ANTI-INFLAMMATORY PROTEINS AND METHODS OF PREPARATION AND USE THEREOF
20170157214 ยท 2017-06-08
Inventors
- Amanda BEAN (Hamilton, NZ)
- Peter MOLAN (Hamilton, NZ)
- Ray CURSONS (Hamilton, NZ)
- Richard WILKINS (Lyttelton, NZ)
Cpc classification
A61P29/00
HUMAN NECESSITIES
G01N33/15
PHYSICS
International classification
Abstract
The present disclosure relates to anti-inflammatory proteins, their uses, methods of preparation and methods of their detection. In particular, the invention relates to major royal jelly proteins modified by methyglyoxal and fragments thereof from manuka honey.
Claims
1.-29. (canceled)
30. A method of: a) reducing inflammation in a cellular tissue; b) reducing the rate of phagocytosis by immune system cells; c) inhibiting the receptors for phagocytosis on immune system cells; or d) reducing the respiratory burst and release of reactive oxygen species in inflammatory cells; comprising the step of contacting a composition to the cellular tissue or the cells, wherein the composition consists essentially of an isolated apalbumin protein or fragment thereof, which has been chemically modified by methylglyoxal (MGO).
31. The method of claim 30, wherein the apalbumin protein or fragment thereof comprises between 17 and 32 amino acid residues modified by MGO.
32. The method of claim 31, wherein the amino acid residues that are modified are either lysine or arginine.
33. An apalbumin protein fragment, which has been chemically modified by methylglyoxal (MGO), which has anti-inflammatory capacity, which is not naturally occurring, which is not identical to the amino acid sequence set forth in SEQ ID NO:1, and which comprises at least 85% sequence identity to the amino acid sequence set forth in SEQ ID NO:1.
34. The protein fragment of claim 33, wherein the protein fragment comprises between 17 and 32 amino acid residues modified by MGO.
35. The protein fragment of claim 34, wherein the amino acid residues that are modified are either lysine or arginine.
36. A composition comprising the protein fragment of claim 33.
37. A method of: a) reducing inflammation in a cellular tissue; b) reducing the rate of phagocytosis by immune system cells; c) inhibiting the receptors for phagocytosis on immune system cells; or d) reducing the respiratory burst and release of reactive oxygen species in inflammatory cells; comprising the step of contacting the composition of claim 36 to the cellular tissue or the cells.
38. An apalbumin protein variant, which has been chemically modified by methylglyoxal (MGO), which has anti-inflammatory capacity, which is not naturally occurring, which is not identical to the amino acid sequence set forth in SEQ ID NO:1, and which comprises at least 85% sequence identity to the amino acid sequence set forth in SEQ ID NO:1.
39. The protein variant of claim 38, comprising between 17 and 32 amino acid residues modified by MGO.
40. The protein variant of claim 39, wherein the amino acid residues that are modified are either lysine or arginine.
41. A composition comprising the protein variant of claim 38.
42. A method of: a) reducing inflammation in a cellular tissue; b) reducing the rate of phagocytosis by immune system cells; c) inhibiting the receptors for phagocytosis on immune system cells; or d) reducing the respiratory burst and release of reactive oxygen species in inflammatory cells; comprising the step of contacting the composition of claim 41 to the cellular tissue or the cells.
43. A method of producing an anti-inflammatory molecule by modifying royal jelly, the method including the step of reacting royal jelly with MGO at a concentration of at least 0.1%, 0.5%, or 1.0% MGO, thereby producing an MGO-modified apalbumin or fragment thereof, wherein the MGO-modified apalbumin or fragment thereof is an anti-inflammatory molecule.
44. The method of claim 43, which further includes the step of isolating the MGO-modified apalbumin protein or fragment thereof from the royal jelly.
45. A method of: a) reducing inflammation in a cellular tissue; b) reducing the rate of phagocytosis by immune system cells; c) inhibiting the receptors for phagocytosis on immune system cells; or d) reducing the respiratory burst and release of reactive oxygen species in inflammatory cells; comprising the step of contacting the cellular tissue or the cells with a composition comprising the MGO-modified apalbumin protein or fragment thereof of claim 44.
46. A method of increasing the anti-inflammatory capacity of an apalbumin protein or fragment thereof, by chemically treating the apalbumin protein or fragment thereof with MGO, formaldehyde, glyoxal, and/or glutaraldehyde, thereby increasing the anti-inflammatory capacity of the apalbumin protein or fragment thereof.
47. The method of claim 46, wherein the apalbumin protein or fragment thereof is an apalbumin 1 protein or fragment thereof.
48. A method of increasing the anti-inflammatory capacity and MGO-modified apalbumin protein content of a honey sample, comprising the step of adding MGO or a MGO-precursor molecule to the honey sample, thereby increasing the anti-inflammatory capacity and the content of MGO-modified apalbumin protein of the honey sample.
49. The method of claim 48, wherein the MGO-modified apalbumin protein is an MGO-modified apalbumin 1 protein.
Description
DESCRIPTION OF FIGURES
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
DETAILED DESCRIPTION
[0054] The following description sets forth numerous exemplary configurations, parameters, and the like. It should be recognized, however, that such description is not intended as a limitation on the scope of the present invention, but is instead provided as a description of exemplary embodiments.
DEFINITIONS
[0055] An apalbumin protein is a glycoprotein. There are a number of apalbumins that are found in honey and in royal jelly. The major apalbumin found in honey is Apalbumin 1 (Apa1) also known as Major Royal Jelly Protein 1 (MRJP 1). While the specification focuses on the major apalbumin found in honey, it is to be appreciated that the other apalbumins found in honey may also exhibit similar modification potential and similar anti-inflammatory capacity because they are all glycoproteins with a high mannose type of glycosylation as reported in 2000 by Kimura et. al. in Biosci. Biotechnol. Biochem. There are approximately nine Major Royal Jelly Proteins and the sequences of the Major Royal Jelly Proteins 1-5 are shown below.
[0056] The term fluorescence as used throughout this specification in relation to honey or apalbumin or a Major Royal Jelly Protein is the wavelength that corresponds substantially to the maximum emission of light predominantly in the region of 440-560 nm when excited by light of lower wavelength.
[0057] Royal jelly is a honey bee secretion that is secreted from the glands in the hypopharynx of worker bees. Aside from water, protein is the major component of royal jelly.
[0058] Tissue that is inflamed is defined as tissue in which an immune response has occurred in response to injury or infection in the tissue, and in which the tissue has one or more symptoms of: pain, swelling, heat, sensitivity or redness.
[0059] As used herein, anti-inflammatory capacity is defined as the capacity to clinically reduce inflammation or the symptoms of inflammation in cellular tissue. Anti-inflammatory capacity may be determined using the phagocytosis inhibition assay (PIA) described in detail, below or the DCFDA assay described in detail below.
[0060] Modification of a primary amino acid sequence is understood to include deletions (that is, polypeptides in which one or more amino acid residues are absent), additions (that is, a polypeptide which has one or more additional amino acid residues as compared to the specified polypeptide), substitutions (that is, a polypeptide which results from the replacement of one or more amino acid residues), and fragments (that is, a polypeptide consisting of a primary amino acid sequence which is identical to a portion of the primary sequence of the specified polypeptide).
[0061] Modified apalbumin is to be understood to include any apalbumin protein or fragment thereof that has been modified by the chemical reaction of methylglyoxal on the amino acids or the chemical reaction of methylglyoxal on the side chains of the amino group that make up the protein. Methylglyoxal modifications are likely to occur on the free amino groups of the lysine, arginine and/or cysteine amino acids within the apalbumin and the terminal amino acid and such MGO modifications may occur on approximately 1-40 sites within the protein. For example, modified apalbumin1 means Apa1 modified at one or more sites on its amino acid sequences to provide a MGO modified Apa1.
[0062] Amino acid sequence similarity or sequence identity refers to the amino acid to amino acid comparison of two or more polypeptides at the appropriate place, where amino acids are identical or possess similar chemical and/or physical properties such as charge or hydrophobicity. Based on the comparison, a percent identity then can be determined between the compared polypeptide sequences.
