, 40, 35, 30, 25, 24, 23, 22, 21 or 20 pasteurisation units (PU) in beer, such as Pilsner beer.

(137) In some embodiments, the composition will include an alpha amylase such as fungal alpha amylases (e.g., Aspergillus sp.) or bacterial alpha amylases (e.g., Bacillus sp. such as B. stearothermophilus, (Geobacillus stearothermophilus), B. amyloliquefaciens, and B. licheniformis) and variants and hybrids thereof. In some embodiments, the alpha amylase is an acid stable alpha amylase. In some embodiments, the alpha amylase is Aspergillus kawachi alpha amylase (AkAA), see U.S. Pat. No. 7,037,704. Commercially available alpha amylases contemplated for use in the compositions of the disclosure are known and include GZYME G-997, SPEZYME FRED, SPEZYME XTRA (Danisco US, Inc, Genencor Division), TERMAMYL 120-L and SUPRA (Novozymes, Biotech.).

(138) In some embodiments, the composition will include an acid fungal protease. In a further embodiment, the composition will include the endo-protease (EC 3.4.21.26) sourced from a variant of the microorganism Aspergillus niger that hydrolyses peptides at the carboxyl site of proline residues disclosed in WO 2007/101888 published 13 Sep. 2007. In a further embodiment, the acid fungal protease is derived from a Trichoderma sp and may be any one of the proteases disclosed in US 2006/0154353, published Jul. 13, 2006, incorporated herein by reference. In a further embodiment, the composition will include a phytase from Buttiauxiella spp. (e.g., BP-17, see also variants disclosed in PCT patent publication WO 2006/043178). In a further embodiment, the composition will include an acetolactate decarboxylase (ALDC) EC 4.1.1.5, for example from Bacillus licheniformis or from the ALDC gene of Bacillus brevis expressed in a modified strain of Bacillus subtilis as disclosed in U.S. Pat. No. 4,617,273 published Oct. 14, 1986.

(139) In other embodiments, the glucoamylases as contemplated herein may be combined with other such glucoamylases. In some embodiments, such glucoamylases will be combined with one or more glucoamylases derived from other various strains or variants of Monascus kaoliang, or of Aspergillus or variants thereof, such as A. oryzae, A. niger, A. kawachi, and A. awamori; glucoamylases derived from strains of Humicola or variants thereof; glucoamylases derived from strains of Talaromyces or variants thereof, such as T. emersonii; glucoamylases derived from strains of Athelia, such as A. rolfsii; or glucoamylases derived from strains of Penicillium, such as P. chrysogenum, for example.

(140) In particular, glucoamylases as contemplated herein may be used for starch conversion processes, and particularly in the production of dextrose for fructose syrups, specialty sugars and in alcohol and other end-product (e.g., organic acid, ascorbic acid, and amino acids) production from fermentation of starch containing substrates (G. M. A. van Beynum et al., Eds. (1985) STARCH CONVERSION TECHNOLOGY, Marcel Dekker Inc. NY). Dextrins produced using variant glucoamylase compositions of the disclosure may result in glucose yields of at least 80%, at least 85%, at least 90% and at least 95%. Production of alcohol from the fermentation of starch substrates using glucoamylases as contemplated herein may include the production of fuel alcohol or potable alcohol. In some embodiments, the production of alcohol will be greater when variant glucoamylases are used under the same conditions as wild-type glucoamylase. In some embodiments, the production of alcohol will be between about 0.5% and 2.5% better, including but not limited to 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.1%, 1.2%, 1.3%, 1.4%, 1.5%, 1.6%, 1.7%, 1.8%, 1.9%, 2.0%, 2.1%, 2.2%, 2.3%, and 2.4% more alcohol than the wild-type glucoamylase.

(141) In some embodiments, the glucoamylases as contemplated herein will find use in the hydrolysis of starch from various plant-based substrates, usually starch and/or sugar containing plant material, which are used for alcohol production. In some embodiments, the plant-based substrates will include corn, wheat, barley, rye, milo, rice, sugar cane, potatoes, cassava and combinations thereof. In some embodiments, the plant-based substrate will be fractionated plant material, for example a cereal grain such as corn, which is fractionated into components such as fiber, germ, protein and starch (endosperm) (U.S. Pat. No. 6,254,914 and U.S. Pat. No. 6,899,910). Methods of alcohol fermentations are described in THE ALCOHOL TEXTBOOK, A REFERENCE FOR THE BEVERAGE, FUEL AND INDUSTRIAL ALCOHOL INDUSTRIES, 3rd Ed., Eds K. A. Jacques et al., 1999, Nottingham University Press, UK. In certain embodiments, the alcohol will be ethanol. In particular, alcohol fermentation production processes are characterized as wet milling or dry milling processes. In some embodiments, the glucoamylase will be used in a wet milling fermentation process and in other embodiments the glucoamylase will find use in a dry milling process.

(142) Dry grain milling involves a number of basic steps, which generally include: grinding, cooking, liquefaction, saccharification, fermentation, and separation of liquid and solids to produce alcohol and other co-products. Plant material and particularly whole cereal grains, such as corn, wheat, or rye are ground. In some cases the grain may be first fractionated into component parts. The ground plant material may be milled to obtain a coarse or fine particle. The ground plant material can be mixed with liquid (e.g., water and/or thin stillage) in a slurry tank. The slurry is subjected to high temperatures (e.g., 90 C. to 105 C. or higher) in a jet cooker along with liquefying enzymes (e.g., alpha amylases) to solublize and hydrolyze the starch in the grain to dextrins. The mixture can be cooled down and further treated with saccharifying enzymes, such as glucoamylases encompassed by the instant disclosure, to produce glucose. The mash containing glucose may then be fermented for approximately 24 to 120 hours in the presence of fermentation microorganisms, such as ethanol producing microorganism and particularly yeast (Saccharomyces spp). The solids in the mash are separated from the liquid phase and alcohol such as ethanol and useful co-products such as distillers' grains are obtained.

(143) In some embodiments, the saccharification step and fermentation step are combined and the process is referred to as simultaneous saccharification and fermentation or simultaneous saccharification, yeast propagation and fermentation.

(144) In other embodiments, these glucoamylases may be used in a process for starch hydrolysis wherein the temperature of the process is between 30 C. and 75 C., in some embodiments, between 40 C. and 65 C. In some embodiments, the glucoamylase can be used in a process for starch hydrolysis at a pH of between pH 3.0 and pH 6.5. The fermentation processes in some embodiments include milling of a cereal grain or fractionated grain and combining the ground cereal grain with liquid to form a slurry that can then be mixed in a single vessel with a glucoamylase according to the disclosure and optionally other enzymes such as, but not limited to, alpha amylases, other glucoamylases, phytases, proteases, pullulanases, isoamylases or other enzymes having granular starch hydrolyzing activity and yeast to produce ethanol and other co-products (see e.g., U.S. Pat. No. 4,514,496, WO 04/081193, and WO 04/080923).

(145) In some embodiments, the disclosure pertains to a method of saccharifying a liquid starch solution, which comprises an enzymatic saccharification step using one or more glucoamylases as contemplated herein.

(146) In some embodiments, the disclosure pertains to a method of hydrolyzing and saccharifying gelatinised and liquefied (typically) grist starch to be used in brewing, whereby a composition comprising one or more glucoamylases as contemplated herein, is used to enhance the amount of brewers' yeast fermentable sugars obtained from the starch. A brewing process is used to produce the potable product, beer, where fermentable sugars are converted to ethanol and CO.sub.2 by fermentation with brewers' yeast. The fermentable sugars are traditionally derived from starch in cereal grains, optionally supplemented with fermentable sugar sources such as glucose and maltose syrups and cane sugar. Briefly, beer production, well-known in the art, typically includes the steps of malting, mashing, and fermentation.

(147) Historically the first step in beer production is maltingsteeping, germination and drying of cereal grain (e.g. barley). During malting enzymes are produced in the germinating cereal (e.g. barley) kernel and there are certain changes in its chemical constituents (known as modification) including some degradation of starch, proteins and beta-glucans.

(148) The malted cereal is milled to give a grist which may be mixed with a milled adjunct (e.g. non-germinated cereal grain) to give a mixed grist. The grist can also consist predominantly, or uniquely of adjunct. The grist is mixed with water and subjected to mashing; a previously cooked (gelatinised and liquefied) adjunct (the result of adjunct cooking) may be added to the mash. The mashing process is conducted over a period of time at various temperatures in order to hydrolyse cereal proteins, degrade beta-glucans and solubilise and hydrolyse the starch. The hydrolysis of the grist starch in the malt and adjunct in traditional mashing is believed to be catalysed by two main enzymes endogenous to malted barley. Alpha-amylase, randomly cleaves alpha-1,4 bonds in the interior of the starch molecule fragmenting them into smaller dextrins. Beta-amylase sequentially cleaves alpha-1,4 bonds from the non-reducing end of the these dextrins producing mainly maltose. Both alpha- and beta-amylase are unable to hydrolyse the alpha-1,6 bonds which forms the branching points of the starch chains in the starch molecule, which results in the accumulation of limit dextrins in the mash. Malt does contain an enzyme, limit dextrinase, which catalyses the hydrolysis of alpha-1,6 bonds but it only shows weak activity at mashing temperatures due to its thermolability. After mashing, the liquid extract (wort) is separated from the spent grain solids (i.e. the insoluble grain and husk material forming part of grist). The objectives of wort separation include: to obtain good extract recovery, to obtain good filterability, and to produce clear wort. Extract recovery and filterability of the wort are important in the economics of the brewing process.

(149) The composition of the wort depends on the raw materials, mashing process and profiles and other variables. A typical wort comprises 65-80% fermentable sugars (glucose, maltose and maltotriose, and 20-35% non-fermentable limit dextrins (sugars with a higher degree of polymerization than maltotriose). An insufficiency of starch hydrolytic enzymes during mashing can arise when brewing with high levels of adjunct unmalted cereal grists. A source of exogenous enzymes, capable of producing fermentable sugars during the mashing process is thus needed. Furthermore, such exogenous enzymes are also needed to reduce the level of non-fermentable sugars in the wort, with a corresponding increase in fermentable sugars, in order to brew highly attenuated beers with a low carbohydrate content. Herein disclosed is a enzyme composition for hydrolysis of starch comprising at least one glucoamylase as contemplated herein, which can be added to the mash or used in the mashing step of a brewing process, in order to cleave alpha-1,4 bonds and/or alpha-1,6 bonds in starch grist and thereby increase the fermentable sugar content of the wort and reduce the residue of non-fermentable sugars in the finished beer. In addition, the wort, so produced may be dried (by for example spray drying) or concentrated (e.g. boiling and evaporation) to provide a syrup or powder.

(150) The grist, as contemplated herein, may comprise any starch and/or sugar containing plant material derivable from any plant and plant part, including e.g. tubers, roots, stems, leaves and seeds as described previously. Preferably the grist comprises grain, such as grain from barley, wheat, rye, oat, corn, rice, milo, millet and sorghum, and more preferably, at least 10%, or more preferably at least 15%, even more preferably at least 25%, or most preferably at least 35%, such as at least 50%, at least 75%, at least 90% or even 100% (w/w) of the grist of the wort is derived from grain. Most preferably the grist comprises malted grain, such as barley malt. Preferably, at least 10%, or more preferably at least 15%, even more preferably at least 25%, or most preferably at least 35%, such as at least 50%, at least 75%, at least 90% or even 100% (w/w) of the grist of the wort is derived from malted grain. Preferably the grist comprises adjunct, such as non-malted grain from barley, wheat, rye, oat, corn, rice, milo, millet and sorghum, and more preferably, at least 10%, or more preferably at least 15%, even more preferably at least 25%, or most preferably at least 35%, such as at least 50%, at least 75%, at least 90% or even 100% (w/w) of the grist of the wort is derived from non-malted grain or other adjunct. Adjunct comprising readily fermentable carbohydrates such as sugars or syrups may be added to the malt mash before, during or after the mashing process of the invention but is preferably added after the mashing process. A part of the adjunct may be treated with an alpha-amylase, and/or endopeptidase (protease) and/or a endoglucanase, and/or heat treated before being added to the mash. The enzyme composition for hydrolysis of starch, as contemplated herein, may include additional enzyme(s), preferably an enzyme selected from among an alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof. During the mashing process, starch extracted from the grist is gradually hydrolyzed into fermentable sugars and smaller dextrins. Preferably the mash is starch negative to iodine testing, before wort separation.

(151) After mashing, the wort (liquid extract wort) is separated from the spent grain solids by the process of lautering or mash filtration. The objectives of wort separation include: good extract recovery; good filterability, and a clear wort (further information may be found in Technology Brewing and Malting by Wolfgang Kunze of the Research and Teaching Institute of Brewing, Berlin (VLB), 3rd completely updated edition, 2004, ISBN 3-921690-49-8).

