AGONIST ANTIBODIES AGAINST ENDOGLIN AND USES THEREOF
20230075244 · 2023-03-09
Inventors
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
International classification
Abstract
Provided are agonist anti-ENG coreceptor-specific antibodies and agonist anti-ENG coreceptor-binding fragments thereof, including antibodies that bind to the BMP9-binding region within an ectodomain of an ENG coreceptor, as well as methods of use employing such antibodies and/or fragments in treating diseases such as HHT and PAH.
Claims
1. An antibody or antigen-binding fragment thereof comprising a heavy chain comprising one or more of: TABLE-US-00024 (SEQ ID NO: 3) GFTFNTYA; (SEQ ID NO: 4) IRSKSSNYAT; (SEQ ID NO: 5) VRDRTGSWFAY; and a light chain comprising one or more of: TABLE-US-00025 (SEQ ID NO: 6) QDIGSS; (SEQ ID NO: 7) ATS; (SEQ ID NO: 8) LQYASSPYT.
2. (canceled)
3. (canceled)
4. The antibody, or antigen-binding fragment thereof, of claim 1, which is agonistic at a human endoglin coreceptor.
5. The antibody, or antigen-binding fragment thereof, of claim 1, wherein the antibody is a monoclonal antibody.
6. (canceled)
7. (canceled)
8. (canceled)
9. (canceled)
10. An ScFv encoded by the nucleotide sequence set forth in one of SEQ ID NOs:13, 14, 15 or 16 or an ScFv comprising SEQ ID NO:17 and SEQ ID NO:18.
11. (canceled)
12. (canceled)
13. (canceled)
14. (canceled)
15. (canceled)
16. (canceled)
17. (canceled)
18. (canceled)
19. (canceled)
20. (canceled)
21. (canceled)
22. The antibody or fragment thereof of claim 1, wherein framework regions of the light chain and/or the heavy chain are human framework regions, or have 85% or more identity thereto.
23. The antibody or fragment thereof of claim 22, wherein framework regions of the light chain and/or the heavy chain are human framework regions.
24. The agonist anti-ENG coreceptor antibody of claim 1.
25. The anti-ENG coreceptor-binding agonist antibody fragment of claim 1.
26. The agonist anti-ENG coreceptor antibody of claim 1, which is an IgM.
27. (canceled)
28. (canceled)
29. (canceled)
30. (canceled)
31. The antibody or antigen-binding fragment thereof of claim 1, which comprises a human sequence Fc region.
32. (canceled)
33. (canceled)
34. (canceled)
35. (canceled)
36. A nucleic acid encoding a heavy chain of an antibody which comprises one or more of: TABLE-US-00026 (SEQ ID NO: 3) GFTFNTYA; (SEQ ID NO: 4) IRSKSSNYAT; (SEQ ID NO: 5) VRDRTGSWFAY; and/or a nucleic acid encoding a light chain of an antibody which comprises one or more of: TABLE-US-00027 (SEQ ID NO: 6) QDIGSS; (SEQ ID NO: 7) ATS; (SEQ ID NO: 8) LQYASSPYT.
37. (canceled)
38. An antibody or fragment thereof according to claim 1, linked or conjugated to a therapeutic agent, an imaging agent or a detectable marker.
39. The antibody or fragment thereof according to claim 38, wherein the therapeutic agent is a cytotoxic drug, a radioactive isotope, an immunomodulator, or a second antibody.
40. (canceled)
41. (canceled)
42. (canceled)
43. A pharmaceutical composition comprising an amount of the antibody or antibody fragment of claim 1 and a pharmaceutically acceptable carrier or excipient.
44. A method of treating hereditary hemorrhagic telangiectasia or preventing one or more symptoms of hereditary hemorrhagic telangiectasia in a subject comprising administering to the subject an amount of an antibody or fragment thereof of claim 1, or a composition comprising such, effective to treat or prevent one or more symptoms of hereditary hemorrhagic telangiectasia.
45. A method of treating pulmonary arterial hypertension or preventing one or more symptoms of pulmonary arterial hypertension in a subject comprising administering to the subject an amount of an antibody or fragment thereof of claim 1, or a composition comprising such, effective to treat or prevent one or more symptoms of pulmonary arterial hypertension.
46. A method of activating activin receptor-like kinase 1 (ALK1) signaling or ALK1-ENG-BMPR2 receptor activation by an ENG co-receptor comprising contacting the ENG co-receptor with an amount of an antibody or fragment thereof of claim 1.
47. A method of effecting phosphorylation of at least one of endothelial SMAD1, SMAD5 and SMAD8 associated with activation of an ENG co-receptor comprising contacting the ENG co-receptor with an amount of an antibody or fragment thereof of claim 1.
48. (canceled)
49. (canceled)
50. (canceled)
51. A method of treating a cancer in a subject comprising administering to the subject an amount of an antibody or fragment thereof of claim 1, or a composition comprising such, effective to treat a cancer in a subject.
52. (canceled)
53. The method of claim 51, wherein the cancer is head and neck squamous cell carcinoma (HNSCC), squamous cancer of the skin, squamous cancer of the lung, or squamous cancer of the esophagus.
54-61. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029] Those of skill in the art will understand that the drawings, described below, are for illustrative purposes only. The drawings are not intended to limit the scope of the present teachings in any way.
[0030]
[0031]
[0032]
DETAILED DESCRIPTION OF THE INVENTION
[0033] An isolated agonist anti-endoglin (ENG) coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof.
[0034] In embodiments, the antibody or antibody fragment of the invention comprises one, two, or all three of the following heavy chain CDRs:
TABLE-US-00007 (SEQ ID NO:3) GFTFNTYA; (SEQ ID NO:4) IRSKSSNYAT; (SEQ ID NO:5) VRDRTGSWFAY.
[0035] In embodiments, the antibody or antibody fragment of the invention comprises one, two, or all three of the following light chain CDRs:
TABLE-US-00008 (SEQ ID NO:6) QDIGSS; (SEQ ID NO:7) ATS; (SEQ ID NO:8) LQYASSPYT.