BRIEF DESCRIPTION OF THE SEQUENCES
[0063] SEQ ID NO: 1amino acid sequence of Apa1 (also known as Major Royal Jelly Protein 1) obtained from http://www.uniprot.org/uniprot/O18330.
TABLE-US-00001 10203040 MTRLFMLVCLGIVCQGTTGNILRGESLNKSLPILHEWKFF 50607080 DYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTM 90100110120 LRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSG 130140150160 IVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLT 170180190200 TSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSD 210220230240 TMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKM 250260270280 TIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNT 290300310320 EQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFG 330340350360 LVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIK 370380390400 EALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNF 410420430 RIMNANVNELILNTRCENPDNDRTPFKISIHL
The Lysine (K) 22 sites and Arginine (R) 17 sites have been highlighted to identify the possible sites of glycation by MGO, whereby such glycation gives rise to a MGO-modified apalbumin.
[0064] SEQ ID NO: 2amino acid sequence of Major Royal Jelly Protein 2 obtained from http://http://www.uniprot.org/uniprot/O77061 is shown in the Sequence Listing.
[0065] SEQ ID NO: 3amino acid sequence of Major Royal Jelly Protein 3 obtained from http://www.uniprot.org/uniprot/Q17060-1 is shown in the Sequence Listing.
[0066] SEQ ID NO: 4amino acid sequence of Major Royal Jelly Protein 4 obtained from http://www.uniprot.org/uniprot/Q17060-1 is shown in the Sequence Listing.
[0067] SEQ ID NO: 5amino acid sequence of Major Royal Jelly Protein 5 obtained from http://www.uniprot.org/uniprot/097432 is shown in the Sequence Listing.
MGO-Modified Apalbumin 1
[0068] Apalbumin 1, also known as Apa1 or Major Royal Jelly Protein 1 (MRJP1) is a protein found in varying concentrations in various bee products. Apa1 is a 48.9 kilodalton (kDa) protein secreted by bees, and it is found in honey, royal jelly, and other bee products. All varieties of honey tested have been shown to contain Apa1 (J. Simuth et. al, 2004). Apa1 is estimated to constitute 48% of the proteins in royal jelly (B. Lerrer et. al, 2007).
[0069] Methylglyoxal or MGO is a highly chemically reactive compound with the formula C.sub.3H.sub.4O.sub.2. MGO is formed by multiple metabolic pathways in living organisms. Certain preparations of manuka honey, which are referred to as active manuka honey, contain much higher concentrations of MGO than other varieties of honey. Active manuka honey has been determined to contain MGO concentrations up to 1000-fold greater than the MGO concentration in other varieties of honey (E. Mavric et al, 2008).
[0070] MGO can participate in a variety of chemical reactions in living organisms, including the formation process of Advanced Glycation Endproducts (AGEs). Glycation is the reaction of a sugar with a protein or a lipid without the involvement of an enzyme as a catalyst for the reaction. MGO can glycate proteins by reacting with the free amino groups of the amino acids arginine, lysine and/or cysteine and the terminal amino group, and thereby can chemically modify proteins that contain arginine and/or lysine. As can be seen from SEQ ID NO: 1 Apa1 contains a total of approximately 39 arginine and lysine residues that may be chemically modified by MGO.
[0071] MGO-modified Apa1 can be derived by isolation of the molecule from active manuka honey. MGO-modified Apa1 can be isolated from honey and/or enriched from honey by biochemical techniques. These techniques include but are not limited to filtration, centrifugation, and chromatography, such as ion-exchange, affinity, hydrophobic interaction, size exclusion, and reverse-phase chromatography. MGO-modified Apa1 can also be purified from various sources or chemically synthesized by addition of MGO to royal jelly.
[0072] MGO-modified Apa1 may also be derived by obtaining a gene coding for the amino acid sequence SEQ ID NO: 1, cloning the gene into an appropriate vector, transforming a cell line with the vector, causing the polypeptide to be expressed, purifying the polypeptide, mixing the polypeptide with MGO to allow for chemical reaction between MGO and the polypeptide, and purifying the MGO-modified polypeptide.
[0073] Expression systems may contain control sequences, such as promoters, enhancers, and termination controls such as are known in the art for a variety of hosts (See e.g. Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Ed., Cold Spring Harbor Press (1989) which is incorporated herein in its entirety). The expression systems may also contain signal peptide and proprotein sequences that facilitate expression of the gene and/or folding of the protein.
[0074] MGO-modified forms of amino acid variants of Apa1 (SEQ ID NO: 1) may also exhibit anti-inflammatory capacity. As would be understood by one of ordinary skill in the art, minor modification of the primary amino acid sequence of SEQ ID NO: 1 may result in a polypeptide which has substantially equivalent or enhanced anti-inflammatory activity as compared to SEQ ID NO: 1. When Apa1 modification includes one or more substitutions, preferred substitutions are those that are conservative, i.e., wherein the residue is replaced by another of the same general type. In making modifications to the Apa1 protein, the hydropathic index of amino acids may be considered (See, e.g., Kyte. et al., J. Mol. Biol. 157, 105-132 (1982), herein incorporated by reference in its entirety). It is known in the art that certain amino acids may be substituted by other amino acids having a similar hydropathic index or score and still result in a polypeptide having similar biological activity.
[0075] Preferably, the MGO-modified Apa1 variant exhibits at least about 75% sequence identity to the non-variant Apa1 sequence, preferably at least about 80% identity, more preferably at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any wild type or reference sequence described herein. Even more preferably, the MGO-modified Apa1 variant exhibits anti-inflammatory capacity substantially comparable to that of non-variant MGO-modified Apa1.
[0076] The formation of MGO-modified Apa1 in honey can be stimulated by (i) prolonged storage at ambient temperature, or (ii) incubation of honey at elevated temperatures (30-40 Celsius), thereby increasing the anti-inflammatory capacity of a sample of honey. Addition of MGO or an MGO precursor, such as dihydroxyacetone (DHA) to a sample of honey, along with sufficient time and/or heating to convert the MGO precursor to MGO, may also stimulate the formation of MGO-modified Apa1 in that sample of honey, and may also increase the anti-inflammatory capacity of the sample of honey, by the generation of MGO-modified Apa1 in the honey sample.
[0077] Apa1 with enhanced anti-inflammatory properties can also be formed outside of honey. Completely or partially purified Apa1 has been found to be treatable with MGO, in order to yield MGO-modified Apa1. The MGO-modified Apa1 exhibits enhanced anti-inflammatory properties when compared to the non-modified Apa1.
[0078] MGO-modified Apa1 and variants thereof may be included in therapeutically-effective amounts in pharmaceutical compositions. The pharmaceutical compositions of the present disclosure may be specially formulated for administration in solid or liquid form, including those adapted for the following: (1) oral administration, for example, drenches (aqueous or non aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; (2) parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained release formulation; (3) topical application, for example, as a cream, ointment, or a controlled release patch or spray applied to the skin; (4) intravaginally or intrarectally, for example, as a pessary, cream or foam; (5) sublingually; (6) ocularly; (7) transdermally; (8) pulmonarily, or (9) nasally. When the compounds of the present invention are administered as pharmaceuticals, to humans and animals, they can be given per se or as a pharmaceutical composition containing, for example, about 0.1 to 99%, or about 1 to 50%, or about 10 to 40%, or about 10 to 30, or about 10 to 20%, or about 10 to 15% of active ingredient in combination with a pharmaceutically acceptable carrier.
[0079] Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the pharmaceutical compositions described herein. These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms upon the compounds of the present invention may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
Example 1Isolation of MGO-Modified Apalbumin Protein from Manuka Honey
[0080] A sample of manuka honey obtained from the Honey Research Unit, University of Waikato, NZ and had a non-peroxide antibacterial activity equivalent to 12% w/v phenol (Allen, Molan et al. 1991), was fractionated as follows:
1.1 Elimination of the Low Molecular Weight Components of Honey
[0081] Twenty-five grams of manuka honey were suspended in 25 ml of distilled water and dialyzed (Cellu Sep T1 tubing, Membrane Filtration Products, Inc., Seguin, Tex.; EEUU, molecular mass cut off 3500 Da) against 1 litre of tap water for 48 h at 4 C. with four changes of the 1 litre of water during this time. The dialysis retentate was lyophilized and then stored at 20 C. until analysis. The lyophilized samples were reconstituted to 2 ml with 0.3 mol/l ammonium acetate buffer.