(152) Prior to the third step of the brewing process, fermentation, the wort is typically transferred to a brew kettle and boiled vigorously for 50-60 minutes. A number of important processes occur during wort boiling (further information may be found in Technology Brewing and Malting by Wolfgang Kunze of the Research and Teaching Institute of Brewing, Berlin (VLB), 3rd completely updated edition, 2004, ISBN 3-921690-49-8) including inactivation of the endogenous malt enzymes and any exogenous enzyme added to the mash or adjunct. The boiled wort is then cooled, pitched with brewers' yeast and fermented at temperatures ranged from 8-16 C. to convert the fermentable sugars to ethanol. A low-alcohol beer can be produced from the final beer, by a process of vacuum evaporation that serves to selectively remove alcohol. Furthermore, hops may be added to the wort.

(153) In one aspect, the invention relates to the use of a polypeptide or a composition as contemplated herein in a fermentation, wherein said polypeptide or composition is added before or during a fermentation step. In a further aspect, said fermentation step is followed by a pasteurisation step. In one aspect, said fermented beverage is selected from the group consisting of beer such as low alcohol beer or low calorie beer. In another aspect, said polypeptide or said composition is added in combination with one or more further enzyme(s), such as selected among alpha-amylase, protease, pullulanase, isoamylase, cellulase, endoglucanase, xylanase, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase and glucoamylase, including any combination(s) thereof. In yet a further aspect, the polypeptide and/or the one or more further enzyme(s) is inactivated in the pasteurisation step.

(154) In one aspect, the polypeptide(s) contemplated herein is added in an amount of for example 1-1000 mg pr. kg grist, such as 20-500 mg pr. kg grist, such as 30-400 mg pr. kg grist such as 40-300 mg pr. kg grist, such as 50-200 mg pr. kg grist.

(155) In one aspect, the polypeptide(s) contemplated herein is added in an amount of for example at least 1, 50, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 mg pr. kg. grist.

(156) In an alternative embodiment, the invention relates to a method, such as in a method wherein a fermentation is comprised in a process for making a fermented beverage, which method comprises adding a polypeptide or a composition as described herein before or during a fermentation step, such as in a method comprising a pasteurisation step after the fermentation step or optional beer filtration step.

(157) In one aspect, the invention relates to a method for production of a fermented beverage which comprises the following steps:

(158) a) preparing a mash, such as obtained from a grist, where said grist for example comprises one or more of malted and/or unmalted grain, or starch-based material from another crop, and wherein the this step optionally further comprises contacting said mash with one or more further enzyme(s),
b) filtering the mash to obtain a wort, and
c) fermenting the wort to obtain a fermented beverage,
and optionally a pasteurisation step (d)
wherein a polypeptide or a composition as described herein is added to: i. the mash of step (a) and/or ii. the wort of step (b) and/or iii. the wort of step (c).

(159) In one aspect the one or more enzymes optionally added in step a may be selected among a starch debranching enzyme, R-enzyme, limit dextrinase, alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof. In another aspect, one or more enzymes may also be added by contacting the wort of step (b) or (c) with one or more further enzyme(s), wherein the enzyme is selected among a starch debranching enzyme, isoamylase and limit dextrinase, including any combinations thereof.

(160) In an alternative embodiment, the disclosure pertains to a method of enhancing the amount of fermentable sugars in the wort, using a composition comprising one or more glucoamylases as contemplated herein (e.g. thermolabile glucoamylase), whereby the composition is added to the wort after it has been boiled, such that the one or more glucoamylases are active during the fermentation step. The composition can be added to the boiled wort either before, simultaneously, or after the wort is pitched with the brewers' yeast. At the end of the fermentation and maturation step the beer, which may optionally be subjected to vacuum evaporation to produce a low-alcohol beer, is then optionally filtered and/or pasteurised. An inherent advantage of this method lies in the duration of the fermentation process, which is about 6-15 days (depending on pitching rate, fermentation, temperature, etc), which allows more time for the enzymatic cleavage of non-fermentable sugars, as compared to the short mashing step (2-4 h duration). A further advantage of this method lies in the amount of the composition needed to achieve the desired decrease in non-fermentable sugars (and increase in fermentable sugars), which corresponds to a significantly lower number of units of enzymatic activity (e.g. units of glucoamylase activity) than would need to be added to the mash to achieve a similar decrease in non-fermentable sugars. In addition, it removes the difficulties often seen during wort separation, especially by lautering, when high dose rates of glucoamylase are added in the mash. In contrast to alternative sources of glucoamylase enzyme, it has surprisingly been found that the glucoamylases as contemplated herein, are sufficiently temperature sensitive, that the final heat-treatment step of the finished beer (standard pasteurisation conditions) is sufficient for its catalytic activity to be inactivated. Hence an important advantage of the composition comprising one or more glucoamylases as contemplated herein, is that it can be used to reduce the amount of non-fermentable sugars in the wort during the fermentation step of brewing in order to brew highly attenuated beers with a low carbohydrate content, and where the catalytic activity of the composition is susceptible to inactivation by the heat treatment during beer pasteurisation thereby avoiding the expense of immobilized enzyme reactors or the use of genetically engineered brewer's yeast.

(161) The present disclosure also provides a method for the production of a food, feed, or beverage product, such as an alcoholic or non-alcoholic beverage, such as a cereal- or malt-based beverage like beer or whiskey, such as wine, cider, vinegar, rice wine, soya sauce, or juice, said method comprising the step of treating a starch and/or sugar containing plant material with a polypeptide or a composition as described herein. In another aspect, the invention also relates to a kit comprising a polypeptide, or a composition as contemplated herein; and instructions for use of said polypeptide or composition. The invention also relates to a fermented beverage produced by a method as described herein.

(162) The present disclosure also provides an animal feed composition or formulation comprising at least one glucoamylase as contemplated herein. Methods of using a glucoamylase enzyme in the production of feeds comprising starch are provided in for example WO 03/049550 (herein incorporated by reference in its entirety). Briefly, the glucoamylase is admixed with a feed comprising starch. The glucoamylase is capable of degrading resistant starch for use by the animal.

(163) Other objects and advantages of the present disclosure are apparent from the present specification.

5. FURTHER EMBODIMENTS ACCORDING TO THE INVENTION

Embodiment 1

(164) An isolated polypeptide having glucoamylase activity selected from the group consisting of: a) a polypeptide comprising an amino acid sequence having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6; b) a polypeptide encoded by i) the nucleic acid sequence comprised in SEQ ID NO:1 or SEQ ID NO:4, or ii) the cDNA sequence of i), or iii) the sequence of SEQ ID NO:2 or SEQ ID NO:5; or iv) by a polynucleotide that hybridizes under at least low stringency conditions with the complementary strand of i), ii), or iii); c) a polypeptide comprising a conservative substitution, deletion and/or insertion of one or more amino acids of an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6; d) a polypeptide encoded by a polynucleotide comprising a nucleotide sequence sequence having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the mature polypeptide coding sequence of SEQ ID NO: 3 or 6; and e) a fragment of a polypeptide of a), b), c) or d) that has glucoamylase activity.

Embodiment 2

(165) An isolated polypeptide having glucoamylase activity comprising an amino acid sequence having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6.

Embodiment 3

(166) An isolated polypeptide having glucoamylase activity encoded by i) the nucleic acid sequence comprised in SEQ ID NO:1 or SEQ ID NO:4, or ii) the cDNA sequence of i), or iii) the sequence of SEQ ID NO:2 or SEQ ID NO:5; or iv) by a polynucleotide that hybridizes under at least low stringency conditions with the complementary strand of i), ii), or iii).

Embodiment 4

(167) An isolated polypeptide having glucoamylase activity comprising a conservative substitution, deletion and/or insertion of one or more amino acids of an amino acid sequence selected from the group consisting of the mature polypeptide of SEQ ID NO: 3 and 6.

Embodiment 5

(168) An isolated polypeptide having glucoamylase activity encoded by a polynucleotide comprising a nucleotide sequence having at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the mature polypeptide coding sequence of SEQ ID NO: 3 or 6.

Embodiment 6

(169) An isolated polypeptide having glucoamylase activity which polypeptide is a fragment of a polypeptide according to any one of embodiments 1-5.

Embodiment 7

(170) The polypeptide according to any one of embodiments 1-6, wherein the amino acid sequence comprises at least one or more amino acid residue(s) selected from the following groups: a. an amino acid residue selected from the group consisting of A and P at a position corresponding to position 459 in SEQ ID NO: 3 or 6, b. an amino acid residue selected from the group consisting of C and S at a position corresponding to position 473 in SEQ ID NO: 3 or 6, c. an amino acid residue selected from the group consisting of A and R at a position corresponding to position 474 in SEQ ID NO: 3 or 6, d. an amino acid residue selected from the group consisting of A and P at a position corresponding to position 475 in SEQ ID NO: 3 or 6, e. an amino acid residue selected from the group consisting of T and Y at a position corresponding to position 476 in SEQ ID NO: 3 or 6, f. an amino acid residue selected from the group consisting of P and G at a position corresponding to position 477 in SEQ ID NO: 3 or 6, g. an amino acid residue selected from the group consisting of A and G at a position corresponding to position 479 in SEQ ID NO: 3 or 6 and/or h. an amino acid residue selected from the group consisting of V and R at a position corresponding to position 480 in SEQ ID NO: 3 or 6.

Embodiment 8

(171) The polypeptide according to any one of embodiments 1-7, wherein the amino acid sequence has at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 3 or 6.

Embodiment 9

(172) The polypeptide according to any one of embodiments 1-8, comprising or consisting of the amino acid sequence of SEQ ID NO: 3 or 6, or a fragment thereof having glucoamylase activity.

Embodiment 10

(173) The polypeptide according to any one of embodiments 1-9, comprising or consisting of the mature polypeptide of SEQ ID NO:3 or 6.

Embodiment 11

(174) The polypeptide according to any one of embodiments 1-10, wherein the percentage of identity of one amino acid sequence with, or to, another amino acid sequence is determined by the use of the protein-protein Blast search (http://blastncbi.nlm.nih.gov) with default settings: score matrix: blosum62, non-redundant protein sequences database and the blast algorithm

(175) TABLE-US-00002 Settings Expect threshold 10 Max matches in a query range 0 Gap opening penalty 11 Gap extension penalty 1 Compositional adjustment: Conditional compositional score matrix adjustment Mask and filters No

Embodiment 12

(176) The polypeptide according to any one of embodiments 1-11, which polypeptide is inactivated by pasteurisation such as using less than 50, 45, 40, 35, 30, 25, 24, 23, 22, 21 or 20 pasteurisation units (PU) in beer.

Embodiment 13

(177) The polypeptide according to any one of embodiments 1-12, which polypeptide has a glucoamylase activity (GAU) of 0.05-10 GAU/mg, such as 0.1-5 GAU/mg, such as 0.5-4 GAU/mg, such as 0.7-3 GAU/mg, or such as 1-3 GAU/mg.

Embodiment 14

(178) The polypeptide according to any one of embodiments 1-13, wherein the polypeptide does not have a SBD.

Embodiment 15

(179) The polypeptide according to any one of embodiments 1-14 having at the most 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 495, 500, 505, 507, 515, 525, 535, 545, 555, 565 or 573 amino acid residues.

Embodiment 16

(180) The polypeptide according to any one of embodiments 1-15, wherein the polypeptide is truncated compared to SEQ ID NO:3.

Embodiment 17

(181) The polypeptide according to any one of the embodiments 1-16, which is obtained by recombinant expression in a host cell.

Embodiment 18

(182) A nucleic acid capable of encoding a polypeptide according to any one of embodiments 1-17.

Embodiment 19

(183) An expression vector comprising a nucleic acid according to embodiment 18, or capable of expressing a polypeptide according to any one of embodiments 1-17.

Embodiment 20

(184) The expression vector or plasmid as defined in embodiment 19 comprising a promoter derived from Trichoderma such as a T. reesei cbhI-derived promoter.

Embodiment 21

(185) The expression vector or plasmid as defined in embodiment 19 comprising a terminator derived from Trichoderma such as a T. reesei cbhI-derived terminator.

Embodiment 22

(186) The expression vector or plasmid according to embodiment 19 comprising one or more selective markers such as Aspergillus nidulans amdS and pyrG.

Embodiment 23

(187) The expression vector or plasmid according to embodiment 19 comprising one or more telomere regions allowing for a non-chromosomal plasmid maintenance in a host cell.

Embodiment 24

(188) A host cell having heterologous expression of a polypeptide as defined in any one of embodiments 1-17.

Embodiment 25

(189) The host cell as defined in any one of embodiments 17 and 24, wherein the host cell is a fungal cell.

Embodiment 26

(190) The host cell according to embodiment 25, wherein the fungal cell is of the genus Trichoderma.