[0036] In embodiments, the antibody or antibody fragment of the invention comprises the following VH amino acid sequence: EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMHWVRQAPGKGLEWVARIRSKSSN YATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRDRTGSWFAYWGQ GTLVTVSA (SEQ ID NO:17).
[0037] In embodiments, the antibody or antibody fragment of the invention comprises the following VH amino acid sequence: MVLGLKWVFFVVFYQGVHCEVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMHWV RQAPGKGLEWVARIRSKSSNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTA MYYCVRDRTGSWFAYWGQGTLVTVSAESQSFPNVFPLVSCESPLSDKNLVAMGCLAR DFLPSTISFTWNYQNNTEVIQSIRTFPTLRTGGKYLATSQVLLSPKSI (SEQ ID NO:9).
[0038] In embodiments, the antibody or antibody fragment of the invention comprises a VH sequence encoded by the following nucleotide sequence:
TABLE-US-00009 (SEQ ID NO: 10) ATGGTGTTGGGGCTTAAGTGGGTTTTCTTTGTTGTTTTTTATCAAGGTG TGCATTGTGAGGTGCAGCTTGTTGAGTCTGGTGGAGGATTGGTGCAGCC TAAAGGATCATTGAAACTCTCATGTGCCGCCTCTGGTTTCACCTTCAAT ACCTATGCCATGCACTGGGTCCGCCAGGCTCCAGGAAAGGGTTTGGAAT GGGTTGCTCGCATAAGAAGTAAAAGTAGTAATTATGCAACATATTATGC CGATTCAGTGAAAGACAGATTCACCATCTCCAGAGATGATTCACAAAGC ATGCTCTATCTGCAAATGAACAACCTGAAAACTGAGGACACAGCCATGT ATTACTGTGTGAGAGATAGAACTGGGTCCTGGTTTGCTTACTGGGGCCA AGGGACTCTGGTCACTGTCTCTGCAGAGAGTCAGTCCTTCCCAAATGTC TTCCCCCTCGTCTCCTGCGAGAGCCCCCTGTCTGATAAGAATCTGGTGG CCATGGGCTGCCTGGCCCGGGACTTCCTGCCCAGCACCATTTCCTTCAC CTGGAACTACCAGAACAACACTGAAGTCATCCAGAGTATCAGAACCTTC CCAACACTGAGGACAGGGGGCAAGTACCTAGCCACCTCGCAGGTCTTGC TGTCTCCCAAGAGCATC.
[0039] In embodiments, the antibody or antibody fragment of the invention comprises the following VL amino acid sequence:
TABLE-US-00010 (SEQ ID NO: 18) DIQMTQSPSSLSASLGERVSLTCRASQDIGSSLNWLQQEPDGTIKRLIY ATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYASSPYTF GGGTKLEIK.
[0040] In embodiments, the antibody or antibody fragment of the invention comprises the following VL amino acid sequence:
TABLE-US-00011 (SEQ ID NO: 11) MRAPAQIFGFLLLLFPGTRCDIQMTQSPSSLSASLGERVSLTCRASQDI GSSLNWLQQEPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSL ESEDFVDYYCLQYASSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTS GGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS STLTLTK.
[0041] In embodiments, the antibody or antibody fragment of the invention comprises a VL sequence encoded by the following nucleotide sequence:
TABLE-US-00012 (SEQ ID NO: 12) ATGAGGGCTCCTGCACAAATTTTTGGCTTCTTGTTGCTCTTGTTTCCAG GTACCAGATGTGACATCCAGATGACCCAGTCTCCATCCTCCTTATCTGC CTCTCTGGGAGAAAGAGTCAGTCTCACTTGTCGGGCAAGTCAGGACATT GGTAGTAGCTTAAACTGGCTTCAGCAGGAACCAGATGGAACTATTAAAC GCCTGATCTACGCCACATCCAGTTTAGATTCTGGTGTCCCCAAAAGGTT CAGTGGCAGTAGGTCTGGGTCAGATTATTCTCTCACCATCAGCAGCCTT GAGTCTGAAGATTTTGTAGACTATTACTGTCTACAATATGCTAGTTCTC CGTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAACGGGCTGATGC TGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCT GGAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACA TCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGCGTCCT GAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGC AGCACCCTCACGTTGACCAAG.
[0042] In embodiments, an ScFv is provided which has agonist activity at an endoglin coreceptor.
[0043] In embodiments, the ScFv is one of the following, wherein the encoding nucleotide sequences are set forth hereinbelow:
LH15: VL-15aa-VH-Fc;
HL15: VH-15aa-VL-Fc;
LH20: VL-20aa-VH-Fc;
HL20: VH-20aa-VL-Fc.