1.2 Chromatographic Separation on Sephadex G-50
[0082] The reconstituted retentate from dialysis (2 ml) was then loaded onto a Sephadex G-50 column (180 ml) and the material was eluted in 1 ml fractions (flow rate 0.5 ml/minute monitored at 280 nm). The fractions obtained from the 2 peaks shown in
1.3 Fast Protein Liquid Chromatography (FPLC) Separation of Protein on Superose 12
[0083] To further fractionate the first peak on the Sephadex G-50 elution trace, a 100 l amount of the reconstituted sample was injected on a Superose 12 FPLC column (25 ml) and eluted as 1 ml fractions with phosphate-buffered saline (pH 7.11), flow rate 0.5 ml/minute, 0.5 cm/ml, monitored at 280 nm. These fractions were frozen at 20 C. until further use. Two clearly separated major peaks (Fractions 8 and 14) obtained were assayed for inhibitory activity in the phagocytosis assay. These fractions were run on a 10% SDS-PAGE gel and processed for MALDI-TOF mass spectrometry identification.
1.4 Reverse Phase of Active Fractions
[0084] The fraction from chromatography on Superose 12 found to have phagocytosis-inhibiting activity (Fraction 8) was chromatographed on a reverse phase column to further purify proteins for MALDI mass spectrometry identification. Chromatography was performed using a column on a FPLC system (Pharmacia-LKB, Uppsala, Sweden). A 500 l amount of the Fraction 8 sample was injected on the column and eluted with a mobile phase in a gradient from 100% water to 100% of acetonitrile at a flow rate of 1 ml/minute monitored at 260 nm. The fractions comprising the two major peaks obtained (Fractions 23 and 26) were rotary evaporated to 50 l. The fractions (5 l) were loaded onto 10% SDS mini gels to visualise and processed for MALDI-TOF mass spectrometry as described below.
Example 2: Phagocytosis Inhibition Assay (PIA) Using THP-1 Cells
[0085] Phagocytosis is a cellular response or process of engulfing solid particles and in the immune system it is a major mechanism used to remove pathogens and cell debris. Bacteria, dead tissue cells, and small mineral particles are all examples of objects that may be phagocytosed or engulfed by a cell. Phagocytosis occurs at the beginning of the inflammatory response of leukocytes to a trigger of inflammation. Reactive oxygen species and cytokines that are produced by cells when phagocytosis is activated in them recruit and activate more phagocytes as part of a cascade of cellular events which are the inflammatory response that all begins with phagocytosis. Thus any inhibitor of phagocytosis effectively stops the inflammatory response right at the start of the cascade.
[0086] The phagocytosis-inhibiting activity of a range of types of New Zealand honey was measured. Manuka honey was found overall to have a much higher activity than other types, as shown in the following Table 1, which shows the effect of different types of honey (0.5%) on phagocytosis of latex particles in LPS-activated THP-1 cells. The assay was performed 4 h after latex particle addition. Manuka and artificial honey concentrations were achieved by dilution of the honey with sterile RPMI 1640 complete medium. Manuka honey was obtained from the Honey Research Unit, University of Waikato, NZ and had a non-peroxide antibacterial activity equivalent to 12% w/v phenol (Allen, Molan et al. 1991). Honey was diluted by weighing 1.37 g (density of honey per ml) and diluting this with 19 ml of MilliQ water (5% V/V concentration) immediately prior to use in sterile RPMI 1640 and filtered (50 m, 8 m and 3 m, Minisart Sartorius filters, Millipore corporation) to remove pollen, bee tissues etc. Undiluted honey was kept at 4 C. in dark coloured containers to prevent enzyme denaturisation and degradation. Artificial honey was used to provide a control for the osmotic effect of the natural sugars found in honey. The composition of this was as published (White 1975).
[0087] It is well known that some types of honey produced in New Zealand may have had some manuka nectar also included in them whilst being produced by the bees because manuka grows extensively throughout New Zealand and is a favoured source of nectar for bees.
TABLE-US-00002 TABLE 1 Honey type Percent reduction in phagocytosis Pasture honey 13% 4% Clover honey 6% 4% Kanuka honey 15% 3% Manuka honey 67% 10% Artificial honey 0%
[0088] THP-1 is a well-characterized human monocytic leukemic cell line. The cells resemble monocytes with respect to several criteria and can be differentiated into macrophage-like cells by treatment with PMA, LPS or Vit D (Auwerx J., 1991). Once activated the macrophage can be used to study phagocytosis by incubating the macrophages with latex beads or similar and recording the phagocytic uptake by observing the cells under a microscope. By using fluorescent latex beads the beads are visible inside the cell after phagocytosis. Substances that inhibit phagocytosis can be studied by comparing the amount of phagocytosis when the substance is added with the amount of phagocytosis without the substance added.
[0089] Changes in cell morphology, phagocytosis, rate of cell division, and selected surface markers were evaluated in cultures of THP-1 cells exposed to honey after activation with LPS, PMA and Vit-D. LPS was selected for further research as the activation rate is shorter enabling the assay to be completed within 30 hours. LPS-activated cells become macrophages in 24 hours whereas with PMA and Vit D it takes at least 72 hrs. The criteria for differentiation of THP-1 cells were cell adherence, changes in cell morphology, and changes in the cell surface marker expression profile of human cartilage group protein-39 (HCgp-39) and carboxypeptidase M (CPM) that are associated with the macrophage phenotype, determined by qRT-PCR of mRNA from LPS treated and untreated cells.
[0090] THP-1 cells were maintained at 37 C., 5% CO.sub.2, and 95% relative humidity (RH) in endotoxin-free RPMI 1640 medium containing 10% fetal calf serum and 25 mM HEPES with antibiotics. Cells were sub-cultured every 3 days to maintain cell counts around 10.sup.6/ml and viability was assessed on a haemocytometer by means of trypan blue exclusion before treatments. Passage number was always between 40 and 55.
[0091] A 100 ug/ml stock solution of LPS was prepared by dissolving 1 mg LPS in sterile RPMI 1640 (Invitrogen). The stock solution was stored frozen at 20 C. Immediately prior to use, the LPS stock solution was thawed and added to freshly sub-cultured cells to a final concentration of 500 ng/ml with 10.sup.6/ml THP-1 cells with a viability 95% or higher. Cells were plated out at 1 ml per well in a 24 well plate (Cellstar, Greiner bio-one) and the plate sealed with tape to avoid evaporation. Plates were incubated for 24 hours 37 C., 5% CO.sub.2, and 95% relative humidity (RH) to allow activation.
[0092] Prior to the phagocytosis assay, each well was checked on an inverted microscope to observe morphology changes which indicate a successful transformation. Control THP-1 cells (no LPS) maintained a round shape and did not clump or adhere to the culture plate surface whereas activated THP-1 cells treated with LPS aggregated, became flat and amoeboid with obvious pseudopodia, and adhered to the culture plate surface.
[0093] Monolayers of LPS-activated THP-1 cells were washed twice with sterile RPMI medium, removing the suspended cells, and then incubated with either one of three treatments; no honey, artificial honey (0.25%) or honey (0.25%) for 30 minutes in 500 l RPMI. Sterile 1.0 m coated polystyrene latex beads (Sigma L5405-1 ml) approx 25 beads per cell were added to the monolayers and plates incubated 37 C., 5% CO.sub.2, and 95% RH. Each treatment group had at least three replicates per experiment and repeated at least twice on separate days.
[0094] After four hours of incubation suspended cells were removed and phagocytosis halted by washing the monolayer with ice-cold sterile phosphate-buffered saline. Adherent cells were loosened from the plate by gentle pipetting of 100 l PBS up and down on the well. At least 200 cells from each sample were counted on a haemocytometer using an Axostar plus Zeiss fluorescent microscope phase II with a 40 lens. Cells that contained at least three beads were considered positive for phagocytosis. Non-activated THP-1 cells (monocytes) had less than 5% phagocytosis rate observed in preliminary assays. Viability was checked after the assay using the trypan blue exclusion method to ensure treatments or honeys had not induced apoptosis.