Embodiment 27

(191) The host cell according to embodiment 26, wherein the fungal cell is of the species Trichoderma reesei.

Embodiment 28

(192) The host cell according to embodiment 26, wherein the fungal cell is of the species Hypocrea jecorina.

Embodiment 29

(193) A host cell comprising, preferably transformed with, a plasmid or an expression vector as defined in any one of embodiments 19-23.

Embodiment 30

(194) A method of isolating a polypeptide as defined in any one of embodiments 1-17, the method comprising the steps of inducing synthesis of the polypeptide in a host cell as defined in any one of embodiments 25-29 having heterologous expression of said polypeptide and recovering extracellular protein secreted by said host cell, and optionally purifying the polypeptide.

Embodiment 31

(195) A method for producing a polypeptide as defined in any one of embodiments 1-17, the method comprising the steps of inducing synthesis of the polypeptide in a host cell as defined in any one of embodiments 25-29 having heterologous expression of said polypeptide, and optionally purifying the polypeptide.

Embodiment 32

(196) A method of expressing a polypeptide as defined in any one of embodiments 1-17, the method comprising obtaining a host cell as defined in any one of embodiments 25-29 and expressing the polypeptide from said host cell, and optionally purifying the polypeptide.

Embodiment 33

(197) The method according to any one of embodiments 30-32, wherein the polypeptide as defined in any one of embodiments 1-17 is the dominant secreted protein.

Embodiment 34

(198) A composition comprising one or more polypeptide(s) as defined in any one of embodiments 1-17.

Embodiment 35

(199) The composition according to embodiment 34, wherein the composition is selected from among a starch hydrolyzing composition, a saccharifying composition, a detergent composition, an alcohol fermentation enzymatic composition, and an animal feed animal feed composition.

Embodiment 36

(200) The composition according to any one of embodiments 34-35, comprising one or more further enzyme(s).

Embodiment 37

(201) The composition according to embodiment 36, wherein the one or more further enzyme(s) is selected among alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof.

Embodiment 38

(202) The composition according to any one of embodiments 34-37, which polypeptide(s) and/or one or more further enzyme(s) is inactivated by pasteurisation.

Embodiment 39

(203) The composition according to embodiment 38, wherein the polypeptide and/or the one or more further enzyme(s) is inactivated by pasteurisation such as by using less than 50, 45, 40, 35, 30, 25, 24, 23, 22, 21 or 20 pasteurisation units (PU) in beer.

Embodiment 40

(204) Use of a polypeptide as defined in any one of embodiments 1-17 or a composition as defined in any one of embodiments 34-39 in a fermentation, wherein said polypeptide or composition is added before or during a fermentation step.

Embodiment 41

(205) The use according to embodiment 40, wherein said fermentation step, and optional beer filtration step, is followed by a pasteurisation step.

Embodiment 42

(206) The use according to any one of embodiments 40-41, wherein said fermentation is comprised in a process for making a fermented beverage.

Embodiment 43

(207) The use according to any one of embodiments 40-42, wherein said fermented beverage is selected from the group consisting of beer such as low alcohol beer or low calorie beer.

Embodiment 44

(208) The use according to any one of embodiments 40-43, wherein said polypeptide or said composition is added in combination with one or more further enzyme(s).

Embodiment 45

(209) The use according to embodiment 44, wherein said one or more further enzyme(s) is selected among alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof.

Embodiment 46

(210) The use according to any one of embodiments 40-45, wherein the polypeptide and/or the one or more further enzyme(s) is inactivated in the pasteurisation step.

Embodiment 47

(211) The use according to any one of embodiments 40-46, wherein the polypeptide is added in an amount of 1-1000 mg pr. kg grist, such as 20-500 mg pr. kg grist, such as 30-400 mg pr. kg grist such as 40-300 mg pr. kg grist, such as 50-200 mg pr. kg grist.

Embodiment 48

(212) Use of a thermolabile polypeptide to enhance the production of fermentable sugars in the fermentation step of a brewing process, wherein the polypeptide is as defined in any one of embodiments 1-17.

Embodiment 49

(213) A method which comprises adding a polypeptide as defined in any one of embodiments 1-17 or a composition as defined in any one of embodiments 34-39 before or during a fermentation step, such as a fermentation step with yeast.

Embodiment 50

(214) The method according to embodiment 49 comprising a pasteurisation step after the fermentation step or optional beer filtration step.

Embodiment 51

(215) The method according to any one of embodiments 49-50, wherein said fermentation is comprised in a process for making a fermented beverage.

Embodiment 52

(216) The method according to any one of embodiments 49-51, wherein said fermented beverage is selected from the group consisting of beer such as low alcohol beer, low calorie beer.

Embodiment 53

(217) The method according to any one of embodiments 49-51, wherein said polypeptide or said composition is added in combination with one or more further enzyme(s).

Embodiment 54

(218) The method according to embodiment 53, wherein said one or more further enzyme(s) is selected among alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof.

Embodiment 55

(219) The method according to any one of embodiments 49-54, wherein the polypeptide and/or the one or more further enzyme(s) is inactivated in the pasteurisation step.

Embodiment 56

(220) The method according to any one of embodiments 49-55, wherein the polypeptide is added in an amount of amount of 1-1000 mg pr. kg grist, such as 20-500 mg pr. kg grist, such as 30-400 mg pr. kg grist such as 40-300 mg pr. kg grist, such as 50-200 mg pr. kg grist.

Embodiment 57

(221) The method according to any one of embodiments 49-56 for production of a fermented beverage which comprises the following steps: a) preparing a mash, b) filtering the mash to obtain a wort, and c) fermenting the wort to obtain a fermented beverage,
wherein a polypeptide as defined in any one of embodiments 1-17 or a composition as defined in any one of embodiments 34-39 is added to: i. the mash of step (a) and/or ii. the wort of step (b) and/or iii. the wort of step (c).

Embodiment 58

(222) The method according to embodiment 57, wherein the fermented beverage is subjected to a pasteurisation step (d).

Embodiment 59

(223) The method according to any one of embodiments 57-58, wherein the mash in step (a) is obtained from a grist.

Embodiment 60

(224) The method according to embodiment 57, wherein the grist comprises one or more of malted and/or unmalted grain, or starch-based material from another crop.

Embodiment 61

(225) The method according to any one of embodiments 57-60, further comprising contacting the mash of step (a) with one or more further enzyme(s).

Embodiment 62

(226) The method according to embodiment 61, wherein the enzyme is selected among a starch debranching enzyme, R-enzyme, limit dextrinase, alpha-amylase, beta-amylase, peptidase (protease, proteinase, endopeptidase, exopeptidase), pullulanase, isoamylase, cellulase, endo-glucanase and related beta-glucan hydrolytic accessory enzymes, xylanase and xylanase accessory enzymes (for example, arabinofuranosidase, ferulic acid esterase, xylan acetyl esterase), acetolactate decarboxylase and glucoamylase, including any combination(s) thereof.

Embodiment 63

(227) The method according to any one of embodiments 57-62, further comprising contacting the wort of step (b) or (c) with one or more further enzyme(s), wherein the enzyme is selected among a starch debranching enzyme, isoamylase and limit dextrinase, including any combinations thereof.

Embodiment 64

(228) A fermented beverage wherein the fermented beverage is produced by a method as defined in any one of embodiments 49-63.

Embodiment 65

(229) The fermented beverage according to embodiment 64, which is beer such as low alcohol beer or low calorie beer.

Embodiment 66

(230) A method for the production of a food, feed, or beverage product, such as an alcoholic or non-alcoholic beverage, such as a cereal- or malt-based beverage like beer or whiskey, such as wine, cider, vinegar, rice wine, soya sauce, or juice, said method comprising the step of treating a starch and/or sugar containing plant material with a polypeptide according to embodiments 1-17, or a composition as defined in any one of embodiments 34-39.

Embodiment 67

(231) A kit comprising a polypeptide according to embodiments 1-17, or a composition as defined in any one of embodiments 34-39; and instructions for use of said polypeptide or composition.

(232) The following examples are provided and it should be understood that the various modifications can be made without departing from the spirit of the embodiments discussed.

5. EXPERIMENTAL

Example 1

(233) Analysis of Enzyme Activity in a Fermentation Broth of Monascus kaoliang and Comparision with Other Microorganisms

(234) CBS302.78 was fermented in 50 mL MD medium [Casamino acids (9 g/L), MgSO.sub.4.7H.sub.2O (1 g/L), (NH.sub.4).sub.2SO.sub.4 (5 g/L), KH.sub.2PO.sub.4 (4.5 g/L), CaCl.sub.2.2H.sub.2O (1 g/L), PIPSS (33 g/L), 2.5 ml/L T. reesei trace elements [Citric acid (175 g/L), FeSO.sub.4.7H.sub.2O (200 g/L), ZnSO.sub.4.7H.sub.2O (16 g/L), Cu SO.sub.4.5H.sub.2O (3.2 g/L), MnSO.sub.4.H.sub.2O (1.4 g/L), H.sub.3BO.sub.3 (0.8 g/L)], 500 ml 30% maltose, pH 5.5] for 7 days at 28 C. As depicted in FIG. 1, the fermentation broth of Monascus kaoliang, along with other wild type fungal strains as listed in Table 1, were analyzed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE). All SDS_PAGE gels were run with the Invitrogen NuPAGE Novex 10% Bis-Tris Gel 1.0 mm, 12 well (Cat# NP0302box), See-Blue prestained Standard (Cat# LC5625) and NuPAGE MES SDS Running Buffer (Cat# NP0002) according to the manufacturer's protocol.

(235) A Bradford assay was used for total protein quantification. The reagent solution was Bradford Quikstart work solution (BioRad cat#500-0205). 100 l of supernatant was placed in a fresh 96-well flat bottom plate. To each well 200 UI reagent was added and incubated for 5 minutes at room temperature. The absorbance was measured at 595 nm in a MTP-reader (Molecular Devices Spectramax 384 plus). Protein concentrations were calculated according to a Bovine Serum Albumin (BSA) (0-50 Ug/ml) standard curve.

(236) TABLE-US-00003 TABLE 1 Total. protein. Strain Organism (mg/ml) Units GA/L DMGA079 Embellisia 0.11 6.6 DMGA080 Geomyces 0.12 0.05 DMGA083 Thelebolus 0.09 1.4 DMGA084 Emericella desertorum 0.28 0.19 DMGA086 Chaetomium vitellium 0.43 0.3 DMGA088 Monascus kaoliang 0.13 6.8 DMGA089 Myceliophthora thermophila 0.32 0.08 DMGA091 Talaromyces emersonii 0.67 0.17 DMGA093 Chaetomium atrobruneum 0.04 0.04

(237) Surprisingly, the fermentation broth of Monascus kaoliang showed an intense protein band at the size in the same range as glucoamylase of other filamentous fungi (62 kDa). The 50 mL fermentation of Monascus kaoliang was repeated, and as depicted in FIG. 2, the PAGE gel showed abundant protein bands of 62 and 49 kDA.

(238) The two bands were isolated from the gel and analyzed by liquid chromatography-mass spectrometry (LC/MS). From the results it could be concluded that the 62 kDa band represented glucoamylase, and the 49 kDA band represented glucoamylase precursor protein.

(239) A sufficient enzyme sample was generated for small-scale application testing. Five 400 mL MD medium fermentations in 2 L shake flasks were carried out for 4 days at 28 C. The SDS-PAGE analysis of the fermentation broth is depicted in FIG. 3. The cultures were centrifuged for 30 min at 8.500 rpm in a Sorvall GS-3 Rotor, and the centrifugate was sterilized by filtration over a 0.22 m filter (Millipore). The filtrate was concentrated using a VivaSpin 200 ultra filtration device with a 10 kDa MW cut off.

(240) pNPG Glucoamylase Activity Assay:

(241) Reagent solutions: NaAc buffer (200 mM sodium acetate buffer pH 4.5); Substrate (50 mM p-nitrophenyl--D-glucopyranoside (Sigma N-1377) in NaAc buffer (0.3 g/20 ml)) and stop solution (800 mM glycine-NaOH buffer pH 10). 30 l filtered supernatant was placed in a fresh 96-well flat bottom MTP. To each well 50 l NaAc buffer and 120 l substrate was added and incubated for 30 minutes at 50 C. (Thermolab systems iEMS Incubator/shaker HT). The reaction was terminated by adding 100 l stop solution. The absorbance was measured at 405 nm in a MTP-reader (Molecular Devices Spectramax 384 plus) and the activity was calculated using a molar extinction coefficient of 0.011 M/cm.

(242) The GA activity was determined as shown in Table 2 below.