[0044] ScFv HL15
TABLE-US-00013 (SEQ ID NO: 13) GATCACCGGCGAAGGAGGGCCACCATGGACCCCAAGGGCAGCCTGAGCTGGAGAA TCCTGCTGTTCCTGAGCCTGGCCTTCGAGCTGAGCTACGGCGAGGTGCAGCTTGTT GAGTCTGGTGGAGGATTGGTGCAGCCTAAAGGATCATTGAAACTCTCATGTGCCGC CTCTGGTTTCACCTTCAATACCTATGCCATGCACTGGGTCCGCCAGGCTCCAGGAA AGGGTTTGGAATGGGTTGCTCGCATAAGAAGTAAAAGTAGTAATTATGCAACATAT TATGCCGATTCAGTGAAAGACAGATTCACCATCTCCAGAGATGATTCACAAAGCAT GCTCTATCTGCAAATGAACAACCTGAAAACTGAGGACACAGCCATGTATTACTGTG TGAGAGATAGAACTGGGTCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACT GTCTCTGCAGGAGGTGGCGGATCAGGTGGCGGAGGTTCTGGCGGTGGCGGTTCTG ACATCCAGATGACCCAGTCTCCATCCTCCTTATCTGCCTCTCTGGGAGAAAGAGTC AGTCTCACTTGTCGGGCAAGTCAGGACATTGGTAGTAGCTTAAACTGGCTTCAGCA GGAACCAGATGGAACTATTAAACGCCTGATCTACGCCACATCCAGTTTAGATTCTG GTGTCCCCAAAAGGTTCAGTGGCAGTAGGTCTGGGTCAGATTATTCTCTCACCATC AGCAGCCTTGAGTCTGAAGATTTTGTAGACTATTACTGTCTACAATATGCTAGTTCT CCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAAGACAAGACCCACACCT GCCCTCCCTGCCCCGCCCCCGAGCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCTC CCAAGCCCAAGGACACCCTGATGATCAGCCGCACCCCCGAGGTGACCTGCGTGGT GGTGGACGTGAGCCACGAGGACCCCGAGGTGAAGTTCAACTGGTACGTGGACGGC GTGGAGGTGCACAACGCCAAGACCAAGCCTCGGGAGGAGCAGTACAACTCCACCT ACCGCGTGGTGAGCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGA GTACAAGTGCAAGGTGAGCAACAAGGCCCTGCCCGCTCCCATCGAGAAGACCATC AGCAAGGCCAAGGGCCAGCCCCGGGAGCCTCAGGTGTACACCCTGCCCCCCAGCC GCGACGAGCTGACCAAGAACCAGGTGAGCCTGACCTGCCTGGTGAAGGGCTTCTA CCCCTCCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCTGAGAACAACTAC AAGACCACCCCTCCCGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCT GACCGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATG CACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGAGCCCCGGAT AGTGATCCCAGTGTCCCTAGCTGGCCAGA.
[0045] ScFv LH15
TABLE-US-00014 (SEQ ID NO: 14) GATCACCGGCGAAGGAGGGCCACCATGGACCCCAAGGGCAGCCTGAGCTGGAGAA TCCTGCTGTTCCTGAGCCTGGCCTTCGAGCTGAGCTACGGCGACATCCAGATGACC CAGTCTCCATCCTCCTTATCTGCCTCTCTGGGAGAAAGAGTCAGTCTCACTTGTCGG GCAAGTCAGGACATTGGTAGTAGCTTAAACTGGCTTCAGCAGGAACCAGATGGAA CTATTAAACGCCTGATCTACGCCACATCCAGTTTAGATTCTGGTGTCCCCAAAAGG TTCAGTGGCAGTAGGTCTGGGTCAGATTATTCTCTCACCATCAGCAGCCTTGAGTCT GAAGATTTTGTAGACTATTACTGTCTACAATATGCTAGTTCTCCGTACACGTTCGGA GGGGGGACCAAGCTGGAAATAAAAGGAGGTGGCGGATCAGGTGGCGGAGGTTCT GGCGGTGGCGGTTCTGAGGTGCAGCTTGTTGAGTCTGGTGGAGGATTGGTGCAGCC TAAAGGATCATTGAAACTCTCATGTGCCGCCTCTGGTTTCACCTTCAATACCTATGC CATGCACTGGGTCCGCCAGGCTCCAGGAAAGGGTTTGGAATGGGTTGCTCGCATAA GAAGTAAAAGTAGTAATTATGCAACATATTATGCCGATTCAGTGAAAGACAGATTC ACCATCTCCAGAGATGATTCACAAAGCATGCTCTATCTGCAAATGAACAACCTGAA AACTGAGGACACAGCCATGTATTACTGTGTGAGAGATAGAACTGGGTCCTGGTTTG CTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAGACAAGACCCACACCTGC CCTCCCTGCCCCGCCCCCGAGCTGCTGGGCGGACCCAGCGTGTTCCTGTTCCCTCCC AAGCCCAAGGACACCCTGATGATCAGCCGCACCCCCGAGGTGACCTGCGTGGTGG TGGACGTGAGCCACGAGGACCCCGAGGTGAAGTTCAACTGGTACGTGGACGGCGT GGAGGTGCACAACGCCAAGACCAAGCCTCGGGAGGAGCAGTACAACTCCACCTAC CGCGTGGTGAGCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAGT ACAAGTGCAAGGTGAGCAACAAGGCCCTGCCCGCTCCCATCGAGAAGACCATCAG CAAGGCCAAGGGCCAGCCCCGGGAGCCTCAGGTGTACACCCTGCCCCCCAGCCGC GACGAGCTGACCAAGAACCAGGTGAGCCTGACCTGCCTGGTGAAGGGCTTCTACC CCTCCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCTGAGAACAACTACAA GACCACCCCTCCCGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTGA CCGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCAGCTGCAGCGTGATGCA CGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGAGCCCCGGATAG TGATCCCAGTGTCCCTAGCTGGCCAGA.