[0095] The ability of THP-1 cells to phagocytise latex beads is quantified with a percentage of honey treatment/no honey control. First the activation rate was obtained by dividing the number of phagocytic cells by the number of cells counted on a haemocytometer. Acceptable activation rates for four hours of incubation was 70% or greater. The honey treatments were also counted in this manner and then a percentage reduction of phagocytosis was calculated according to the following formula.
% reduction of phagocytosis=(honey treatment phagocytosis rate/control)100-100
[0096] An exemplary calculation follows:
[0097] Control, 75% (75% of the cells phagocytosed at least 3 beads)
[0098] Honey treatment 1, 25% (25% of the cells phagocytosed at least 3 beads)
[0099] Honey treatment 1, phagocytosis-inhibiting activity=(25/75)100-100=66.7%
[0100] This result indicates that honey treatment 1 had a 66.7% inhibitory effect on the phagocytic uptake of latex beads.
[0101] For screening lots of samples this assay can be modified to work on a 96 well plate using a modified protocol set out by (Wan, Park et al. 1993). This assay has been modified to use THP-1 and its growing conditions/media and the same latex beads. Wells are washed in PBS after incubation with honey to remove suspended cells and free latex beads before measurement on either a plate reader or the LAS-1000. Both methods have been compared and give fairly similar results.
Example 3: Measurement of Fluorescence Intensity
[0102] The fluorescent intensity of honey is measured on a Fujifilm LAS-100 equipped with an intelligent darkbox II (Alphatech). Data is analysed using the provided software, Image Reader LAS-1000 plus lite version 1.5 and Image Gauge 4.0.
[0103] Honey is brought to room temperature and diluted to 10% v/v (1 ml honey=1.37 gm) in double-distilled H.sub.2O. 5 ml of dilute honey is then filtered through a 0.2 m Minisart sterile single use syringe filter (Sartoris). 100 l of dilute honey is pipetted into 5 wells of a 96 well black plate (nunc CAT 137101). A standard honey with known fluorescence is also plated along with a water blanks and empty wells for background readings.
[0104] The plate is placed inside the darkbox (level 4) and focused using the Image reader LAS 1000 plus programme. A pre-exposure is taken to gauge the required exposure time which is approximately 30 seconds. Once the image is taken results are obtained using the provided Image Gauge 4.0. Briefly, the fluorescence is measured across the well in arbitrary units (AU) and the background intensity is subtracted to give a reading ranging from 40000 AU to 260000 AU. Samples are averaged to obtain a final reading with typical standard deviation+/1500 AU. In some cases the fluorescence intensity is too high and exposure time is reduced to avoid over exposure. The standard honey AU is used to derive the correct AU for these honeys (though this is rarely done as only a few honeys have been this fluorescent).
[0105] 1% of the concentration they would have been in honey. A 200 l assay sample size was used due to the smaller amounts of protein available from the fractioning of honey. Fraction 8 and 14 obtained as described above were assayed for phagocytosis-inhibitory activity. Fraction 8 had strong phagocytosis inhibiting activity and fraction 14 had very little activity. Both fractions were identified with significant hits by MALDI-TOF mass spectrometry as described below. The fraction with the majority of the anti-inflammatory activity (Fraction 8) was modified Apalbumin 1 (MRJP-1). Fraction 14 returned two hits, one being significant which was Apalbumin 3 (MRJP-3). The non-significant hit was Apalbumin 1 (MRJP-1), most likely being unmodified by MGO.
Example 4 Electrophoresis on SDS Mini Gels
[0106] Proteins obtained by fractionation of honey were run on SDS-PAGE gels to visualise and give a molecular weight estimate. Resolving gels with 10% and 12% acrylamide were used for separating a different range of proteins. The 10% gel is best for separating 14-205 kD proteins and 12% gel for 14-66 kD proteins. The gels were made in an OWL Separation System gel caster (BioLab Scientific LTD) using assembled clean glass plates. The resolution gel was poured first, using a syringe, and left to set covered with a layer of butanol to ensure an even gel surface. When the gel was set the butanol was removed and the stacking gel was poured and a gel comb inserted to make wells for sample loading. The composition of the gels was:
10% Resolution Gel
[0107] 6.8 ml 37% Acrylamide
[0108] 2 ml 1M Tris pH 9.0
[0109] 5.9 ml water
[0110] 150 l 10% Sodium Dodecyl Sulfate (SDS)
[0111] 15 l N,N,N,Ntetramethylenediamine (TEMED)
[0112] 150 l 10% ammonium persulfate (APS)
12% Resolution Gel
[0113] 8.2 ml 37% Acrylamide
[0114] 2 ml 1M Tris pH 9.0
[0115] 4.5 ml water
[0116] 150 l 10% SDS
[0117] 15 l TEMED
[0118] 150 l 10% APS
5% Stacking Gel
[0119] 0.66 ml 37% Acrylamide
[0120] 1.25 ml 0.5M Tris pH 6.8
[0121] 3.0 ml water
[0122] 50 l 10% SDS
[0123] 5 l TEMED
[0124] 50 l 10% APS
[0125] When the stacking gel was set, the gel was inserted into the electrophoresis chamber and running buffer (3.0 g Tris, 14.4 g Glycine, 1 g SDS, in 11 MilliQ water) added in the top and bottom chamber. The comb was removed and the sample wells washed with electrophoresis buffer. The gel was then run for 10 minutes at 10 mA to remove any un-polymerised acrylamide. Samples to be loaded on the gel were mixed 1:1 with 2 Tricine Sample Buffer (0.1 mol/l Tris pH 6.8, 24% (w/v) glycerol, 8% (w/v) SDS, 0.2 mol/l dithiothreitol, 0.02% (w/v) Coomassie Blue G-250) and heated at 99 C. for 5 minutes, then left to cool. Samples were centrifuged (2000 g for 20 seconds) to pellet any sediment and 10 l of sample loaded per lane. A BIORAD Precision Plus Dual Colour protein standard ladder (Cat. No. #161-0374) was run alongside the samples to provide an estimated protein size for the samples. The standard contained proteins sized 10-250 kDa: 6 l was loaded at each end of the gel. The gel was run at 10 mA until samples had migrated through the stacking gel into the resolution gel. The current was then increased to 20 mA. When the dye in the sample had run off the edge of the gel, the current was switched off and the gel removed and stained. Two methods were used to visualize bands. Silver staining was used to identify fainter bands as it is more sensitive. A fast blue method was used prior to MALDI-TOF mass spectrometry work as the stain is more readily removed than silver. Fast blue is a stain using Coomassie Brilliant Blue which binds with less affinity to glycoproteins making it ideal for honey which has a large proportion of glycoproteins. This allows for better stain removal prior to protein MALDI mass spectrometry work as remaining stains can interfere with quantification (Deutscher 1990). All reagents were made fresh 5 minutes before staining took place and kept at 4 C. until required. The gel was first fixed for 30 minutes in 50% ethanol/12% acetic acid, then soaked in 30% ethanol for 15 minutes. Then 100 ml of 0.02% sodium thiosulfate was added and left for 1-2 minutes. The gel was soaked in 100 ml 0.1% silver nitrate+100 l formaldehyde for 10 minutes. It was then washed in water for 10 seconds and 100 ml developer (3 g sodium carbonate, 100 l formaldehyde, 40 l 1% sodium thiosulfate in 100 ml MilliQ water) added. Development was stopped with 10% acetic acid after the bands became visible. Developed gels were stored in MilliQ water until required. Fast Blue was obtained from Fisher Biotec (Cat. No. # FS-100). Fast Blue was diluted (8 ml of Fast Stain concentrate, 32 ml MilliQ water, 10 ml 45% methanol with 10% acetic acid) before use. Gels were first washed in 40% methanol with 10% acetic acid for 10-20 minutes followed by a rinse in MilliQ water. Then 100 ml of diluted Fast Blue was added and the gel was gently swirled in the solution for 20 minutes. Gels were de-stained with 10% acetic acid for 10 minutes, then stored in MilliQ water until required.