(243) TABLE-US-00004 TABLE 2 Total protein Spec. Strain Gene from: (mg/ml) U GA/L act. GAV213 Monascus kaoliang 1.66 145 87

(244) The fermentation broth of Monascus kaoliang was compared to that of Aspergillus niger by SDS-PAGE analysis. As can be seen in FIG. 4, the production of glucoamylase of wild type Monascus kaoliang is remarkably high, and the yield of the fermentation is in the same order as Aspergillus niger strain dgr246.

(245) Surprisingly, as depicted in FIG. 4, the fermentation broth of Aspergillus niger contains a secreted alpha amylase, whereas the fermentation broth of Monascus kaoliang shows only the glucoamylase. Thus, it appears that glucoamylase is the only dominant enzyme secreted by Monascus kaoliang.

Example 2

(246) Elucidation of the Monascus kaoliang Glucoamylase Genes

(247) To further characterize glucoamylase from Monascus kaoliang, Monascus kaoliang strain (CBS302.78) culture pre-grown overnight in MD-medium with 2% maltose was induced for 8 hours in fresh MD-medium with 15% maltose to initiate glucoamylase synthesis. Total RNA was isolated from M. kaoliang using the Qiagen RNeasy plant Mini kit (Cat#74904). The Invitrogen RNase AWAY (Cat#10328-011) was used to clear all materials and work surfaces of RNase.

(248) Total RNA was used in construction of a cDNA library using a Cloneminer Library Construction Kit (Invitrogen, cat#18249-029). Approximately 2920 colonies from the library were plated on 2TY-medium [Bacto Tryptone (16 g/L), Bacto Yeast Extract (10 g/L), NaCL (5 g/L), Agar (15 g/L)] supplemented with kanamycin (50 g/ml). Colonies were transferred onto a Hybond-N membrane (Cat# RPN2222N). Membranes were screened for the glucoamylase cDNA inserts by Southern hybridization using the labeling and detection system of Roche Applied Science, Indianapolis, Ind. 46250-0414 USA. A homologous probe that was used was isolated in a 2 step process. First an internal fragment of the Monascus kaoliang GA gene was isolated by PCR from the cDNA library template using degenerated primers designed from amino acid fragments resulted from the MS/LC: Deg.FW: 5-GAYTAYTTYTAYACNTGG-3 (SEQ ID NO:7) and Deg.RV: 5-YTGRTANACRTCDTCNGG-3 (SEQ ID NO:8). In the next step a homologous probe was isolated by PCR using the homologous primers derived from the fragments mentioned above: MkGA probe FW: 5-CTGGTCAATGGTGACGTGAATC-3 (SEQ ID NO:9) and MkGA probe RV: 5-GCAATACCCGAGTTGAGAGAGTAG-3 (SEQ ID NO:10). Twenty-three (23) out of the 2920 of these colonies gave a positive hybridization signal and were confirmed to contain glucoamylase cDNA fragments by sequence analysis. Results of the sequence analysis of these glucoamylase cDNA fragments demonstrated that there were two different variants of glucoamylase. A first, longer variant, referred to herein as glucoamylase II, codes for glucoamylase with a Starch Binding Domain (SBD), and a second, shorter variant, referred to herein as glucoamylase I, codes for a glucoamylase without a SBD (SEQ ID NO 2 and SEQ ID NO 5, respectively). The difference between the two variants is a gap of 162 base pairs at the end of the linker region that separates the catalytic core and the SBD (SEQ ID NO 3 and SEQ ID NO 6). This gap in the sequence results in a shift of the reading frame of +1 to +3, and as a consequence, a preliminary termination of translation appears to account for the two glucoamylase forms. Additionally, it was discovered that an extra mutation in glucoamylase II cDNA results in an amino acid substitution of Alanine for Proline at position 507 (A507P).

(249) To gain more information about the intron positions and the origin of the 2 cDNA species, a PCR was performed on genomic DNA using specific primers starting from the first start codon to the stop codon of the SBD: MkGA FW: 5-ATGATTGACACAAAACCGACTGATATCGTCTC-3 (SEQ ID NO:11) and MkGA RV: 5-CTACTTCCAGCTGTCGTTGACGGTCAC-3 (SEQ ID NO:12). The reaction was performed on a MJ Research PTC-200 Peltier thermal cycler using Platinum Taq DNA Polymerase High Fidelity from Invitrogen (Cat#11304-011) according protocols of the supplier. All PCR product were purified using the Qiagen QIAquick PCR purification kit (Cat#28106) according to manufactures protocol. The PCR showed two bands on a gel, the bands being approximately 2.1 kb and 2.3 kb in length (not shown). Sequence analysis showed that both genomic fragments code for the glucoamylase I and II forms (SEQ ID NO 4 and SEQ ID NO 1, respectively). Within the exon sequences, these fragments showed 100% identity to the corresponding cDNA clones described above. Sequence alignment allowed for the identification of 4 introns within the longer glucoamylase II gene. The shorter glucoamylase I gene lacks exactly the same 162 base pair stretch at the end of the linker, and bears the mutation at the position 507 as the shorter cDNA clone. Based on these results it can be concluded that the Monascus kaoliang genome contains two closely related glucoamylase genes coding for a protein with and without the SBD. It was also found that both genes within the overlapping region are virtually identical, save for a single nucleotide change.

Example 3

(250) Use of Monascus kaoliang Glucoamylase from Fermentation Broth in Conventional Ethanol Fermentation

(251) The use of M. kaoliang glucoamylase to saccharify liquefied starch and support ethanol fermentation was compared to a glucoamylase from Aspergillus niger.

(252) An ethanol fermentation assay was preformed as follows: Frozen liquefact (liquefied starch having 32% dry solids (DS) content) was thawed at 75 C., and then brought to room temperature, with a measured pH of 5.6. Ethanol yeast was provided by the Red Star Yeast Company. Liquefact was then dispensed in 150 gram quantities into 250 ml Erlenmeyer flasks. 500 l of a 20% yeast/water solution and 600 l of 10% urea/water solution (400 ppm) was added to each flask. Enzymes were dosed according to the experimental design in Table 3. As the activity of the MkGA was relatively low, a large volume was required to achieve the desired dose. Water was added to the flasks to keep the volumes constant. The flasks were incubated at 32 C. in a forced air shaker at 150 rpm.

(253) TABLE-US-00005 TABLE 3 glucoamy lase Flask Description L GA L water L total units (GAU) 1 and 2 AnGA 32.0 2101.0 2133.0 15.6 3 and 4 MkGA @ 0.325 1733.0 400.0 2131.0 15.6 5 and 6 MkGA @ 0.40 2133.0 0 2131.0 19.2 AnGA: Aspergillus niger glucoamylase (487 glucoamylase units/g) MkGA: Monascus kaoliang glucoamylase I and II preparation (9 glucoamylase units/g)

(254) Samples were taken from each flask at scheduled intervals for HPLC analysis and at the end of fermentation for starch analysis.

(255) For HPLC analysis, samples were first centrifuged, diluted 1:10 in 0.1 N H.sub.2SO.sub.4, heated to 75 C. for 15 minutes and filtered through a 0.45 micron filter. A 10 microliter sample was injected into an HPLC Phenomenex Rezex Organic Acid column coupled to a Refractive Index Detector, where the 23 minute HPLC run conditions were: 65 C. with 0.01 N H.sub.2SO.sub.4 as the mobile phase.

(256) For Insoluble Residual Starch (IRS) analysis, a 100 g aliquot of fermentation broth was placed in a 250 ml Erlenmeyer and while stirring with a stir bar, the sample was heated to boiling point, and boiled for 10 minutes, and then centrifuged (HOT). The supernatant was decanted, allowed to cool on ice for 10 minutes, and then warmed to room temperature. A 1.0 ml sample of the supernatant was then added to 14 ml of Distilled H.sub.2O in a 15 ml volumetric test tube, and the insoluble starch residue was allowed to settle overnight. The volume of sedimented starch was assessed visually.

(257) TABLE-US-00006 TABLE 4 Average HPLC Data % W/V % W/V % W/V % W/V % W/V % W/V % W/V % V/V Flask Description hrs DP > 3 DP-3 DP-2 DP-1 Lactic Glycerol Acetic Ethanol 1, 2 AnGA 17 7.68 0.10 4.08 2.98 0.12 1.22 0.04 7.91 24 6.19 0.15 1.48 2.89 0.12 1.35 0.05 10.21 40 1.21 0.16 0.26 2.07 0.08 1.45 0.08 13.70 48 0.78 0.13 0.35 1.05 0.06 1.48 0.09 14.41 3, 4 MGA @ 0.325 17 8.55 0.09 4.21 0.46 0.15 1.20 0.04 8.88 24 7.50 0.11 1.77 0.19 0.14 1.26 0.05 10.85 40 3.51 0.17 0.12 0.05 0.09 1.30 0.08 14.00 48 2.74 0.16 0.11 0.03 0.07 1.31 0.09 14.29 5, 6 MGA @ 0.40 17 8.18 0.08 3.16 1.09 0.13 1.23 0.05 9.48 24 6.68 0.15 0.58 0.25 0.12 1.29 0.07 11.99 40 2.48 0.15 0.12 0.04 0.06 1.32 0.09 14.46 48 2.07 0.14 0.11 0.03 0.05 1.31 0.09 14.36

(258) As seen in Table 1 and FIG. 5, a faster rate of ethanol fermentation was obtained using M. kaoliang glucoamylase (MkGA) than A. niger glucoamylase, when compared on the basis of an equal number of units of glucoamylase (GAU)/g dry solids (DS) of liquefied starch dose, indicating a better carbon conversion efficiency. Final yields of alcohol produced using the two glucoamylases were comparable, at approximately 14.3%.

(259) The amount of insoluble residual starch (IRS) remaining after ethanol fermentation of the liquefied starch in the presence of glucoamylase was greater for M. kaoliang glucoamylase (MkGA) than A. niger glucoamylase when compared on the basis of 0.325 GAU/g DS. However, a 25% increase in the MkGA dose (0.4 GAU/g DS) left similar levels of IRS as 0.325 GAU/g DS of AnGA (FIG. 6).

Example 4

(260) Use of Monascus kaoliang Glucoamylase from Fermentation Broth in the Fermentation Step of Brewing

(261) The use of M. kaoliang glucoamylase to saccharify wort carbohydrates and support ethanol fermentation was compared to DIAZYME X4 which comprises a glucoamylase from Aspergillus niger (AnGA). Fermentation trials were performed using hopped wort prepared from Munton's Bitter Home Brew Kit having an initial Specific Gravity of 1056.7 (i.e. 13.92 Plato). 200 ml of the wort were added to each 500 ml flask (Fermenting Vessel; FV), which was then autoclaved at 99 C. for 10 minutes and then cooled. The following additions were made to the flasks: Negative control flasks received 1 ml sterile water; Positive control flasks received 1 ml of a 100 fold dilution of DIAZYME X4 (concentrated glucoamylase derived from a strain of Aspergillus niger) supplied by Genencor International, equivalent to an addition rate of 5 g DIAZYME X4 per hl pitching wort; Test flasks received 1 ml of a 2.9 g.fwdarw.5 ml dilution of the Monascus kaoliang glucoamylase, equivalent to the same addition rate, in terms of units of glucoamylase activity added per hl pitching wort, as that used for DIAZYME X4 in the Positive control.

(262) Each flask was dosed with W34/70 (Weihenstephan) yeast at a dose rate of 10.106 per ml per Plato, the fermentation was allowed to proceed under standardised laboratory test conditions (an elevated temperature of 22.5 C., with gentle agitation of 100 rpm, in an orbital incubator for up to 165 hours). Each flask was analysed at scheduled intervals with respect to weight loss and specific gravity, while Real Degree of Fermentation (RDF, which is the Real Attenuation expressed in percentage form) was calculated for the final fermented wort (beer) and a sample was subjected to HPLC analysis of the carbohydrate composition and the products of fermentation, employing methods set out in Example 3. Specific gravity of the wort before, during and after fermentation was measured using a specific gravity hydrometer or Anton-Paar density meter (e.g. DMA 4100 M) and Real Attenuation was calculated and expressed in percentage form as RDF according to the formulae listed by Ensminger (see http://hbd.org/ensmingr/ Beer data: Alcohol, Calorie, and Attenuation Levels of Beer). Monitoring weight loss during fermentation provides an indirect measure of CO2 evolution and hence ethanol formation.