[0046] ScFv HL20
TABLE-US-00015 (SEQ ID NO: 15) GATCACCGGCGAAGGAGGGCCACCATGGACCCCAAGGGCAGCCTGAGCTGGAGAA TCCTGCTGTTCCTGAGCCTGGCCTTCGAGCTGAGCTACGGCGAGGTGCAGCTTGTT GAGTCTGGTGGAGGATTGGTGCAGCCTAAAGGATCATTGAAACTCTCATGTGCCGC CTCTGGTTTCACCTTCAATACCTATGCCATGCACTGGGTCCGCCAGGCTCCAGGAA AGGGTTTGGAATGGGTTGCTCGCATAAGAAGTAAAAGTAGTAATTATGCAACATAT TATGCCGATTCAGTGAAAGACAGATTCACCATCTCCAGAGATGATTCACAAAGCAT GCTCTATCTGCAAATGAACAACCTGAAAACTGAGGACACAGCCATGTATTACTGTG TGAGAGATAGAACTGGGTCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACT GTCTCTGCAGGCTCTACAGGAGGTGGCGGATCAGGTAAACCTGGTTCTGGCGAAG GAGGTGGCGGTTCAGACATCCAGATGACCCAGTCTCCATCCTCCTTATCTGCCTCTC TGGGAGAAAGAGTCAGTCTCACTTGTCGGGCAAGTCAGGACATTGGTAGTAGCTTA AACTGGCTTCAGCAGGAACCAGATGGAACTATTAAACGCCTGATCTACGCCACATC CAGTTTAGATTCTGGTGTCCCCAAAAGGTTCAGTGGCAGTAGGTCTGGGTCAGATT ATTCTCTCACCATCAGCAGCCTTGAGTCTGAAGATTTTGTAGACTATTACTGTCTAC AATATGCTAGTTCTCCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAAGA CAAGACCCACACCTGCCCTCCCTGCCCCGCCCCCGAGCTGCTGGGCGGACCCAGCG TGTTCCTGTTCCCTCCCAAGCCCAAGGACACCCTGATGATCAGCCGCACCCCCGAG GTGACCTGCGTGGTGGTGGACGTGAGCCACGAGGACCCCGAGGTGAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCTCGGGAGGAGCA GTACAACTCCACCTACCGCGTGGTGAGCGTGCTGACCGTGCTGCACCAGGACTGGC TGAACGGCAAGGAGTACAAGTGCAAGGTGAGCAACAAGGCCCTGCCCGCTCCCAT CGAGAAGACCATCAGCAAGGCCAAGGGCCAGCCCCGGGAGCCTCAGGTGTACACC CTGCCCCCCAGCCGCGACGAGCTGACCAAGAACCAGGTGAGCCTGACCTGCCTGG TGAAGGGCTTCTACCCCTCCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCC TGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACAGCGATGGCAGCTTCTTCC TGTACAGCAAGCTGACCGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCAG CTGCAGCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGC CTGAGCCCCGGATAGTGATCCCAGTGTCCCTAGCTGGCCAGA.
[0047] ScFv LH20
TABLE-US-00016 (SEQ ID NO: 16) GATCACCGGCGAAGGAGGGCCACCATGGACCCCAAGGGCAGCCTGAGCTGGAGAA TCCTGCTGTTCCTGAGCCTGGCCTTCGAGCTGAGCTACGGCGACATCCAGATGACC CAGTCTCCATCCTCCTTATCTGCCTCTCTGGGAGAAAGAGTCAGTCTCACTTGTCGG GCAAGTCAGGACATTGGTAGTAGCTTAAACTGGCTTCAGCAGGAACCAGATGGAA CTATTAAACGCCTGATCTACGCCACATCCAGTTTAGATTCTGGTGTCCCCAAAAGG TTCAGTGGCAGTAGGTCTGGGTCAGATTATTCTCTCACCATCAGCAGCCTTGAGTCT GAAGATTTTGTAGACTATTACTGTCTACAATATGCTAGTTCTCCGTACACGTTCGGA GGGGGGACCAAGCTGGAAATAAAAGGCTCTACAGGAGGTGGCGGATCAGGTAAA CCTGGTTCTGGCGAAGGAGGTGGCGGTTCAGAGGTGCAGCTTGTTGAGTCTGGTGG AGGATTGGTGCAGCCTAAAGGATCATTGAAACTCTCATGTGCCGCCTCTGGTTTCA CCTTCAATACCTATGCCATGCACTGGGTCCGCCAGGCTCCAGGAAAGGGTTTGGAA TGGGTTGCTCGCATAAGAAGTAAAAGTAGTAATTATGCAACATATTATGCCGATTC AGTGAAAGACAGATTCACCATCTCCAGAGATGATTCACAAAGCATGCTCTATCTGC AAATGAACAACCTGAAAACTGAGGACACAGCCATGTATTACTGTGTGAGAGATAG AACTGGGTCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAG ACAAGACCCACACCTGCCCTCCCTGCCCCGCCCCCGAGCTGCTGGGCGGACCCAGC GTGTTCCTGTTCCCTCCCAAGCCCAAGGACACCCTGATGATCAGCCGCACCCCCGA GGTGACCTGCGTGGTGGTGGACGTGAGCCACGAGGACCCCGAGGTGAAGTTCAAC TGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCTCGGGAGGAGC AGTACAACTCCACCTACCGCGTGGTGAGCGTGCTGACCGTGCTGCACCAGGACTGG CTGAACGGCAAGGAGTACAAGTGCAAGGTGAGCAACAAGGCCCTGCCCGCTCCCA TCGAGAAGACCATCAGCAAGGCCAAGGGCCAGCCCCGGGAGCCTCAGGTGTACAC CCTGCCCCCCAGCCGCGACGAGCTGACCAAGAACCAGGTGAGCCTGACCTGCCTG GTGAAGGGCTTCTACCCCTCCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGC CTGAGAACAACTACAAGACCACCCCTCCCGTGCTGGACAGCGATGGCAGCTTCTTC CTGTACAGCAAGCTGACCGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCA GCTGCAGCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAG CCTGAGCCCCGGATAGTGATCCCAGTGTCCCTAGCTGGCCAGA.
[0048] In embodiments, the ScFv sequences SEQ ID NOS:13-16 herein include: signal peptide sequence, variable region sequence of light chain, variable region sequence of heavy chain, linker sequence, Fc region sequence of human IgG1, and vector sequence.
[0049] In embodiments, the ScFv comprises SEQ ID NO:17 and SEQ ID NO:18. In embodiments, the ScFv is an agonist at an ENG coreceptor and comprises at least one of SEQ ID NO:17 and SEQ ID NO:18. In embodiments, the ScFv is an agonist at an ENG coreceptor and comprises SEQ ID NOS:3-5 and 6-8.
[0050] An antibody or antigen-binding fragment thereof comprising
a heavy chain comprising one or more of:
TABLE-US-00017 (SEQ ID NO: 3) GFTFNTYA; (SEQ ID NO: 4) IRSKSSNYAT; (SEQ ID NO: 5) VRDRTGSWFAY;
and a light chain comprising one or more of:
TABLE-US-00018 (SEQ ID NO: 6) QDIGSS; (SEQ ID NO: 7) ATS; (SEQ ID NO: 8) LQYASSPYT.