[0126] The molecular weight for Fraction 8 (Apa1/MRJP-1) estimated from the SDS gels is 60 kDa which is 10 kDa larger than would be expected as the Swiss-prot returned a protein size of only 48.9 kDa. The size disparity could be explained by glycosylation and/or cross-linking. Three predicted N-linked glycosylation sites have been reported on MRJP-1 (Srisuparbh, Klinbunga et al. 2003). Glycation of these sites would increase the molecular weight. As Fraction 8 was in the void volume, (meaning macromolecules that are sufficiently large to be excluded from the column beads elute first from the column (the void volume of the Superose 12 column is 11 ml), this may indicate that the Apa1/MRJP-1 is highly glycosylated and/or cross-linked, as at 48.9 kDa (the molecular weight of Apa1/MRJP-1) the monomer protein should easily enter the column.
Example 5 MALDI-TOF Mass Spectrometry Identification of Active Honey Proteins
[0127] The MALDI-TOF work described below was completed at the Waikato Mass Spectrometry Facility, University of Waikato.
5.1 Preparation of Proteins
[0128] A clean scalpel was used to excise the bands which were then de-stained with 30% ethanol to remove the Fast Blue dye by incubating at 60 C. for 15 minutes or until the gel pieces appeared colour-less. The bands were washed twice in 30% ethanol and then shrunk with 100% acetylnitrile for 10 minutes. Acetylnitrile was removed by aspiration and the gel piece was dried by vacuum in a Speed Vac to remove residual moisture for 30 minutes. The protein in the gel pieces was cleaved into peptides for analysis by MALDI-TOF mass spectrometry by digesting the protein in the gel piece with trypsin. The method used was adapted from details given by Jo McKenzie, University of Waikato. To each gel piece 10 l of 25 mmol/l ammonium bicarbonate was added, followed by 10 l of sequencing grade trypsin solution (49 l 25 mmol/l ammonium bicarbonate in 10% acetylnitrile, 1 l sequencing trypsin (1 mg/ml Promega Cat. No. # V5111). Tubes were then left overnight at 37 C. To each tube 14 l 50% acetylnitrile with 0.3% trifluoroacetic acid was added and the tubes vortexed and sonicated for 10 minutes. The gel piece was discarded and the solutions were refrigerated until use.
5.2. Preparation of Matrix
[0129] The method used was obtained from Waikato Mass Spectrometry Facility, University of Waikato. 5 mg -Cyano-4-hydroxycinnamic acid (CHCA) was added to 500 l 65% acetylnitrile with 1% trifluoroacetic. The solution was vortexed for 2 minutes, sonicated for 10 minutes, vortexed again for 2 minutes then centrifuged at 12,000 rpm for 5 minutes. The prepared protein digest solutions and matrix were combined (2:1) and 1 l was spotted onto the MALDI Anchor chip target plate. The spots were allowed to air dry and then washed by pipetting 5 l of 1% trifluoroacetic onto and off the dried matrix spot and allowed to dry.
5.3 Autoflex Operating Procedure
[0130] The external calibration was conducted with the Bruker Daltonics Peptide standard 206195 prior to analysis. A monoisotopic peptide calibration was used with a zooming of 0.1%. Once a good, clean spectrum has been collected the mass spectrometer is automatically recalibrated. The fit result is accepted if the error is no more than 10 ppm. Internal calibration can be conducted if products resulting from the autolysis of the trypsin are present. These products yield peaks at 842 and 2 211. The peaks are assigned as internal calibrants in the flex analysis program. A Bruker Autoflex II TOF/TOF mass spectrometer was used to analyze peptide digests. An average of 30 shots per sample was taken to build the peptide mass fingerprint spectra. The mass range selector was set at low range and the detector gain voltage offset was set at 1 400 v. The detection settings were set in the range of 480-3 540 Da. The instrument was manually operated using flex control software. Suitable spectra were saved and exported into flex analysis.
5.4 Analysing MALDI Spectra
[0131] Using the Biotools software the spectrum collected can be searched against a variety of protein databases. The databases of preferred use are SWIS Prot and NCBInr. The parameters for the searching of Eukaryota proteins in SWIS Prot are a peptide tolerance of 200 ppm and 1 missed cleavage. A protein score greater than 64 is significant for Swis Prot. The parameters for searching of Eukaryota proteins, in NCBInr are 1 missed cleavage and a peptide tolerance of 200 ppm. The protein Score required for a significant hit in NCBInr is 78. These parameters where correct, at least, up until May 2009. Molecular masses can be measured to within an accuracy of 0.01% of the total molecular mass of the molecule/peptide. This is sufficient to allow minor mass changes to be detected, e.g. the substitution of one amino acid for another or a post-translational modification.
[0132] The main function of the mass analyser is to separate, or resolve, the ions formed in the ionisation source of the mass spectrometer according to their mass-to-charge ratios. The peptides produced by the tryptic digest are separated by ionisation due to their mass and this mass can be calculated. The detector monitors the ion current, amplifies it and the signal is then transmitted to the data system where it is recorded in the form of a mass spectrum. The mass to charge values of the ions are plotted against their intensities to show the number of components in the sample, the molecular mass of each component, and the relative abundance of the various components in the sample. When using MALDI-TOF to identify a protein, the ions generated must form a clear mass spectrum with intense peaks, indicating that only one protein (in large quantities at least) is present in the band cut from the SDS electrophoresis gel. When more than one protein is present in the sample there is typically no clear peaks correlating to large amounts of the same peptide.
5.5 MALDI-TOF Mass Spectrometry Identification of Active Proteins
[0133] The proteins recovered from the excised bands in the gels from SDS electrophoresis as described above, Fractions 8 and 14 from the Superose 12 chromatographic separation, were subjected to a tryptic digest for MALDI-TOF mass spectrometry analysis for identification. The Autoflex operating procedure described above was used to obtain a peptide mass fingerprint spectrum of Fraction 14 isolated from the Superose 12 chromatography column. The mass spectrum generated by MALDI-TOF mass spectrometry as shown in
[0134] The same procedure was also carried out for Fraction 8 isolated from the Superose 12 chromatography column. The MALDI mass spectrum of the peptides from Fraction 8 as shown in
Example 6Incubation of Honeys in the Presence of MGO
[0135] Both Manuka and non-Manuka honeys were incubated. Manuka honey was selected for incubation based on its initial high MGO levels and low fluorescence. Non-Manuka honey was selected based on its low fluorescence and lack of MGO. Honey was incubated for three months, during which time fluorescence readings were tracked. Each honey incubated also had a sample frozen to maintain the original qualities. The incubated honey and the frozen honey were assayed for inhibition of phagocytosis and were subjected to SDS electrophoresis on a mini-gel to determine any protein size modifications due to the incubation. A Manuka honey with high fluorescence and Manuka honey with low fluorescence was also subjected to SDS electrophoresis for comparison to the incubated and non-incubated honey. Whole Clover and Pasture honeys were incubated with MGO or without MGO for three months at 37 C. to determine if the presence of MGO would generate fluorescence over time in the non-fluorescent honey and increase the phagocytosis-inhibiting activity. The honey had been assayed previously for phagocytosis-inhibiting activity and had low activity. The honey was electrophoresed on a SDS mini-gel to determine any protein size modifications due to the incubation. The MGO treated honey was assayed in the phagocytosis assay to determine what effect the incubation had on the phagocytosis-inhibiting activity. Methylglyoxal (40%) was purchased from Sigma-Aldrich (Cat. No. #M0252) and used at final concentrations correlating to a non-peroxide antibacterial activity of 15 (approximately 400 g/gm honey or 1 ml of 40% MGO per kg honey).
6.1 Honey Incubation
[0136] Whole Manuka honey (20 g of MSB20, NPA 20+), Pasture honey (20 g) and Clover honey (20 g) were incubated for three months at 37 C. Clover honey, (20 g) treated with 400 g/g MGO mixed into it, was also incubated for three months at 37 C. Control samples of all the honeys (20 g) were frozen for the duration. The fluorescence of honey immediately after adding the MGO was measured, and at the concentrations added to honey, the fluorescence was found to not increase due to the added MGO. After six weeks and three months incubation of the honey, the fluorescence was measured.