(263) TABLE-US-00007 TABLE 5 Fermentation trial: Addition of MkGA or DIAZYME X4 to the FV Real Final Final Enzyme(s) Dose rate Initial Solids RDF Final Extract glycerol ethanol added (g/hl) S.G. (% Plato) (%) S.G. (%) (% w/v) (% v/v) Control 1.057 13.923 63.280 1.012 5.112 0.243 5.452 (no enzyme) 1.057 13.923 63.132 1.013 5.133 0.247 5.326 1.057 13.923 63.429 1.012 5.092 0.239 5.349 1.057 13.923 63.280 1.012 5.112 0.242 5.380 mean 1.057 13.923 63.280 1.012 5.112 0.243 5.377 stdev 0.000 0.000 0.122 0.000 0.017 0.003 0.055 UL 1.057 13.923 63.474 1.013 5.139 0.248 5.464 LL 1.057 13.923 63.087 1.012 5.085 0.237 5.290 DIAZYME X4 5 1.057 13.923 79.948 1.001 2.792 0.256 6.612 (Lot # 1.057 13.923 80.403 1.001 2.728 0.267 6.742 1681046910) 1.057 13.923 79.797 1.001 2.813 0.283 6.783 409.9 GAU/g 1.057 13.923 79.645 1.002 2.834 0.272 6.806 mean 1.057 13.923 79.948 1.001 2.792 0.270 6.736 stdev 0.000 0.000 0.327 0.000 0.046 0.011 0.087 UL 1.057 13.923 80.469 1.002 2.864 0.287 6.874 LL 1.057 13.923 79.428 1.001 2.719 0.252 6.598 MkGA 5 1.057 13.923 77.376 1.003 3.150 0.278 6.250 409.9 GAU 1.057 13.923 77.679 1.003 3.108 0.260 6.207 equiv. 1.057 13.923 77.830 1.003 3.087 0.271 6.616 1.057 13.923 78.435 1.002 3.002 0.258 6.673 mean 1.057 13.923 77.830 1.003 3.087 0.267 6.437 stdev 0.000 0.000 0.445 0.000 0.062 0.009 0.242 UL 1.057 13.923 78.538 1.003 3.185 0.282 6.821 LL 1.057 13.923 77.122 1.002 2.988 0.251 6.052

(264) Analysis of the final beer, produced by fermentation in the presence of an equivalent number of units of glucoamylase from MkGA compared with DIAZYME X4, revealed that MkGA glucoamylase gave a slightly lower yield with respect to ethanol production, weight loss (CO.sub.2 production) and RDF (see Tables 5-7 and FIG. 7). Correspondingly the content of oligosaccharides having a polymerization of DP4 and above was elevated in the final beer produced with MkGA glucoamylase. These results clearly show that DIAZYME X4 can be substituted with MkGA glucoamylase to generate fermentable carbohydrates in the wort to support ethanol fermentation. An increased dosage of MkGA glucoamylase in the fermenting vessel is likely to support rates of ethanol production similar to or greater than that of DIAZYME X4, based on the enhanced ethanol production seen with higher MkGA dosage rates shown in Example 3.

(265) TABLE-US-00008 TABLE 6 HPLC carbohydrate analyses of the fermented worts DP1 DP1 Dose Fructose Glucose DP2 DP3 DP4+ Total Enzyme(s) rate (% (% (% (% (% (% added (g/hl) w/v) w/v) w/v) w/v) w/v) w/v) Control 0.055 0.044 0.191 0.360 2.783 3.432 (no enzyme) 0.066 0.042 0.189 0.366 2.830 3.493 0.070 0.045 0.169 0.360 2.750 3.394 0.065 0.041 0.173 0.347 2.761 3.387 Mean 0.064 0.043 0.180 0.358 2.781 3.426 Stdev 0.006 0.002 0.011 0.008 0.035 0.049 UL 0.074 0.046 0.198 0.371 2.837 3.504 LL 0.054 0.040 0.162 0.346 2.725 3.349 DIAZYME 5 0.048 0.033 0.200 0.289 0.637 1.208 X4 (Lot # 0.047 0.032 0.183 0.284 0.633 1.179 1681046910) 0.049 0.031 0.186 0.291 0.655 1.212 409.9 GAU/g 0.050 0.031 0.202 0.302 0.652 1.237 Mean 0.048 0.032 0.193 0.291 0.644 1.209 Stdev 0.001 0.001 0.010 0.008 0.011 0.024 UL 0.050 0.034 0.208 0.304 0.662 1.246 LL 0.047 0.030 0.177 0.279 0.627 1.171 MkGA 5 0.058 0.037 0.220 0.318 0.835 1.467 409.9 GAU 0.058 0.037 0.224 0.323 0.830 1.472 equiv. 0.059 0.037 0.217 0.338 0.885 1.535 0.057 0.035 0.159 0.287 0.808 1.346 Mean 0.058 0.036 0.205 0.316 0.840 1.455 Stdev 0.001 0.001 0.031 0.021 0.032 0.079 UL 0.059 0.038 0.254 0.350 0.891 1.581 LL 0.056 0.034 0.156 0.282 0.788 1.329

(266) TABLE-US-00009 TABLE 7A Weight loss data Flask weight (g) Flask Enzyme Empty Start 24 h 48 h 117 h 144 h 165 h 1 Control 178.06 389.1 383.7 380.9 380.4 380.3 380.37 2 (no enzyme) 171.82 383.1 376.7 374.8 374.4 374.3 374.38 3 171.88 385.2 377 376.6 376.2 376.2 376.27 4 172.92 384.5 378 376.2 375.8 375.7 375.74 5 DIAZYME X4 171.3 383.4 376.2 373.8 372.6 372.3 372.32 6 (Lot # 179.29 391.4 383.3 381.6 380.4 380.2 380.22 7 1681046910) 160.74 372.4 365.4 362.9 361.7 361.5 361.45 8 409.9 GAU/g 178.86 390.2 383.9 380.8 379.6 379.3 379.26 9 MkGA 162.03 374 368.5 364.6 363.5 363.3 363.26 10 409.9 GAU 173.02 384.5 378.5 375.1 374 373.8 373.76 11 equiv. 177.48 388.8 382.5 379.4 378.3 378.1 378.05 12 175.28 387.7 379.5 377.9 377 376.7 376.74

(267) TABLE-US-00010 TABLE 7B Weight loss data (% of the start weight) Dose rate Weight loss (%) at: Enzyme(s) added (g/hl) 0 24 48 117 144 165 Control 0.00% 2.56% 3.89% 4.12% 4.17% 4.14% (no enzyme) 0.00% 3.03% 3.93% 4.12% 4.17% 4.13% 0.00% 3.84% 4.03% 4.22% 4.22% 4.19% 0.00% 3.07% 3.92% 4.11% 4.16% 4.14% Mean 0.00% 3.13% 3.94% 4.14% 4.18% 4.15% Stdev 0.00000 0.00532 0.00063 0.00051 0.00028 0.00026 UL 0.00% 3.97% 4.04% 4.22% 4.22% 4.19% LL 0.00% 2.28% 3.84% 4.06% 4.13% 4.11% DIAZYME X4 5 0.00% 3.39% 4.53% 5.09% 5.23% 5.22% (Lot # 0.00% 3.82% 4.62% 5.19% 5.28% 5.27% 1681046910) 0.00% 3.31% 4.49% 5.06% 5.15% 5.17% 409.9 GAU/g 0.00% 2.98% 4.45% 5.02% 5.16% 5.18% Mean 0.00% 3.38% 4.52% 5.09% 5.21% 5.21% Stdev 0.00000 0.00345 0.00074 0.00073 0.00063 0.00046 UL 0.00% 3.92% 4.64% 5.20% 5.30% 5.28% LL 0.00% 2.83% 4.40% 4.97% 5.11% 5.14% MkGA 5 0.00% 2.59% 4.43% 4.95% 5.05% 5.07% 409.9 GAU 0.00% 2.84% 4.44% 4.97% 5.06% 5.08% equiv. 0.00% 2.98% 4.45% 4.97% 5.06% 5.09% 0.00% 3.86% 4.61% 5.04% 5.18% 5.16% Mean 0.00% 3.07% 4.49% 4.98% 5.09% 5.10% Stdev 0.00000 0.00552 0.00086 0.00038 0.00061 0.00042 UL 0.00% 3.95% 4.62% 5.04% 5.18% 5.16% LL 0.00% 2.19% 4.35% 4.92% 4.99% 5.03%

Example 5

(268) Purification of MkGA I and MkGA II and their Use in the Fermentation Step of Brewing Purification

(269) Monascus kaoliang CBS302.78 was grown on PDA agar plates. To initiate the pre-culture fermentation use a piece (1 cm.sup.2) of a fresh PDA plate with M. kaoliang CBS302.78 to inoculate 50 ml LD-maltose medium in a 250 ml sterile baffled shake flask. The culture was grown for 2 days at 28 C. and harvested. 50 mL of this culture was transferred to 1000 ml LD-maltose medium in a 2.8 L baffled Fernbac and incubated 4 days at 28 C. with pH fixed at 5.0 or 5.5. The cell culture is harvested and media clarified by centrifugation (4000 rpm at 15 min.) and filtration (VacuCap 90, 0.2 m). Following, the ferment was concentrated and stored at 20 C.

(270) MkGA I and MkGA II were purified as follows: Clarified fermentation broth was treated with active charcoal to remove the excess of Monascus kaoliang secreted pigments such as: Monascin, ankaflavin and monascorubrin. Thus, ferment broth was added 2% (w/v) Norit SA Plus and left with stirring at RT for 20 min. This slurry was centrifuged at 4000 rpm for 20 min. and filtered (0.2 m) before diluting it 1:4 with Buffer A (25 mM Na-Acetat pH 4.3) used for the first column. Chromatography was carried out manually on a BioRAD FPLC system. A 15 ml -cyclodextrin column was made by immobilizing -cyclodextrin (Sigma-Aldrich; CAS nr:68168-23-0) on Epoxy-activated Sepharose 6B (GE Healthcare; Lot: 10021987). This (3-CD-column was equilibrated with Buffer A at a flow rate of 2 ml/min. This flow rate was maintained throughout the purification. The sample containing 500 M-GAU was loaded onto the column through the inlet tubing and fractions of 10 ml were collected throughout purification. MkGA I could be collected in the flowthrough and the buffer was switched to 100% Buffer B (10 mM -cyclodextrin in 25 mM Na-acetat pH 4.3) after stabilisation of the baseline by extensive washing with Buffer A. Bound MkGA II was eluted from the column and the buffer was finally switched back to A after all protein was eluted. Protein in the flowthrough and elution was analyzed for glucoamylase activity and by SDS-page.

(271) All SDS-page gels were run with the Invitrogen NuPage Novex 10% Bis-Tris gel 1.0 mm, 10 well (Cat#NP0321box), See-Blue Plus2 prestained Standard (Cat# LC5925) and NuPAGE MES SDS Running Buffer (Cat# NP0002) according to the manufacturer's protocol. Stained with Coomasie Brilliant-Blue.

(272) MkGA I- and MkGA II-containing fractions were pooled separately and -cyclodextrin was removed by passing the sample through a PD10 columns. GA containing fractions were concentrated in Vivaspin ultrafiltration centrifuge tubes to approximately 20 mg/ml (25 ml, 10K MWCO, Sartorius).

(273) The flowthrough from -cyclodextrin column with MkGA I contained small amounts of MkGA II (<10%) and was purified further. The sample of MkGA I was changed to Buffer C (20 mM Citrate buffer pH3.5) by extensive dialysis. 4 ml sample (corresponding to 100 GAU) was loaded onto a 1 ml SPFF HiTrap column equipped on an Akta Pharmacia FPLC system (GE Healthcare) pre-equilibrated with Buffer C and running with a flow of 1 ml/min. The bound proteins were separated with a 20 CV gradient into 50% Buffer D (20 mM Citrate buffer pH3.5, 1 M NaCl). Peak fractions were collected and analyzed for glucoamylase activity and by SDS-page. Completely pure MkGA I and MkGA II were obtained in this way.

(274) The amino acid sequence of the purified MkGA I and MkGA II was obtained by MS analysis (SEQ ID NO. 6 and SEQ ID NO. 3) and agreed with the translated cDNA sequences.

(275) Glucoamylase activity was assayed by a Megazyme R-AMGR3 assay (M-GAU) according to manufactures description (see example 6). Dilution and mixing were performed in 96 well ELISA plates on a Biomek 3000 (Beckman Coulter).

(276) Brew Analysis:

(277) MkGA I, MkGA II, AnGA (DIAZYME X4) and TrGA were all tested in brewing experiments. In this setup a wort was made using Munton's malt extract. 340 g Munton's malt extract was dissolved in 1500 ml hot water. This slurry was added 5 pellets of hops, pH adjusted to 5.2 by H.sub.2SO.sub.4 and boiled for 1 hour before being autoclaved at 121 C. for 15 minutes. Afterwards, 0.6 g freshly produced W34/70 (Weihenstephan) yeast was added 100 g cooled wort together with the different enzymes. The enzymes were dosed on similar amount of protein (0.066 mg GA/mL wort) or similar -D-maltoside activity (0.16 M-GAU/mL wort).