[0051] An antibody or antigen-binding fragment thereof which binds to an endoglin (ENG) coreceptor and comprises:
a heavy chain comprising each of the following CDRs:
TABLE-US-00019 (SEQ ID NO: 3) GFTFNTYA; (SEQ ID NO: 4) IRSKSSNYAT; (SEQ ID NO: 5) VRDRTGSWFAY;
and a light chain comprising one or more of the following CDRs:
TABLE-US-00020 (SEQ ID NO: 6) QDIGSS; (SEQ ID NO: 7) ATS; (SEQ ID NO: 8) LQYASSPYT.
[0052] An antibody or antigen-binding fragment thereof which binds to a human endoglin coreceptor.
[0053] In embodiments, the antibody or antigen-binding fragment thereof is agonistic at an endoglin (ENG) coreceptor.
[0054] In embodiments, the antibody is a monoclonal antibody.
[0055] An antibody or antigen-binding fragment thereof which binds to and is agonistic at an endoglin coreceptor and comprises a heavy chain encoded by SEQ ID NO:10.
[0056] An antibody or antigen-binding fragment thereof which binds to and is agonistic at an endoglin coreceptor and comprises a heavy chain having SEQ ID NO:17.
[0057] An antibody or antigen-binding fragment thereof which binds to and is agonistic at an endoglin coreceptor and comprises a light chain encoded by SEQ ID NO:12.
[0058] An antibody or antigen-binding fragment thereof which binds to and is agonistic at an endoglin coreceptor and comprises a light chain having SEQ ID NO:18.
[0059] An ScFv encoded by the nucleotide sequence set forth in one of SEQ ID NOs:13, 14, 15 or 16. An ScFv comprising SEQ ID NO:17 and SEQ ID NO:18. In embodiments, the ScFv binds to and is agonistic at an endoglin coreceptor.
[0060] An isolated agonist endoglin coreceptor antibody or antibody fragment that: specifically binds to the epitope set forth in SEQ ID NO:1 or SEQ ID NO:2, the antibody or antibody fragment comprising a heavy chain variable region comprising the CDR sequences set forth in SEQ ID NOs:3-5; and/or a light chain variable region comprising the CDR sequences set forth in SEQ ID NOs:6-8; or
cross-competes for specific binding with a reference antibody to the epitope set forth in SEQ ID NO:1 or SEQ ID NO:2, the reference antibody comprising a heavy chain variable region comprising the CDR sequences set forth in SEQ ID NOs:3-5; and/or a light chain variable region comprising the CDR sequences set forth in SEQ ID NOs:6-8.
[0061] In embodiments, the antibody or antigen-binding fragment thereof is agonistic when bound to an endoglin coreceptor.
[0062] In embodiments, the antibody or antigen-binding fragment thereof effectuates endothelial SMAD1/SMAD5/SMAD8 signaling when bound to an ENG co-receptor.
[0063] In embodiments, the antibody or antigen-binding fragment thereof phosphorylates at least one of endothelial SMAD1, SMAD5 and SMAD8 when bound to an ENG co-receptor.
[0064] In embodiments, the antibody or antigen-binding fragment thereof phosphorylates all of endothelial SMAD1, SMAD5 and SMAD8 when bound to an ENG co-receptor.
[0065] In embodiments, the antibody or antigen-binding fragment thereof activates activin receptor-like kinase 1 (ALK1) signaling or ALK1-ENG-BMPR2 receptor activation when bound to an ENG co-receptor.
[0066] In embodiments, the antibody or antigen-binding fragment thereof activates Notch signaling when bound to an ENG co-receptor.
[0067] In embodiments, the antibody or antigen-binding fragment thereof activates Notch signaling via an endoglin/ALK1 receptor complex.
[0068] In embodiments, the antibody or antigen-binding fragment thereof increases Notch ligand D114 levels in a cell and/or elicits generation of Notch activated fragment NICD.
[0069] In embodiments, the antibody or antigen-binding fragment thereof comprises framework regions of the light chain and/or the heavy chain which are human framework regions, or have 85% or more identity thereto. In embodiments, the antibody or antigen-binding fragment thereof comprises framework regions of the light chain and/or the heavy chain which have 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% or more identity thereto.
[0070] In embodiments, the antibody or antigen-binding fragment thereof comprise framework regions of the light chain and/or the heavy chain which are human framework regions.
[0071] In embodiments, the antibody disclosed herein is provided. In embodiments, the antigen-binding fragment of the antibody disclosed herein is provided.
[0072] In embodiments, the antibody disclosed herein is an IgM.
[0073] In embodiments, the antibody or antigen-binding fragment thereof binds a BMP9-binding region within an ectodomain of the ENG coreceptor.
[0074] In embodiments, the antibody or antigen-binding fragment thereof binds an epitope comprising SEQ ID NO:1 or SEQ ID NO:2 of the ENG coreceptor.
[0075] In embodiments, the antibody or antigen-binding fragment thereof binds to an ENG coreceptor, or a BMP9-binding region within an ectodomain of an ENG coreceptor, with an affinity of 1.5 nM K.sub.D or stronger.
[0076] In embodiments, the antibody or antigen-binding fragment thereof binds to an ENG coreceptor, or a BMP9-binding region within an ectodomain of an ENG coreceptor, with an affinity of 0.75 nM K.sub.D or stronger.
[0077] In embodiments, the antibody or antigen-binding fragment thereof comprises a human sequence Fc region.
[0078] In embodiments, the antibody or antigen-binding fragment thereof is chimeric or humanized.
[0079] In embodiments, the antibody or antigen-binding fragment thereof is selected from the group consisting of a monoclonal antibody, an Fab fragment, an Fab′ fragment, an F(ab)′ fragment and a bispecific antibody. In embodiments, the antigen-binding fragment thereof is a fusion protein. In embodiments, the antigen-binding fragment thereof is a fusion protein and is an ScFv.
[0080] In embodiments, the antibody or antigen-binding fragment thereof is linked or conjugated to a therapeutic agent, an imaging agent or a detectable marker. In embodiments, the therapeutic agent is a cytotoxic drug, a radioactive isotope, an immunomodulator, or a second antibody.