6.2 SDS Gel Electrophoresis of Incubated Honey
[0137] Honey samples described above were run on a 12% SDS mini-gel (prepared and run as described above) Also included for comparison was Manuka honey with high fluorescence and Manuka honey with low fluorescence. Honey was diluted to 10%. Samples to be loaded on the gel were mixed 1:1 with 2 Tricine Sample Buffer and heated at 99 C. for 5 minutes, then left to cool prior to loading. Prior to staining, gels were imaged on a UV gel illuminator to observe the fluorescence of the protein band (this fluorescence was not visible after staining). SDS minigels were silver-stained.
[0138] Table 2 below shows the fluorescence measurements for selected honeys before, during and after incubation for three months at 37 C. with natural MGO levels (Manuka) or 400 mg/kg MGO added (Pasture and Clover). In the controls which were Manuka honey (with a high natural MGO content) kept for three months at 4 C., and Pasture and Clover honey with 400 mg/kg MGO, or honey with no added MGO (Pasture and Clover), kept for three months at 4 C., there was no increase in fluorescence (results not shown).
TABLE-US-00003 TABLE 2 Fluorescence Fluorescence Fluorescence MGO before after 6 weeks after 3 months Honey mg/kg incubation incubation incubation Manuka 576 88 149 170 Pasture 10 35 47 57 Pasture 410 35 64 89 Clover 0 41 52 60 Clover 400 41 66 82
Table 2.
[0139] Fluorescence measurements (in Arbitrary Units10.sup.3) before incubation, after 6 weeks incubation, and after 3 months incubation at 37 C., with the level of natural or added MGO shown for honey. Manuka honey had natural MGO levels whereas Pasture and Clover had MGO added.
6.3 SDS Electrophoresis Gel Images of Incubated Honeys
[0140] The results of electrophoresis of honeys incubated with MGO are shown in
[0141] As described in detail above, activity-led fractionation was used to isolate the component(s) of the sample of manuka honey. It was found by the inventors, that the isolated component of manuka honey having phagocytosis-inhibiting activity was fluorescent. At each stage of separating the honey into fractions each fraction was tested to measure how much phagocytosis-inhibiting activity was present in it by measuring the fluorescence of the component at about 490 nm. As can be seen from
[0142] Having found by activity-led fractionation that an Apa1 or a MRJP-1 protein was the component responsible for the anti-inflammatory activity, and knowing that other honeys have the presence of Major Royal Jelly Proteins further work was conducted to determine if the presence of the high levels of MGO in the manuka honey was modifying the Apa1/MJRP protein. It was found that Manuka honey had a high fluorescence that was not seen in other honey types to the same extent and that this fluorescence was due to MGO modifying the proteins in honey. Without wanting to be bound to any particular theory the high level of MGO that is a unique feature of manuka honey is thought to cause glycation of the Apa1/MRJP protein to form Advanced Glycation End-products (AGEs) which are fluorescent as reported in Schmitt et al, Analytical Biochemistry, 2005. It was found by the inventors that the incubation of honey with MGO, gave rise to an increase in fluorescence, at the same emission wavelength as the fluorescence developed in bovine serum albumin when it was incubated with MGO. Further analysis showed that anti-inflammatory activity also increased as a result of this treatment. A correlation was found between the fluorescence and the anti-inflammatory activity of samples of honey as shown in
Methods of Use for MGO Modified Apalbumins
[0143] Inflammation in tissue may be reduced by administering one or more purified MGO-modified Apalbumin polypeptides or a MGO-modified Apalbumin-containing composition to inflamed tissue.
[0144] MGO-modified Apalbumin reduces inflammation in tissue by reducing the rate of phagocytosis by immune cells, and by blocking the mannose receptors on immune cells, which trigger phagocytosis. Immune cells include macrophages, monocytes, dendritic cells, and granulocytes.
[0145] MGO-modified Apalbumin may be administered to inflamed tissue in various different forms, including MGO-modified Apalbumin which has been purified from other components, and MGO-modified Apalbumin which is in a composition containing one or more other types of compounds such as pharmaceutically acceptable carriers, adjuvants, or therapeutic molecules. MGO-modified apalbumin may be purified from active manuka honey, or from manuka honey or any other type of honey to which MGO or an MGO precursor has been added to modify the apalbumin, or it may be purified from royal jelly or a system in which apalbumin is recombinantly expressed and then treated with MGO.
[0146] MGO-modified apalbumin in a composition containing one or more other types of compounds includes MGO-modified apalbumin in honey or a honey extract that has been enriched for MGO-modified apalbumin, MGO-modified apalbumin in extracts related to the recombinant production of apalbumin and the chemical modification of apalbumin with MGO.
[0147] Purified MGO-modified apalbumin or MGO-modified Apalbumin 1-containing compositions may be administered to inflamed tissue in various different forms, including but not limited to: creams, lotions, liquid solutions, or poultices. MGO-modified Apalbumin may also be administered to inflamed tissue as by inclusion of MGO-modified Apalbumin in an edible product. Such products include but are not limited to: beverages, candies, syrups, lozenges, pills, and foods.
Methods of Detecting MGO-Modified Apalbumin and Characterizing Properties of Honey
[0148] The anti-inflammatory capacity of a sample of honey may be determined through detection of a MGO-modified Apalbumin. The chemical modification of Apa1 by MGO generates MGO-modified Apa1 that exhibits greater fluorescence than Apa1 that has not been modified by MGO. Because Apa1 is present in honey, by measuring the fluorescence of a sample of honey, a measurement of the relative concentration of MGO-modified Apa1 in the honey sample can be obtained. A measurement of the concentration of MGO-modified Apa1 in a sample of honey directly relates to the anti-inflammatory capacity of the sample of honey.
[0149] By measuring the fluorescence of samples of honey with known low concentrations of MGO-modified Apalbumin, such as Apa1, and also the fluorescence of samples of honey with known high concentrations of MGO-modified Apa1, a standard scale can be generated, which correlates the fluorescence of a sample of honey to the concentration of MGO-modified Apa1 in that sample of honey. In order to obtain samples of honey that contain a known MGO-modified Apa1 concentration that can be used for fluorescence testing and standard scale generation, the MGO-modified Apa1 concentration of samples of honey can be determined by standard analytical chemistry techniques, such as mass spectroscopy.
[0150] Once a standard scale is generated that correlates the fluorescence of a sample of honey with the MGO-modified Apa1 concentration in the sample of honey, that standard scale may be used in combination with fluorescence testing of samples of honey in order to generate various types of information useful for honey production and analysis.
[0151] For example, the fluorescence of a sample of honey with unknown MGO-modified Apa1 concentration can be measured, and based upon the fluorescence measurement and the standard scale, the concentration of MGO-modified Apa1 in the test honey sample can be determined. This fluorescence method of determining the concentration of MGO-modified Apa1 in a sample of honey is much cheaper and faster than other analytical chemistry techniques, such as mass spectroscopy. By measuring the concentration of MGO-modified Apa1 in the honey sample in this way, the anti-inflammatory capacity of the honey sample is also quickly determined.
[0152] Because high MGO concentration is a feature unique to manuka honey among all honey varieties, honey producers may try to simulate active manuka honey by adding MGO to samples of honey that do not naturally contain a desired concentration of MGO. Consumers prefer naturally occurring honeys over treated honeys. Purified, active MGO is readily available from commercial chemical producers (e.g. Sigma-Aldrich, St. Louis, Mo., sells a solution of 40% methylglyoxal in water), and honey producers may add MGO to a sample of honey that does not naturally contain a desired concentration of MGO, in order to raise the concentration of MGO in the honey sample to a desired level. A process independent from natural honey formation includes any activity not performed by bees, and it therefore includes activities such as addition of purified MGO to a honey sample. A process independent from natural honey formation does not include activities such as bees collecting nectars, pollens, or other plant products that contain high levels of MGO or MGO-precursor molecules.