(278) The worts were fermented at 18 C. and gentle agitation of 150 rpm, in 500 ml conical flasks. Residual activity was measured before and after fermentation. Production of ethanol was indirectly measured by weight loss of ferments. Alcohol was measured on an Anton-Paar density meter (e.g. DMA 4100 M) and Real Attenuation was calculated and expressed in percentage form as RDF according to the formulae listed by Ensminger (see http://hbd.org/ensmingr/ Beer data: Alcohol, Calorie, and Attenuation Levels of Beer).

(279) Carbohydrate Analysis of Fermented Wort:

(280) Samples withdrawn from fermentation were analysed on a Gilson HPLC system with Gilson 234 autosampler. HPLC parameters were as follows: Mobile phase: Milli-Q water, Flow: Isochratic, 1 ml/min, Column: Phenomenex RSOOligosaccharide, Column temperature: 75 C., Injection volume: 20 L, Detector: Refractive index (Laserchrom Schambeck RI detector), Integration: Manual, Sample preparation: 2 times dilution in Milli-Q water (2.5 ml sample+2.5 ml water) and filtration through 0.45 m syringe filters, Quantification: Peak areas in percent of peak area of the standard. The following specimens were quantified: Ethanol, glycerol, glucose, DP2, DP3, DP4, DP4+(all above and including DP4) and DP1-4+.

(281) As seen in table 8 the effect of MkGA I was superior to MkGA II in both dosage experiments and showed comparable within the experimental error to the effect obtained using either AnGA or TrGA.

(282) TABLE-US-00011 TABLE 8 Brew analysis - Brew analysis - dosed on protein dosed on activity 0.066 mg GA/mL wort 0.16 M-GAU/mL wort RDF (%) Std RDF (%) Std MkGA I M. kaoliang 77.81 0.130 77.73 0.255 MkGA II M. kaoliang 77.03 0.141 77.28 0.156 AnGA (DIAZYME A. niger 77.42 0.203 78.19 0.184 X4) TrGA T. reesei 77.71 0.205 77.85 0.141 RDF values determined for listed GA's applied to the FV at the indicated doses, using a malt extract wort. Results are an average of 3 determinations.

(283) In accordance with the obtained RDF-values, MkGA I, MkGA II and DIAZYME showed a very similar turnover of oligosaccharides in the wort during the fermentation period (96 h) (FIG. 8). The only notable difference is that DIAZYME X4 shows slightly faster initial consumption of DP3 and DP4+ oligosaccharides compared to MkGA I and MkGA II. This however does not affect the end result of residual oligosaccharide composition and the obtained RDF values.

Example 6

(284) Thermostability of MkGA I and MkGA II in Buffer and Beer

(285) Glucoamylase activity of MkGA I, MkGA II, DIAZYME X4 (AnGA) and TrGA was determined in beer pH(4.3-4.6) and in Na-Acetate pH(4.7) buffer using a lab-scale pasteurisation assay (ranging from 0 to 42 PU).

(286) Determination of M-GAU Activity:

(287) The assay is a ELISA scaled version of the Megazyme R-AMGR3 assay.

(288) Substrate: p-Nitrophenyl--maltoside (4 mM), plus thermostable -glucosidase (5 U/ml): Dissolve the contents of one vial in 10 mL of milli-q water, divide into aliquots of 1 mL and store frozen.

(289) Buffer: 200 mM Sodium acetate buffer (pH 4.5). Add 5.9 mL of glacial acetic acid (1.05 g/mL) to 900 mL of milli-q water. Adjust the pH to pH 4.4 by addition of 1 M (4 g/100 mL) NaOH solution (approx. 30 mL is required). Adjust the volume to 1 L and store in a well sealed bottle at 4 C.

(290) Dilute enzyme samples by a factor 10 in sodium acetate buffer (dilute further with the same buffer if necessary but remember that the first dilution is always needed in order to bring the pH to 4.5). In a 96 well plate: Mix 20 L substrate with 20 L enzyme solution and incubate at 40 C. with agitation for 10 minutes. Add 300 L 2% Trizma base to terminate reaction and develop the color.

(291) Measure absorbance at 400 nm against a reagent blank. Blanks are prepared by adding 300 L of Trizma base solution (2%) to 20 L of substrate with vigorous stirring, followed by the enzyme solution (20 L). Activity is calculated as follows:

(292) Activity ( GAU / ml ) = A 400 10 .Math. 340 20 .Math. 1 18.1 .Math. 1 1 , 88 .Math. Dilution

(293) Where: GAU=units of glucoamylase activity. One Unit is the amount of GA which release one mole of p-nitrophenol from the substrate per minute at the defined pH and temperature. A400=absorbance (reaction)Absorbance (blank). 10=incubation time (min). 340=final reaction volume (L). 20=volume of enzyme assayed (L) 18.1=E mM p-nitrophenol in 2% trizma base (pH8.5) at 400 nm (unit: M-1*cm-1). 0.88=Light path (cm)

(294) Pasteurisation Assay:

(295) The relative loss of glucoamylase activity was determined in degassed beer or acetate buffer in a lab-scale pasteurisation assay. The sample was diluted 1:10 in beer or buffer and transferred to thin glass cuvette and placed in water bath at 72 C. where time and temperature were measured. Samples were withdrawn over time (0 to 100 sec) and hold on ice before determining the residual activity. Dilution and mixing were performed in 96 well ELISA plates on a Biomek 3000 (Beckman Coulter). To measure enzyme thermostability under the conditions used in the present experiments, the GAU activity was determined before and after incubation of enzymes. Beer or buffer without glucoamylase was used as blank. The accumulated energy input was converted into pasteurisation units PU, an energy equivalent index, by the equation stated above. Data is presented as relative activity lost.

(296) Thermostability was determined in regular degassed Pilsner (Royal Export Pilsner) pH (4.5) for MkGA I, MkGA II, MkGA I+MkGA II, DIAZYME X4 (AnGA) and TrGA. From the results in table 9, it is seen that MkGA I is significantly more thermolabile compared to the other tested glucoamylases in the Pilsner beer. MkGA I is completely inactivated with less than 26 pasteurisation units (PU) using a pasteurisation temperature of 72 C. In comparison MkGA II requires 100 PU and AnGA and TrGA need more than 200 PU to be inactivated. Notably, MkGA I is truncated and lacks the SBD compared to MkGA II, AnGA and TrGA that all have same domain structure with a catalytic domain and a SBD.

(297) TABLE-US-00012 TABLE 9 Table 9. Residual glucoamylase activity after increasing pasteurisation at 72 C. in beer of MkGA I, MkGA II, MkGA I + MkGA II (MkGA), AnGA ((DIAZYME X4) and TrGA. Residual activity is calculated as the actual activity divided with the initial activity (0 PU) and results are an average of 3 determinations. Residual glucoamylase activity in beer after pasteurisation at 72 C. AnGA Pasteurisation MkGA I MkGA II MkGA I + MkGA II (DIAZYMEX4) TrGA Units Sample M. kaoliang M. kaoliang M. kaoliang A. niger T. reesei [PU] ID (purified) (purified) (ferment) (product) (ferment) 0.000 1 1.000 1.000 1.000 1.000 1.000 0.020 2 0.840 0.895 0.910 0.974 0.956 0.180 3 0.122 0.700 0.375 0.857 0.945 2.190 4 0.036 0.547 0.144 0.774 0.898 6.770 5 0.021 0.230 0.074 0.561 0.612 13.16 6 0.004 0.110 0.020 0.474 0.471 26.81 7 0.000 0.031 0.002 0.349 0.271 48.69 8 0.000 0.015 0.002 0.225 0.202 75.20 9 0.000 0.002 0.000 0.164 0.153 102.2 10 0.000 0.000 0.000 0.125 0.114

(298) In addition, pasteurisations at 72 C. were performed in beers with widely different Specific Gravity (i.e. Plato): Budweiser Pilsner pH (4.5), Newcastle Brown Ale pH(4.3), Thisted bryghus Porter pH(4.6) and 0.1M Na-Acetate pH (4.7) used in previous studies of MkGA I and MkGA II thermostability (1). It is clear from the results shown in FIG. 9 that MkGA I and MkGA II are more thermolabile in beer compared to Na-Acetate buffer, whereas the thermostability of DIAZYME X4 (AnGA) does not change significantly between buffer and beer. Surprisingly, the residual activity of MkGA I that has lowest themostability decreases faster in beer and the glucoamylase may get completely inactive in all beers with less than 25 PU compared to buffer, which hold small but significant (2%) residual activity after pasteurisation with 42 PU. Thisted bryghus porter is the beer in which MkGA I and MkGA II show the lowest thermostability.

Example 7

(299) To express both forms of M. kaoliang glucoamylase, MkGA I and MkGA II, in the heterologous host Hypocrea jecorina (anamorph Trichoderma reesei), both genomic and cDNA sequences of the two corresponding genes were amplified by PCR from either the M. kaoliang genomic DNA or a pooled cDNA library prepared as described in previous examples with the upstream and downstream primers as indicated below (SEQ ID NOs: 13-15)

(300) TABLE-US-00013 forward- (SEQIDNO:13) 5 GGGACAAGTTTGTACAAAAAAGCAGGCTCACCATGGTGAAGA TCAGCATAAATCCCATC3, reverseI(forMkGAII)- (SEQIDNO:14) 5ACCACTTTGTACAAGAAAGCTGGGTCTACTTCCAGCTGTCGTT GACGGTC3 and reverseII(forMkGAI)- (SEQIDNO:15) 5ACCACTTTGTACAAGAAAGCTGGGTTCACCGTCCCGTGCCATA GGGGCGTG3.

(301) In addition, one extra fragment encoding MkGA I glucoamylase but starting from another ATG codon found in frame upstream of the putative start of translation (SEQ ID NO:17) was amplified using an upstream primer:

(302) TABLE-US-00014 (SEQIDNO:16) 5GGGACAAGTTTGTACAAAAAAGCAGGCTATGATTGACACAAAA CCGACTGATATCGTCTC3

(303) All primers included the specific recombination attB1 and attB2 sites compatible with a Gateway cloning technology (Invitrogen, Carlsbad, Calif., USA), to facilitate cloning of the amplified fragments in either pDONR 221 or pDONR/Zeo vector followed by a second recombination reaction with the pTTTpyrG13 destination vector (FIG. 10). This vector allowed for expression of the MkGA I and MkGA II genes in H. jecorina cells and was described in WO2010141779A1. It contains the T. reesei cbhI-derived promoter and terminator regions driving a strong inducible expression of a gene of interest, the Aspergillus nidulans amdS and pyrG selective marker conferring growth of transformants on acetamide as a sole nitrogen source in the absence of uridine, and the T. reesei telomere regions allowing for a non-chromosomal plasmid maintenance in a fungal cell. The cbhI promoter and terminator regions are separated by the chloramphenicol resistance gene, Cm.sup.R, and the ccdB gene lethal to E. coli, flanked by the bacteriophage lambda specific recombination sites attR1, attR2. Such configuration allows for direct selection of recombinants containing the M. kaoliang GA sequences under the control of the cbhI regulatory elements in the right orientation via the Gateway LR recombination reaction. The final expression plasmids are shown in FIG. 11 and the identity of the specific genomic and cDNA sequences cloned was confirmed by a sequence analysis. All cloning steps were performed according to recommendations of the supplier (Invitrogen, Carlsbad, Calif., USA).

(304) Isolated plasmids were transformed in the H. jecorina Quad strain deleted for four major cellulases (cbh1, cbh2, egl1, egl2, pyr4-) using a PEG-protoplast method as described elsewhere (US20110020899). Transformants selected for growth on minimal medium with acetamide as a nitrogen source were harvested and a spore mixture was used to inoculate Glycine production medium (4.7 g/L (NH.sub.4).sub.2SO.sub.4, 33 g/L 1,4-Piperazinebis(propanesulfonic acid), pH 5.5, 6.0 g/L glycine, 5.0 g/L KH.sub.2PO.sub.4, 1.0 g/L CaCl.sub.22H.sub.2O, 1.0 g/L MgSO.sub.47H.sub.2O, 2.5 ml/L of 400 T. reesei trace elements {5 g/L FeSO.sub.47H.sub.2O, 1.4 g/L ZnSO.sub.47H.sub.2O, 1.6 g/L MnSO.sub.4H.sub.2O, 3.7 g/L CoCl.sub.26H.sub.2O}, 20 g/L Glucose, 0.6 g/L Sophorose). After growth for 5 days at 28 C in shake flasks on a rotary shake at 200 rpm, cultures samples were harvested and analysed for production of M. kaoliang glucoamylases by both SDS-PAGE and activity assay using para-nitrophenyl--D-glucopyranoside as a substrate. SDS-PAGE analysis and glucoamylase activity assay were performed as described in example 1.