[0081] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof, effectuates endothelial SMAD1/SMAD5/SMAD8 signaling when bound to an ENG co-receptor.
[0082] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof, phosphorylates at least one of endothelial SMAD1, SMAD5 and SMAD8 when bound to an ENG co-receptor.
[0083] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof, phosphorylates all of endothelial SMAD1, SMAD5 and SMAD8 when bound to an ENG co-receptor.
[0084] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof, activates activin receptor-like kinase 1 (ALK1) signaling or ALK1-ENG-BMPR2 receptor activation when bound to an ENG co-receptor.
[0085] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof comprises framework regions of the light chain and/or the heavy chain which are human framework regions, or have 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% or more identity thereto.
[0086] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof comprises framework regions of the light chain and/or the heavy chain which are human framework regions.
[0087] In embodiments, the isolated agonist anti-ENG coreceptor antibody is claimed. In embodiments, the anti-ENG coreceptor-binding agonist antibody fragment thereof is claimed.
[0088] In embodiments, the isolated agonist anti-ENG coreceptor antibody is an IgM, or the anti-ENG coreceptor-binding agonist antibody fragment thereof is a fragment of an IgM.
[0089] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof, binds a bone morphogenic protein 9 (BMP9)-binding region within an ectodomain of the ENG coreceptor.
[0090] In embodiments, the isolated agonist anti-ENG coreceptor antibody, or anti-ENG coreceptor-binding agonist antibody fragment thereof, binds an epitope comprising SEQ ID NO:1 or SEQ ID NO:2 of the ENG coreceptor.
[0091] In embodiments, the epitope comprises TTGEYSFKIFP (SEQ ID NO:1). In embodiments, the epitope TTGEYSVKIFP (SEQ ID NO:2).
[0092] In embodiments, the ENG coreceptor is a human ENG coreceptor. In embodiments, the BMP9 is a human BMP9.
[0093] In embodiments, the antibody comprises framework regions, and the framework regions of the light chain and the heavy chain are human framework regions, or have 85% or more identity thereto. In embodiments, framework regions of the light chain and the heavy chain are human framework regions. In embodiments, the antibody, isolated antibody or antigen-binding fragment thereof is chimeric or humanized.
[0094] In embodiments, the antibody, isolated antibody or antigen-binding fragment thereof is selected from the group consisting of a monoclonal antibody, an Fab fragment, an Fab′ fragment, and an F(ab)′ fragment.
[0095] In embodiments, the antibody or fragment thereof is selected from the group consisting of a monoclonal antibody, an scFv, an Fab fragment, an Fab′ fragment, and an F(ab)′ fragment.
[0096] In embodiments, the agonist anti-ENG coreceptor antibody or ENG coreceptor-binding agonist fragment thereof (i.e., an antigen-binding fragment thereof), comprises (i) a VH framework comprising the framework sequence of human germline IGHV1-2*02, IGHV1-2*03, IGHV1-2*04, IGHV1-2*05, IGHV1-2*06, IGHV1-18*04, IGHV1-69-2*01, IGHV1-46*01, IGHV7-4-1*01, IGHV7-4-1*02, IGHV7-4-1*01, IGHV7-81*01, IGHD2-8*02, IGHD3-10*01, IGHD3-10*02, IGHD3-22*01, IGHD5-18*01, IGHD5-5*01, IGHD5-12*01, IGHD5-24*01, IGHD6-25*01, IGHJ3*01, IGHJ4*01, IGHJ4*02, IGHJ4*03, IGHJ6*01, IGHJ6*02 and/or (ii) a VL framework comprising the framework sequence of human germline IGKV1-17*01, IGKV1-6*01, IGKV1-6*02, IGKV1-13*02, IGKV1-27*01, IGKV1-33*01, IGKV3-7*02, IGKV4-1*01, IGKV1D-13*02, IGKV1D-33*01, IGKV3D-7*01, IGKJ1*01, IGKJ2*01, IGKJ3*01, IGKJ4*01, IGKJ4*02.
[0097] In embodiments, the agonist anti-ENG coreceptor antibody or ENG coreceptor-binding agonist fragment thereof, binds ENG coreceptor with a binding affinity (K.sub.D) of from about 1×10.sup.−9M to about 1×10.sup.−12 M.
[0098] An isolated antibody or antigen-binding fragment thereof which binds to an ENG coreceptor, or a bone morphogenic protein 9 (BMP9)-binding region within an ectodomain of an ENG coreceptor, with an affinity of 1.5 nM K.sub.D or stronger.
[0099] In embodiments, the isolated antibody or antigen-binding fragment thereof binds to an ENG coreceptor, or a BMP9-binding region within an ectodomain of an ENG coreceptor, with an affinity of 0.75 nM K.sub.D or stronger.
[0100] In embodiments, the isolated antibody or antigen-binding fragment thereof comprises a human sequence Fc region.
[0101] In embodiments, the isolated antibody or antigen-binding fragment thereof is chimeric or humanized.
[0102] In embodiments, the isolated antibody or antigen-binding fragment thereof is selected from the group consisting of a monoclonal antibody, an scFv, an Fab fragment, an Fab′ fragment, an F(ab)′ fragment and a bispecific antibody.
[0103] A nucleic acid encoding a heavy chain of an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein. A nucleic acid encoding a light chain of an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein. In an embodiment, the nucleic acid is a DNA. In an embodiment, the nucleic acid is a cDNA. In an embodiment, the nucleic acid is an RNA.
[0104] A nucleic acid encoding a heavy chain of an antibody which comprises one or more of:
TABLE-US-00021 (SEQ ID NO: 3) GFTFNTYA; (SEQ ID NO: 4) IRSKSSNYAT; (SEQ ID NO: 5) VRDRTGSWFAY;
[0105] A nucleic acid encoding a light chain of an antibody which comprises one or more of:
TABLE-US-00022 (SEQ ID NO: 6) QDIGSS; (SEQ ID NO: 7) ATS; (SEQ ID NO: 8) LQYASSPYT.