[0153] The fluorescence of honey may also be used to determine an appropriate time to harvest honey from a hive or to store harvested honey in order to obtain honey with desired anti-inflammatory properties. Because the modification of apalbumin by MGO in honey may occur over a period of time, a honey producer may choose to keep honey in the hive until it contains a desired anti-inflammatory capacity and concentration of MGO-modified apalbumin. By measuring the fluorescence of samples of honey from the hive at different time intervals, a honey producer can use the measurement of the fluorescence of the honey as a method for determining the optimal time to harvest honey from the hive in order to obtain a honey having desired anti-inflammatory properties in the honey. Similarly, a honey producer may also measure the fluorescence of honey stored outside of the hive, in order to determine if the honey sample has a desired level of anti-inflammatory properties. By measuring the fluorescence of honey samples, a honey producer seeking to obtain a honey sample containing a desired anti-inflammatory capacity can store honey until it has developed a desired level of anti-inflammatory capacity by the formation of MGO-modified apalbumin.
Modification of Royal Jelly with MGO and Assessment of the Resulting Molecular Weight Changes.
[0154] Royal jelly was taken and analysed by MALDI-TOF using sinipanic acid as the matrix and in positive ion mode. One significant peak at approximately m/z of 52.4 kDa was identified. This peak corresponded with the m/z of 52.4 kDa obtained from a reverse phase isolated fraction that had previously been identified as major royal jelly protein.
[0155] The analytical RP HPLC protocol was performed on a Phenomenex Proteo90 column (3, 90 , C18, 2504.06 mm) with a Phenomenex SecurityGuard C-18 guard column. The column was equilibrated with Buffer A: 0.1% TFA in Nanopure water, flow rate 1 mL/min. A gradient of buffer B (100% acetonitrile containing 0.1% TFA) was applied as follows and the absorbance was monitored at 214 nm (Table 1).
[0156] The royal jelly was then reacted with methylglyoxal at 0.1%, 0.5% and 1.0%. The royal jelly protein solutions were prepared by dissolving the partly defrosted preparation in PBS at a concentration of 10 mg/mL. MGO solutions were prepared by diluting the stock solution (Sigma, 40%) with PBS to obtain end concentrations in the range of 0.1, 0.5 and 1.0%. To 900 L of the protein solution 100 L of MGO solution of the required concentration was added and the mixture was incubated overnight at 60 C. The resulting reaction product was also studied by MALDI TOF MS. Using MALDI TOF MS only one significant peak was seen in the 0.5 and 1.0% MGO reaction products, that being the modified MRJP1 major protein at approximately 55.1 kDa. In the 0.1% MGO reaction it was clear from the MALDI-TOF spectra that there was not only the presence of underivatised protein, but also the modified MRJP-1 major protein. This suggested that the level of MGO was not sufficient to complete the reaction with MRJP-1 The shift in the m/z from 52.4 kDa to 55.1 kDa can be accounted for based on the addition of a single MGO unit accounting for an 72.07 Da adduct on Arg to produce methylglyoxal-derived dihydroxyimidazolidine (MG DH), and a mass shift of 70.05 for methylglyoxal-derived hydroimidazolone (MG-HI). Reaction with lysine to form CEL with a mass shift of 72.07 for CEL, N-(carboxymethyl)lysine and 180.25 Da increase for MOLD MOLD, methylglyoxal lysine dimmer. Other arginine modifications and their mass changes are 2-ammonio-6-([2-[(4-ammonio-5-oxido-5-oxopentyl)amino]-4-methyl-4,5-dihydro-1H-imidazol-5-ylidene]amino)hexanoate (MODIC) an increase of 166.23 Da, tetrahydropyrimidine (THP) which has a mass change of 160.18 Da and argpyrimidine with a mass change of 80.09. See Brock et al.Detection and identification of arginine modifications on methylglyoxal-modified ribonuclease by mass spectrometric analysis in J. Mass Spectrom. 2007; 42: 89-100 Published online 4 Dec. 2006 in Wiley InterScience.
Table 3 of the Molecular Weight changes associated with MGO modifications
TABLE-US-00004 Mass MGO modification change MGDH 72.07 MGHI 70.05 CEL 72.07 MOLD 180.25 MODIC 166.23 THP 160.18 argpyrimidine 80.09
[0157] As a number of adducts are possible and the likelihood for each forming varies an average number of 82 was used to determine the relative levels of MGO modification on MRJP1. In the case of 0.1% MGO that resulted in a partially reacted MRJP 1 protein the difference in mass units compared with the unreacted MRJP1 was 1422.0 Da, being approximately 17 MGO adducts formed on the MRJP1. In the case of 0.5% and 1.0% MGO reaction products the differences in mass units can be seen in the Table 4 below. Both 0.5% and 1.0% MGO gave approximately 31-32 MGO adducts being formed on the MRJP1. It is also notable that there are a maximum of 39 sites that MGO can form an adduct on the MRJP1 (excluding Cys residues). There are 22 arginine sites and 17 lysine sites. What the results suggest is that approximately 82% of the possible sites for MGO adduct formation are being modified by MGO. Because both 0.5% and 1.0% MGO reacted substantially equivalently with MRJP1, as represented in
TABLE-US-00005 TABLE 4 MRJP1 MRJP1 MRJP1 MRJP1 and and 0.5% and 1.0% alone 0.1% MGO MGO MGO Difference in Molecular 0 1422.0 2589.8 2605.1 Weight with MGO modification (mass units) Number of MGO 0 17.3 31.6 31.8 modifications based on the addition of an 82 dalton adduct)
[0158] DCFDA ROS Activity Assay
[0159] Cells constantly generate reactive oxygen species (ROS) during aerobic metabolism. The ROS generation plays an important protective and functional role in the immune system. Cells are armed with a powerful antioxidant defense system to combat excessive production of ROS. Oxidative stress occurs in cells when the generation of ROS overwhelms the cells' natural antioxidant defenses. ROS and the oxidative damage are thought to play an important role in many human diseases including cancer, atherosclerosis, other neurodegenerative diseases and diabetes. Thus, establishing their precise role requires the ability to measure ROS accurately and the oxidative damage that they cause. There are many methods for measuring free radical production in cells. ROS production leads essentially to an inflammatory response. The most straightforward techniques use cell permeable fluorescent and chemiluminescent probes. 2-7-Dichlorodihydrofluorescein diacetate (DCFDA) oxidation is one of the most widely used techniques for directly measuring the redox state of a cell. It has several advantages over other techniques developed. It is very easy to use, extremely sensitive to changes in the redox state of a cell, inexpensive and can be used to follow changes in ROS over time. The DCFDA assay for reactive oxygen species ROS production, an indicative measure of an inflammatory response in cells, was developed as an alternative biological activity test to the phagocytosis test described above. The assay was prepared by placing 90 L of phosphate buffered saline (PBS) and 10 L of cells along with the sample of interest into 96 well plate in triplicate followed by the addition of 50 L of DCFDA solution. DCFDA was prepared by dissolving 3 mg in 1 mL of DMSO. Then 100 L of the DMSO solution was mixed with 10 mL of PBS. The oxidation of DCFDA into fluorescein was monitored using fluorescence in a SpectraMax M4 plate reader using Ex 473 nm and Em 520 nm. Assays were monitored at time 0 min, 2 min, 5 min and 10 minutes. An initial assay was performed using kinetic analysis where measurements were made every 10 s for a period of 5 minutes in the presence and absence of cells. The initial plates were used to determine how many cells were needed and what volume of sample to use. The standard error of the mean across the entire 96 well plate was only 5%. By using a multi channel pipette we were able to confidently do an entire plate of analysis within 10 minutes. This rapid turnaround was necessary to analyze the samples generated and undertake assay guided fractionation of the samples in order to attempt to identify the proteins and peptides of interest. Kinetic analysis of the DCFDA assay using 10 L of cells is shown in
[0160] Activation of the ovine spleen cells with LPS and 1 m spheres did not appear to be necessary as the samples were prepared without the use of sterile techniques and used immediately. As shown by
Preparation of Cells for the DCFDA ROS Activity Assay
[0161] Whole fresh spleens were obtained from a local abattoir (Taylor Preston Wellington). Cells were typically obtained within 1 hour of collection but processing of spleen cells after 24 hour of storage at 4 C. was also performed. A spleen was sliced longitudinally with 1 cm gaps between the incisions and then a gel knife was used to scrape the red cell mass out of the spleen. The cells were mixed with 200 mL of PBS and then briefly homogenized with a hand blender to break up the cell mass into individual cells. The mixture was then poured through 4 layers of muslin cloth. The cells were then stored at 4 C. until used.