(305) As seen in FIG. 12 and below table 10, both forms of MkGA I and II were successfully expressed in their active form in the heterologous host H. jecorina. For both genes, only genomic sequences resulted in detectable expression of the corresponding glucoamylase molecules. More pronounced expression was observed when the downstream ATG codon was used as a start of translation indicating that it might be the true start of the signal peptide.

(306) TABLE-US-00015 TABLE 10 Activity of heterologously expressed M. kaoliang glucoamylases. Fermentation samples were diluted equally and activity was measured against para-nitrophenyl--D-glucopyranoside Sample Activity, O.D. 405 nm Mk GAII genomic 0.68 Mk GAII cDNA 0.1 Mk GAI genomic 0.7 Mk GAI cDNA 0.084 Mk GAI genomic + ATG 0.42 Recipient 0.08

(307) The T. reesei expressed MkGA-I/-II were analysed by MS. A partial sequence analysis (covering 70% of the full sequence) was performed on the mature proteins from both M. kaoliang and T. reesei (purified from SDS-page, see FIG. 13) and showed the respective variants to be 100% identical (not shown). Thermostability of MkGA-I/-II from T. reesei (the crude ferment) were examined and were very similar to the purified wild-type enzymes from M. kaoliang (Table 11). Notably, it was possible to inactivate gMkGA I produced in T. reesei with less than 42 PU.

(308) TABLE-US-00016 TABLE 11 Residual glucoamylase activity as a function of the applied pasteurisation units at 72 C. in beer of MkGA I and MkGA II from M. kaoliang and T. reesei. Residual activity is meassured on a -D-maltoside substrate and calculated as the actual activity divided with the initial activity (0 PU) and results are an average of 3 determinations. Residual glucoamylase activity after pasteurisation at 72 C. MkGA I MkGA II gMkGA I gMkGA II Pasteurisation M. Kaoliang M. Kaoliang T. Reesei T. Reesei Units [PU] Sample ID (purified) (purified) (ferment) (ferment) 0.000 1 1.000 1.000 1.000 1.000 0.001 2 0.830 0.954 0.810 0.990 0.005 3 0.470 0.892 0.530 0.920 0.167 4 0.063 0.849 0.155 0.840 1.557 5 0.040 0.407 0.042 0.610 3.990 6 0.024 0.225 0.031 0.330 16.70 7 0.001 0.101 0.020 0.150 42.60 8 0.000 0.058 0.000 0.070 66.58 9 0.000 0.010 0.000 0.040 99.98 10 0.000 0.000 0.000 0.010 239.6 11 0.000 0.000 0.000 0.000 563.7 12 0.000 0.000 0.000 0.000

(309) MkGA I and MkGA II expressed in both H. jecorina and M. kaoliang were tested in brewing experiments. A wort was made using Munton's malt extract. 340 g Munton's malt extract was dissolved in 1500 ml hot water. This slurry was added 5 pellets of hops, pH adjusted to 5.2 by H2SO4. and boiled for 1 hour before being autoclaved at 121 C. for 15 minutes. Afterwards, 0.6 g freshly produced Weihenstephan yeast was added 100 g cooled wort together with the different enzymes (as described in example 5).

(310) The worts (normally 100 ml) were fermented at 18 C. and 150 rpm in 500 ml conical flasks. Residual activity was measured before and after fermentation. Production of ethanol was indirectly measured by weight loss of ferments. Alcohol was measured on an Anton Paar Alcoanalyzer and calculation of RDF was done on basis of specific gravity of the beer and alcohol concentration from the Alcoanalyzer.

(311) The performance in the beer FV application of gMkGA I and gMkGA II from T. reesei showed to be high but decreased (in terms of RDF-values) compared to the purified proteins from M. kaoliang (see FIG. 14). The enzymes were dosed on activity (GAU/mL) and the decreased performance may be due to side-activities in the crude ferment from T. reesei rather an actual performance difference in the FV as they have similar amino acid sequences.