[0106] A vector encoding the nucleic acid molecule described herein is provided.
[0107] A host cell comprising the nucleic acid molecule described herein, or the vector described herein, is provided.
[0108] A hybridoma which produces an agonist anti-ENG coreceptor monoclonal antibody of the invention, which antibody is described herein, is also provided.
[0109] An agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein, linked or conjugated to a therapeutic agent, an imaging agent or a detectable marker. In embodiments, the therapeutic agent is a cytotoxic drug, a radioactive isotope, an immunomodulator, or a second antibody.
[0110] A method of producing the antibody or fragment thereof of the invention, comprising culturing the host cell described herein, under conditions wherein the agonist anti-ENG coreceptor antibody, or fragment thereof, is produced by the host cell.
[0111] A method of detecting an ENG coreceptor-positive cell in a subject or a sample comprising administering to the subject, or contacting the sample with, an amount of an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein having a detectable marker conjugated thereto, in an amount effective to label an ENG coreceptor-positive cell and then detecting the presence of and/or quantifying the level of the label in the subject, thereby detecting an ENG coreceptor-positive cell in the subject or the sample.
[0112] In embodiments, the label is detected by imaging. In embodiments, the cell is an endothelial cell.
[0113] A pharmaceutical composition comprising an amount of the isolated agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein and a pharmaceutically acceptable carrier or excipient.
[0114] A method of detecting an ENG coreceptor-positive cell in a subject or a sample comprising administering to the subject, or contacting the sample with, an amount of an antibody or ENG coreceptor binding fragment thereof as provided herein, having a detectable marker conjugated thereto, in an amount effective to label an ENG coreceptor-positive cell and then detecting the presence of and/or quantifying the level of the label in the subject, thereby detecting an ENG coreceptor-positive cell in the subject or the sample.
[0115] In embodiments, the label is detected by imaging. In embodiments, the cell is an endothelial cell.
[0116] In embodiments, the antibody or antigen-binding fragment thereof is synthetically made by, e.g., a hybridoma or recombinant means.
[0117] A pharmaceutical composition comprising an amount of an antibody or ENG coreceptor-binding fragment thereof as provided herein, and a pharmaceutically acceptable carrier or excipient.
[0118] A method of treating hereditary hemorrhagic telangiectasia or preventing one or more symptoms of hereditary hemorrhagic telangiectasia in a subject comprising administering to the subject an amount of an antibody or ENG coreceptor binding-fragment thereof as provided herein, or a composition comprising such, effective to treat or prevent one or more symptoms of hereditary hemorrhagic telangiectasia.
[0119] A method of treating pulmonary arterial hypertension or preventing one or more symptoms of pulmonary arterial hypertension in a subject comprising administering to the subject an amount of an antibody or ENG coreceptor binding-fragment thereof as provided herein, or a composition comprising such, effective to treat or prevent one or more symptoms of pulmonary arterial hypertension.
[0120] A method of activating activin receptor-like kinase 1 (ALK1) signaling or ALK1-ENG-BMPR2 receptor activation by an ENG co-receptor comprising contacting the ENG co-receptor with an amount of an antibody or ENG coreceptor binding fragment thereof as provided herein.
[0121] A method of effecting phosphorylation of at least one of endothelial SMAD1, SMAD5 and SMAD8 associated with activation of an ENG co-receptor comprising contacting the ENG co-receptor with an amount of an antibody or ENG coreceptor-binding fragment thereof as provided herein.
[0122] In embodiments, the method is used to prevent or treat a disease or disorder that is associated with reduced phosphorylation of endothelial SMAD1, SMAD5 and/or SMAD8 in a subject.
[0123] In embodiments, the disease or disorder is hereditary hemorrhagic telangiectasia.
[0124] In embodiments, the disease or disorder is pulmonary arterial hypertension.
[0125] A method of treating a cancer in a subject comprising administering to the subject an amount of an antibody or ENG coreceptor-binding fragment thereof as provided herein, or a composition comprising such, effective to treat a cancer in a subject.
[0126] In embodiment, the cancer is associated with Notch loss-of-function.
[0127] In embodiments, the cancer is head and neck squamous cell carcinoma (HNSCC), squamous cancer of the skin, squamous cancer of the lung, or squamous cancer of the esophagus.
[0128] In embodiments, the cancer is squamous cancer of the lung.
[0129] In embodiments of the methods, the subject is a mammal.
[0130] In embodiments of the methods, the mammal is a human.
[0131] A method of treating hereditary hemorrhagic telangiectasia or preventing one or more symptoms of hereditary hemorrhagic telangiectasia in a subject comprising administering to the subject an amount of an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein, or a composition comprising such, effective to treat or prevent one or more symptoms of hereditary hemorrhagic telangiectasia.
[0132] In embodiments, the method is to treat or prevent a symptom of HHT1. In embodiments, the method is to treat or prevent a symptom of HHT2. In embodiments, the method is to treat the hereditary hemorrhagic telangiectasia. In embodiments, the method is to prevent one or more symptoms of the hereditary hemorrhagic telangiectasia.
[0133] A method of treating pulmonary arterial hypertension or preventing one or more symptoms of pulmonary arterial hypertension in a subject comprising administering to the subject an amount of an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein, or a composition comprising such, effective to treat or prevent one or more symptoms of pulmonary arterial hypertension (PAH).
[0134] In embodiments, the method is to treat the pulmonary arterial hypertension. In embodiments, the method is to prevent one or more symptoms of the pulmonary arterial hypertension. In embodiments, the pulmonary arterial hypertension is familial pulmonary arterial hypertension.
[0135] A method of activating activin receptor-like kinase 1 (ALK1) signaling or ALK1-ENG-BMPR2 receptor activation by an ENG co-receptor comprising contacting the ENG co-receptor with an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein.
[0136] A method of effecting phosphorylation of at least one of endothelial SMAD1, SMAD5 and SMAD8 associated with activation of an ENG co-receptor comprising contacting the ENG co-receptor with an amount of an agonist anti-endoglin (ENG) coreceptor antibody or fragment thereof described herein.