The Significance of the Lysine Residues
[0162] Acetylation selectively blocks the lysine residues. 1.2814 g of defrosted RJP mixture was dissolved in 50 mL of Tris/HCl (0.1 M, pH 8.5) containing 6 M urea. The solution was cooled down on an ice water bath. Acetic anhydride was added every 20 minutes in aliquots of 0.5 ml over a period of 2 hours. The pH of the solution was determined before every addition and adjusted to a pH above 7.5 using Tris/HCl buffer (1 M, pH 8.5). Then the sample was transferred to a dialysis tubing (molecular weight cut off 10 kDa) and dialysed over night against 1.6 litres of water with three changes of dialysate. The content of the dialysis tubing was frozen and freeze dried. 239.9 mg of a white slightly sticky material was recovered. The acetylated sample was found to no longer have activity in the DCFDA assay after MGO treatment. This indicated that the MGO modification of lysine residues is essential for the functional activity seen by modified MRJP.
[0163] Lys C Digestion:
[0164] a sample of royal jelly was hydrolyzed using the following protocol. 4 g of Lys C was dissolved in 100 L of ammonium carbonate pH 8.4. 10 L of Lys C stock solution was added directly to 100 g of MRJP extract in 100 L. The reaction was performed for 72 hours at room temperature. The sample was then mixed 1:1 with Sinapinic acid solution and 1 L spotted in duplicate on to MALDI TOF 384 well plate. Applied Biosystems Voyager 5800 was used to analyse the peptide to determine the masses and MSMS spectrum. The Lys C extracts from modification using MGO at 0.1, 0.5 and 1.0% were studied by mass spectrometry and the MS plots are shown in
[0165] Trypsin spin column hydrolysis of MRJP1 and MGO modified MRJP1: a sample of royal jelly (10 mg/mL) was subjected to trypsin hydrolysis using Sigma trypsin spin column (TT0010) using manufactures instructions. The hydrolysis was performed for 30 minutes at room temperature with two passes of the MRJP (100 g) in ammonium bicarbonate buffer. MRJP were also reacted with MGO at 0.1, 0.5 and 1.0% concentration overnight at 60 C. The MGO modified MRJP were also subjected to trypsin hydrolysis under identical conditions as that described for the native enzyme. The MGO modified MRJP samples were also tested for their ability to reduce the oxidation rate of DCFDA. The two higher concentrations were shown to be highly active. A lower amount of activity was observed in the 0.1% MGO treated sample.
[0166] The modified MGO (0.1, 0.5 and 1.0%) trypsin digests were studied by mass spectrometry and the MS plots are shown in
[0167] Hydrolysis of MRJP extracts were performed with various enzymes including trypsin and MGO modification of the digests was undertaken. The resulting hydrolyzed extracts were found to have good activity in the DCFDA assay (results not shown).
Modification of Untreated RJP with Alternative Reagents
[0168] A number of other compounds that cross link proteins were also investigated including glyoxal and glutaraldehyde to determine if a similar level of anti phagocytotic activity could be generated using these agents.
[0169] Untreated MRJP was treated with other reagents which are known to cross link peptides and proteins. These included glyoxal, glutaraldehyde and formaldehyde. A solution of glyoxal was made up to a final concentration of 10 mg/mL using PBS. The stock solutions of glutaraldehyde (25%) and formaldehyde (37%) were diluted 2.5 and 3.7 times using PBS, respectively, to give final concentrations of 10%. 500 l of these reagent solutions were added to 4.5 ml RJP solution (10 mg/mL) and incubated at 60 C. overnight.
[0170] RJP was also reacted with glucose and fructose as follows. To 4.5 ml protein solution in PBS (10 mg/mL) 500 L solution of the respective carbohydrate (10 mg/mL) in PBS were added and the mixture was incubated at 60 C. overnight. MRJP was prepared at 10 mg/mL in PBS and modified overnight at 60 C. with the following reagents: 1) glyoxal, 2) glucose (10% 2 mL 10 mg/mL 19.7+1.97), 3) fructose (10% 2 mL 10 mg/mL 24.1+2.41), 4) glutaraldehyde (25% diluted 2.52 mL 800 microL+12 mL of PBS), 5) MGO (40% diluted 42 mL 500 microL+1.5 mL PBS) and untreated Blank. The samples were tested in the DCFDA assay for ROS production and the results shown in
[0171] The MALDI-TOF work described in this section was completed at the University of Victoria Mass Spectrometry Facility, Wellington, New Zealand.
[0172] The present invention and its embodiments have been described in detail. However, the scope of the present invention is not intended to be limited to the particular embodiments of any process, manufacture, composition of matter, compounds, means, methods, and/or steps described in the specification. Various modifications, substitutions, and variations can be made to the disclosed material without departing from the spirit and/or essential characteristics of the present invention. Accordingly, one of ordinary skill in the art will readily appreciate from the disclosure that later modifications, substitutions, and/or variations performing substantially the same function or achieving substantially the same result as embodiments described herein may be utilized according to such related embodiments of the present invention. Thus, the following claims are intended to encompass within their scope modifications, substitutions, and variations to processes, manufactures, compositions of matter, compounds, means, methods, and/or steps disclosed herein.
REFERENCES
[0173] K. Kohno, I. Okamoto, O. Sano, N. Arai, K. Iwaki, M. Ikeda, and M. Kurimoto, Royal Jelly Inhibits the Production of Proinflammatory Cytokines by Activated Macrophages, Biosci. Biotechnol. Biochem., 68 (1), 2004 pp. 138-145. [0174] Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H. Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. Biosci. Biotechnol. Biochem., 64(10) (2000) pp 2109-20. [0175] J. Simuth, K. Bilikova, E. Kovacova, Z. Kuzmova, and W. Schroder, Immunochemical approach to detection of adulteration in honey: physiologically active Royal Jelly protein stimulating TNF-alpha release is a regular component of honey; Journal of Agriculture and Food Chemistry, 52(8), 2004; pp. 2154-8. [0176] B. Lerrer, K. Zinger-Yosovich, B. Avrahami, and N. Gilboa-Garber, Honey and royal jelly, like human milk, abrogate lectin-dependent infection-preceding Pseudomonas aeruginosa adhesion; ISME Journal, 1, 2007; pp. 149-155. [0177] E. Mavric, S. Wittmann, G. Barth, and T. Henle Identification and quantification of methylglyoxal as the dominant antibacterial constituent of Manuka (Leptospermum scoparium) honeys from New Zealand; Mol. Nutr. Food Res. 52, 2008. [0178] Auwerx J. (1991). The human leukemia cell line, THP-1: a multifaceted model for the study of monocyte-macrophage differentiation. Experientia. 47:22-31. [0179] Wan, C. P., C. S. Park, et al. (1993). A rapid and simple microfluorometric phagocytosis assay. Journal of Immunological Methods 162(1): 1-7. [0180] Allen, K. L., P. C. Molan, et al. (1991). A survey of the antibacterial activity of some New Zealand honeys. Journal of Pharmacy and Pharmacology 43(12): 817-22. [0181] White, J. (1975). Honey: a comprehensive survey. London, Heinemann. [0182] Schmitt, A., J. Schmitt, et al. (2005). Characterization of advanced glycation end products for biochemical studies: side chain modifications and fluorescence characteristics. Analytical Biochemistry 338: 201-215. [0183] Jonathan W. C. Brock, 1 William E. Cotham, 1 Suzanne R. Thorpe, 1 John W Baynes1 and Jennifer M. Ames2. (2007). Detection and identification of arginine modifications on methylglyoxal-modified ribonuclease by mass spectrometric analysis. J. Mass Spectrom. 2007; 42: 89-100