(312) TABLE-US-00017 gDNAMkGAII (SEQIDNO:1) 1 atggtgaagatcagcataaatcccatcttgaaacggacattccctctatc 51 agtgctgctggcgccgctcctcgcagcctgtcttggggcttcaaacctag 101 ctcagatcgctgttgccgctgcaacatcggcggagtcaagtgctgcgtct 151 gattccttagattcatggctggccagagagactccatatgcccttgatgg 201 aattttaaataacatcggcccagacggcgcgaaggctgtgggtgcagtct 251 ctggcgtggtggttgcgagtccgagcaagagtaatccggattgtgagtat 301 tctcgtatttccagcccccaacgtcaagtgcatctatagcaaagaaagaa 351 aaagctcatgctaatggatgtatctgtatatatttctacacttggactcg 401 tgacgctgctctgactgttaaatgtctgaccgacctcttcctggtcaatg 451 gtgacgtgaatctgcagtcgcagatccagaactacatcagccgccaggca 501 tatttgcagaccgtatccaatccatctggtgacctgtcgactgggggact 551 tggtgagcccaaattcgaggttgatggcgctgcatttaccggttcctggg 601 gccgtcctcaacgagatgggcctgcgttgagggctacggctctgattgct 651 tatgccaattggctcattgtaggtgtttgcatgttggattttcttttctt 701 tctaatataatcttctcttgttgttacttgctaacttccatctacagagc 751 aatggacagacctcgacggcggagtccattgtttggccagttgtccagaa 801 tgacctttcatatgtgatgcagtattggaattcatctacctttggtttgt 851 cgaggcctctaaaatgggacaagcattctcagctaacgtatggaaacttc 901 atgcagacctctgggaggaagtctacggctcatcgttttttaccacggcc 951 gtgcagcatcgtgccctagtcgaaggtgcggctttcgccaaaaagcttgg 1001 ccactcttgtcccgactgtctctcccaggcatcgcagatcctctgctttt 1051 tgcagtcgtactggaccggtgcttacgtgctctctaactttggtggtggc 1101 cgctcagggaaggacgccaactcgatcctcggagttctgcatactttcga 1151 ccccgatgcagactgcgatgataccactttccagccttgttctgcccggg 1201 cgcttgcgaaccataaagtagttacggactctttccggtccatctactct 1251 ctcaactcgggtattgcccagggtcaagccgtggctgtgggacggtatcc 1301 cgaggacgtctaccagggaggcaatccatggtatctctgtactttggctg 1351 cggcggagcagctctacgacgcgctgtatcaatgggatcgaatcgggtcc 1401 ttgtctataacggacgtcagtctgggattcttccaggacctgtacccgtc 1451 cgctgcagtaggtgactatgcgtcttccacggagacatacagagatatca 1501 tggcagctgtgaaggcctatgcgaatggatatatggatattgctgtaagg 1551 agagctcctttccatcttttccttgtcccatgctgaaatagtgctacaga 1601 gaaagtacacacctgccaacggcgctctagcagagcagttttctagagac 1651 gatggttccccagtctcagcggtcgatctgacctggtcgtatgcctctct 1701 tctcacggcagcagccagacgaggctcccagatgccgccatcgtggaacg 1751 aatcttcttccaacaagcctccatcgacttgctcagcatcctctgcgacg 1801 ggggcctatgcctcggctaccaacaccgtctggcccacagcgtcgtgtgc 1851 ggcgacgccgacagccgtgcctgtgcgtttcaacgaactggtcacgactt 1901 cagtcggggataaggtagccctcgtggggtccacccctgctctggggtca 1951 tggaatgtctctgcggccgtcgcactgagtgcagacgaatacagcagcgt 2001 cacgcccctatggcacgggacggtgagtctcccgaccaaaacgagcttcg 2051 agtataagtatgtggtgcagaaggagtctggggaagtggactgggagggc 2101 ggagagaatcggtcgtacacagtgccagagggatgcgagggctcttcagt 2151 gaccgtcaacgacagctggaagtag cDNASequenceofMkGAII (SEQIDNO:2) 1 atggtgaagatcagcataaatcccatcttgaaacggacattccctctatc 51 agtgctgctggcgccgctcctcgcagcctgtcttggggcttcaaacctag 101 ctcagatcgctgttgccgctgcaacatcggcggagtcaagtgctgcgtct 151 gattccttagattcatggctggccagagagactccatatgcccttgatgg 201 aattttaaataacatcggcccagacggcgcgaaggctgtgggtgcagtct 251 ctggcgtggtggttgcgagtccgagcaagagtaatccggattatttctac 301 acttggactcgtgacgctgctctgactgttaaatgtctgaccgacctctt 351 cctggtcaatggtgacgtgaatctgcagtcgcagatccagaactacatca 401 gccgccaggcatatttgcagaccgtatccaatccatctggtgacctgtcg 451 actgggggacttggtgagcccaaattcgaggttgatggcgctgcatttac 501 cggttcctggggccgtcctcaacgagatgggcctgcgttgagggctacgg 551 ctctgattgcttatgccaattggctcattagcaatggacagacctcgacg 601 gcggagtccattgtttggccagttgtccagaatgacctttcatatgtgat 651 gcagtattggaattcatctacctttgacctctgggaggaagtctacggct 701 catcgttttttaccacggccgtgcagcatcgtgccctagtcgaaggtgcg 751 gctttcgccaaaaagcttggccactcttgtcccgactgtctctcccaggc 801 atcgcagatcctctgctttttgcagtcgtactggaccggtgcttacgtgc 851 tctctaactttggtggtggccgctcagggaaggacgccaactcgatcctc 901 ggagttctgcatactttcgaccccgatgcagactgcgatgataccacttt 951 ccagccttgttctgcccgggcgcttgcgaaccataaagtagttacggact 1001 ctttccggtccatctactctctcaactcgggtattgcccagggtcaagcc 1051 gtggctgtgggacggtatcccgaggacgtctaccagggaggcaatccatg 1101 gtatctctgtactttggctgcggcggagcagctctacgacgcgctgtatc 1151 aatgggatcgaatcgggtccttgtctataacggacgtcagtctgggattc 1201 ttccaggacctgtacccgtccgctgcagtaggtgactatgcgtcttccac 1251 ggagacatacagagatatcatggcagctgtgaaggcctatgcgaatggat 1301 atatggatattgctagaaagtacacacctgccaacggcgctctagcagag 1351 cagttttctagagacgatggttccccagtctcagcggtcgatctgacctg 1401 gtcgtatgcctctcttctcacggcagcagccagacgaggctcccagatgc 1451 cgccatcgtggaacgaatcttcttccaacaagcctccatcgacttgctca 1501 gcatcctctgcgacgggggcctatgcctcggctaccaacaccgtctggcc 1551 cacagcgtcgtgtgcggcgacgccgacagccgtgcctgtgcgtttcaacg 1601 aactggtcacgacttcagtcggggataaggtagccctcgtggggtccacc 1651 cctgctctggggtcatggaatgtctttgcggccgtcgcactgagtgcaga 1701 cgaatacagcagcgtcacgcccctatggcacgggacggtgagtctcccga 1751 ccaaaacgagcttcgagtataagtatgtggtgcagaaggagtctggggaa 1801 gtggactgggagggcggagagaatcggtcgtacacagtgccagagggatg 1851 cgagggcttttcagtgaccgtcaacgacagctggaagtag AminoAcidSequenceofMkGAII(thematureprotein) (SEQIDNO:3) 1 ASDSLDSWLARETPYALDGILNNIGPDGAKAVGAVSGVVVASPSKSNPDY 51 FYTWTRDAALTVKCLTDLFLVNGDVNLQSQIQNYISRQAYLQTVSNPSGD 101 LSTGGLGEPKFEVDGAAFTGSWGRPQRDGPALRATALIAYANWLISNGQT 151 STAESIVWPVVQNDLSYVMQYWNSSTFDLWEEVYGSSFFTTAVQHRALVE 201 GAAFAKKLGHSCPDCLSQASQILCFLQSYWTGAYVLSNFGGGRSGKDANS 251 ILGVLHTFDPDADCDDTTFQPCSARALANHKVVTDSFRSIYSLNSGIAQG 301 QAVAVGRYPEDVYQGGNPWYLCTLAAAEQLYDALYQWDRIGSLSITDVSL 351 GFFQDLYPSAAVGDYASSTETYRDIMAAVKAYANGYMDIARKYTPANGAL 401 AEQFSRDDGSPVSAVDLTWSYASLLTAAARRGSQMPPSWNESSSNKPPST 451 CSASSATGAYASATNTVWPTASCAATPTAVPVRFNELVTTSVGDKVALVG 501 STPALGSWNVSAAVALSADEYSSVTPLWHGTVSLPTKTSFEYKYVVQKES 551 GEVDWEGGENRSYTVPEGCEGSSVTVNDSWK gDNAMkGAI (SEQIDNO:4) 1 atggtgaagatcagcataaatcccatcttgaaacggacattccctctatc 51 agtgctgctggcgccgctcctcgcagcctgtcttggggcttcaaacctag 101 ctcagatcgctgttgccgctgcaacatcggcggagtcaagtgctgcgtct 151 gattccttagattcatggctggccagagagactccatatgcccttgatgg 201 aattttaaataacatcggcccagacggcgcgaaggctgtgggtgcagtct 251 ctggcgtggtggttgcgagtccgagcaagagtaatccggattgtgagtat 301 tctcgtatttccagcccccaacgtcaagtgcatctatagcaaagaaagaa 351 aaagctcatgctaatggatgtatctgtatatatttctacacttggactcg 401 tgacgctgctctgactgttaaatgtctgaccgacctcttcctggtcaatg 451 gtgacgtgaatctgcagtcgcagatccagaactacatcagccgccaggca 501 tatttgcagaccgtatccaatccatctggtgacctgtcgactgggggact 551 tggtgagcccaaattcgaggttgatggcgctgcatttaccggttcctggg 601 gccgtcctcaacgagatgggcctgcgttgagggctacggctctgattgct 651 tatgccaattggctcattgtaggtgtttgcatgttggattttcttttctt 701 tctaatataatcttctcttgttgttacttgctaacttccatctacagagc 751 aatggacagacctcgacggcggagtccattgtttggccagttgtccagaa 801 tgacctttcatatgtgatgcagtattggaattcatctacctttggtttgt 851 cgaggcctctaaaatgggacaagcattctcagctaacgtatggaaacttc 901 atgcagacctctgggaggaagtctacggctcatcgttttttaccacggcc 951 gtgcagcatcgtgccctagtcgaaggtgcggctttcgccaaaaagcttgg 1001 ccactcttgtcccgactgtctctcccaggcatcgcagatcctctgctttt 1051 tgcagtcgtactggaccggtgcttacgtgctctctaactttggtggtggc 1101 cgctcagggaaggacgccaactcgatcctcggagttctgcatactttcga 1151 ccccgatgcagactgcgatgataccactttccagccttgttctgcccggg 1201 cgcttgcgaaccataaagtagttacggactctttccggtccatctactct 1251 ctcaactcgggtattgcccagggtcaagccgtggctgtgggacggtatcc 1301 cgaggacgtctaccagggaggcaatccatggtatctctgtactttggctg 1351 cggcggagcagctctacgacgcgctgtatcaatgggatcgaatcgggtcc 1401 ttgtctataacggacgtcagtctgggattcttccaggacctgtacccgtc 1451 cgctgcagtaggtgactatgcgtcttccacggagacatacagagatatca 1501 tggcagctgtgaaggcctatgcgaatggatatatggatattgctgtaagg 1551 agagctcctttccatcttttccttgtcccatgctgaaatagtgctacaga 1601 gaaagtacacacctgccaacggcgctctagcagagcagttttctagagac 1651 gatggttccccagtctcagcggtcgatctgacctggtcgtatgcctctct 1701 tctcacggcagcagccagacgaggctcccagatgccgccatcgtggaacg 1751 aatcttcttccaacaagcctccatcgacttgctcagcatcctctgcgacg 1801 gggccctatgcctcggctaccaacaccgtctggcccacagcgtcgtcacg 1851 cccctatggcacgggacggtgagtctcccgaccaaaacgagcttcgagta 1901 taagtatgtggtgcagaaggagtctggggaagtggactgggagggcggag 1951 agaatcggtcgtacacagtgccagagggatgcgagggctcttcagtgacc 2001 gtcaacgacagctggaagtag cDNASequenceofMkGAI (SEQIDNO:5) 1 atggtgaagatcagcataaatcccatcttgaaacggacattccctctatc 51 agtgctgctggcgccgctcctcgcagcctgtcttggggcttcaaacctag 101 ctcagatcgctgttgccgctgcaacatcggcggagtcaagtgctgcgtct 151 gattccttagattcatggctggccagagagactccatatgcccttgatgg 201 aattttaaataacatcggcccagacggcgcgaaggctgtgggtgcagtct 251 ctggcgtggtggttgcgagtccgagcaagagtaatccggattatttctac 301 acttggactcgtgacgctgctctgactgttaaatgtctgaccgacctctt 351 cctggtcaatggtgacgtgaatctgcagtcgcagatccagaactacatca 401 gccgccaggcatatttgcagaccgtatccaatccatctggtgacctgtcg 451 actgggggacttggtgagcccaaattcgaggttgatggcgctgcatttac 501 cggttcctggggccgtcctcaacgagatgggcctgcgttgagggctacgg 551 ctctgattgcttatgccaattggctcattagcaatggacagacctcgacg 601 gcggagtccattgtttggccagttgtccagaatgacctttcatatgtgat 651 gcagtattggaattcatctacctttgacctctgggaggaagtctacggct 701 catcgttttttaccacggccgtgcagcatcgtgccctagtcgaaggtgcg 751 gctttcgccaaaaagcttggccactcttgtcccgactgtctctcccaggc 801 atcgcagatcctctgctttttgcagtcgtactggaccggtgcttacgtgc 851 tctctaactttggtggtggccgctcagggaaggacgccaactcgatcctc 901 ggagttctgcatactttcgaccccgatgcagactgcgatgataccacttt 951 ccagccttgttctgcccgggcgcttgcgaaccataaagtagttacggact 1001 ctttccggtccatctactctctcaactcgggtattgcccagggtcaagcc 1051 gtggctgtgggacggtatcccgaggacgtctaccagggaggcaatccatg 1101 gtatctctgtactttggctgcggcggagcagctctacgacgcgctgtatc 1151 aatgggatcgaatcgggtccttgtctataacggacgtcagtctgggattc 1201 ttccaggacctgtacccgtccgctgcagtaggtgactatgcgtcttccac 1251 ggagacatacagagatatcatggcagctgtgaaggcctatgcgaatggat 1301 atatggatattgctagaaagtacacacctgccaacggcgctctagcagag 1351 cagttttctagagacgatggttccccagtctcagcggtcgatctgacctg 1401 gtcgtatgcctctcttctcacggcagcagccagacgaggctcccagatgc 1451 cgccatcgtggaacgaatcttcttccaacaagcctccatcgacttgctca 1501 gcatcctctgcgacggggccctatgcctcggctaccaacaccgtctggcc 1551 cacagcgtcgtcacgcccctatggcacgggacggtga AminoAcidSequenceofMkGAI(thematureprotein) (SEQIDNO:6) 1 ASDSLDSWLARETPYALDGILNNIGPDGAKAVGAVSGVVVASPSKSNPDY 51 FYTWTRDAALTVKCLTDLFLVNGDVNLQSQIQNYISRQAYLQTVSNPSGD 101 LSTGGLGEPKFEVDGAAFTGSWGRPQRDGPALRATALIAYANWLISNGQT 151 STAESIVWPVVQNDLSYVMQYWNSSTFDLWEEVYGSSFFTTAVQHRALVE 201 GAAFAKKLGHSCPDCLSQASQILCFLQSYWTGAYVLSNFGGGRSGKDANS 251 ILGVLHTFDPDADCDDTTFQPCSARALANHKVVTDSFRSIYSLNSGIAQG 301 QAVAVGRYPEDVYQGGNPWYLCTLAAAEQLYDALYQWDRIGSLSITDVSL 351 GFFQDLYPSAAVGDYASSTETYRDIMAAVKAYANGYMDIARKYTPANGAL 401 AEQFSRDDGSPVSAVDLTWSYASLLTAAARRGSQMPPSWNESSSNKPPST 451 CSASSATGPYASATNTVWPTASSRPYGTGR PrimerDeg.FW (SEQIDNO:7) GAYTAYTTYTAYACNTGG PrimerDeg.RV (SEQIDNO:8) YTGRTANACRTCDTCNGG MkGAprobeFW (SEQIDNO:9) CTGGTCAATGGTGACGTGAATC MkGAprobeRV (SEQIDNO:10) GCAATACCCGAGTTGAGAGAGTAG PrimerMkGAFW (SEQIDNO:11) ATGATTGACACAAAACCGACTGATATCGTCTC PrimerMkGARV (SEQIDNO:12) CTACTTCCAGCTGTCGTTGACGGTCAC PrimerMkGAFW-Trexpression (SEQIDNO:13) 5 GGGACAAGTTTGTACAAAAAAGCAGGCTCACCATGGTGAAGATCAGCATAAATCCCATC3, PrimerMkGAIIRV-Trexpression (SEQIDNO:14) 5 ACCACTTTGTACAAGAAAGCTGGGTCTACTTCCAGCTGTCGTTGACGGTC3 PrimerMkGAIRV-Trexpression (SEQIDNO:15) 5 ACCACTTTGTACAAGAAAGCTGGGTTCACCGTCCCGTGCCATAGGGGCGTG3 PrimerMkGAI+ ATGFW-Trexpression (SEQIDNO:16) 5 GGGACAAGTTTGTACAAAAAAGCAGGCTATGATTGACACAAAACCGACTGATATCGTCTC3 gDNAMkGAI+ ATG (SEQIDNO:17) 1 atgattgacacaaaaccgactgatatcgtctcgaaaatggtgaagatcag 51 cataaatcccatcttgaaacggacattccctctatcagtgctgctggcgc 101 cgctcctcgcagcctgtcttggggcttcaaacctagctcagatcgctgtt 151 gccgctgcaacatcggcggagtcaagtgctgcgtctgattccttagattc 201 atggctggccagagagactccatatgcccttgatggaattttaaataaca 251 tcggcccagacggcgcgaaggctgtgggtgcagtctctggcgtggtggtt 301 gcgagtccgagcaagagtaatccggattgtgagtattctcgtatttccag 351 cccccaacgtcaagtgcatctatagcaaagaaagaaaaagctcatgctaa 401 tggatgtatctgtatatatttctacacttggactcgtgacgctgctctga 451 ctgttaaatgtctgaccgacctcttcctggtcaatggtgacgtgaatctg 501 cagtcgcagatccagaactacatcagccgccaggcatatttgcagaccgt 551 atccaatccatctggtgacctgtcgactgggggacttggtgagcccaaat 601 tcgaggttgatggcgctgcatttaccggttcctggggccgtcctcaacga 651 gatgggcctgcgttgagggctacggctctgattgcttatgccaattggct 701 cattgtaggtgtttgcatgttggattttcttttctttctaatataatctt 751 ctcttgttgttacttgctaacttccatctacagagcaatggacagacctc 801 gacggcggagtccattgtttggccagttgtccagaatgacctttcatatg 851 tgatgcagtattggaattcatctacctttggtttgtcgaggcctctaaaa 901 tgggacaagcattctcagctaacgtatggaaacttcatgcagacctctgg 951 gaggaagtctacggctcatcgttttttaccacggccgtgcagcatcgtgc 1001 cctagtcgaaggtgcggctttcgccaaaaagcttggccactcttgtcccg 1051 actgtctctcccaggcatcgcagatcctctgctttttgcagtcgtactgg 1101 accggtgcttacgtgctctctaactttggtggtggccgctcagggaagga 1151 cgccaactcgatcctcggagttctgcatactttcgaccccgatgcagact 1201 gcgatgataccactttccagccttgttctgcccgggcgcttgcgaaccat 1251 aaagtagttacggactctttccggtccatctactctctcaactcgggtat 1301 tgcccagggtcaagccgtggctgtgggacggtatcccgaggacgtctacc 1351 agggaggcaatccatggtatctctgtactttggctgcggcggagcagctc 1401 tacgacgcgctgtatcaatgggatcgaatcgggtccttgtctataacgga 1451 cgtcagtctgggattcttccaggacctgtacccgtccgctgcagtaggtg 1501 actatgcgtcttccacggagacatacagagatatcatggcagctgtgaag 1551 gcctatgcgaatggatatatggatattgctgtaaggagagctcctttcca 1601 tcttttccttgtcccatgctgaaatagtgctacagagaaagtacacacct 1651 gccaacggcgctctagcagagcagttttctagagacgatggttccccagt 1701 ctcagcggtcgatctgacctggtcgtatgcctctcttctcacggcagcag 1751 ccagacgaggctcccagatgccgccatcgtggaacgaatcttcttccaac 1801 aagcctccatcgacttgctcagcatcctctgcgacggggccctatgcctc 1851 ggctaccaacaccgtctggcccacagcgtcgtcacgcccctatggcacgg 1901 gacggtgagtctcccgaccaaaacgagcttcgagtataagtatgtggtgc 1951 agaaggagtctggggaagtggactgggagggcggagagaatcggtcgtac 2001 acagtgccagagggatgcgagggctcttcagtgaccgtcaacgacagctg 2051 gaagtag

(313) Various modifications and variations of the described embodiments will be apparent to those skilled in the art without departing from the scope and spirit of those embodiments. It should be understood that the subject matters as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the embodiments that are obvious to those skilled in the art are intended to be within the scope of the following claims.

(314) All references discussed herein are incorporated herein by reference for all purposes.