[0137] In embodiments, the method is used to prevent or treat a disease or disorder that is associated with reduced phosphorylation of endothelial SMAD1, SMAD5 and/or SMAD8 in a subject.
[0138] In embodiments, the disease or disorder is hereditary hemorrhagic telangiectasia.
[0139] In embodiments, the disease or disorder is pulmonary arterial hypertension.
[0140] A method of activating a Notch signaling pathway in a subject comprising administering to the subject an amount of an agonist anti-ENG coreceptor antibody or ENG coreceptor-binding fragment thereof, or a composition comprising such, effective to activate a Notch signaling pathway in a subject. In embodiments, the method effects an increase of a cellular Notch ligand D114 level and/or elicits generation of Notch activated fragment NICD in the subject.
[0141] In embodiments of the methods herein, the subject is a mammal.
[0142] In embodiments of the methods herein, the mammal is a human.
[0143] Use of an effective amount of an agonist anti-ENG coreceptor antibody or fragment thereof described herein for the manufacture of a medicament for treating, or preventing a symptom of, hereditary hemorrhagic telangiectasia.
[0144] Use of an effective amount of an agonist anti-ENG coreceptor antibody or fragment thereof described herein for the manufacture of a medicament for treating or preventing pulmonary arterial hypertension.
[0145] Use of an effective amount of an agonist anti-ENG coreceptor antibody or fragment thereof described herein for the manufacture of a medicament for treating or preventing a squamous cell cancer.
[0146] As used herein, the term “antibody” refers to an intact antibody, i.e., with complete Fc and Fv regions. “Fragment” refers to any portion of an antibody, or in embodiments portions of an antibody linked together, such as, in non-limiting examples, a Fab, F(ab)2, a single-chain Fv (scFv), which is less than the whole antibody but which is an antigen-binding portion and which competes with the intact antibody of which it is a fragment for specific binding. In this case, the antigen is the ENG coreceptor. In an embodiment, the fragment is an actual fragment of an antibody. In an embodiment, the fragment is a fusion protein, which, in further embodiments is an ScFv. In an embodiment the antibody, or fragment thereof, binds the BMP9-binding region (bone morphogenic protein 9-binding region) within an ectodomain of the ENG coreceptor. In an embodiment, the antigen is the BMP9-binding region (bone morphogenic protein 9-binding region) within an ectodomain of the ENG coreceptor. In an embodiment, the antigen is SEQ ID NO:1 or 2. In an embodiment, the antibody or fragment binding to the ENG coreceptor causes activation of the ENG coreceptor.
[0147] An “antibody” or a “fragment” thereof can comprise an immunoglobulin of any class, e.g., IgM, IgG, IgA, IgD and IgE. In some embodiments, the term “antibody” or a “fragment” thereof encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof (such as Fab, Fab′, F(ab′)2, Fv), single chain (ScFv), mutants thereof, naturally occurring variants, fusion proteins comprising an antibody portion with an antigen recognition site of the required specificity, humanized antibodies, chimeric antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity.
[0148] Such fragments can be prepared, for example, by cleaving an intact antibody or by recombinant means. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989), hereby incorporated by reference in its entirety). Antigen-binding fragments may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies or by molecular biology techniques. In some embodiments, a fragment is an Fab, Fab′, F(ab′)2, Fd, Fv, complementarity determining region (CDR) fragment.
[0149] In embodiments, the fragment is a single-chain variable fragment (ScFv; a variable domain light chain (VL) and a variable domain heavy chain (VH) linked via a peptide linker). In an embodiment, the ScFv comprises a variable domain framework sequence having a sequence identical to a human variable domain FR1, FR2, FR3 or FR4. In an embodiment, the ScFv comprises a linker peptide from 5 to 30 amino acid residues long. In an embodiment, the ScFv comprises a linker peptide comprising one or more of glycine, serine and threonine residues. In an embodiment the linker of the scFv is 10-25 amino acids in length. In an embodiment the peptide linker comprises glycine, serine and/or threonine residues. For example, see Bird et al., Science, 242: 423-426 (1988) and Huston et al., Proc. Natl. Acad. Sci. USA, 85:5879-5883 (1988) each of which are hereby incorporated by reference in their entirety), or a polypeptide that contains at least a portion of an antibody that is sufficient to confer ENG coreceptor specific antigen binding on the polypeptide, including a diabody. From N-terminus to C-terminus, both the mature light and heavy chain variable domains comprise the regions FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991), Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987), or Chothia et al., Nature 342:878-883 (1989), each of which are hereby incorporated by reference in their entirety). As used herein, the term “polypeptide” encompasses native or artificial proteins, protein fragments and polypeptide analogs of a protein sequence. A polypeptide may be monomeric or polymeric. As used herein, an Fd fragment means an antibody fragment that consists of the VH and CH1 domains; an Fv fragment consists of the V1 and VH domains of a single arm of an antibody; and a dAb fragment (Ward et al., Nature 341:544-546 (1989) hereby incorporated by reference in its entirety) consists of a VH domain. In some embodiments, fragments are at least 5, 6, 8 or 10 amino acids long. In other embodiments, the fragments are at least 14, at least 20, at least 50, or at least 70, 80, 90, 100, 150 or 200 amino acids long.
[0150] The term “monoclonal antibody” as used herein refers to an antibody member of a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts. Thus, the modifier “monoclonal” indicates the character of the antibody as not being a mixture of discrete antibodies. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. In addition to their specificity, monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins. Thus, an identified monoclonal antibody can be produced by non-hybridoma techniques, e.g., by appropriate recombinant means once the sequence thereof is identified. For example, other than hybridoma techniques, antibodies of the invention can be produced by cells transfected with an immortalizing virus, or by production in an immortal cell culture line (such as Chinese hamster ovary (CHO) cells).
[0151] In an embodiment of the inventions described herein, the antibody is isolated. As used herein, the term “isolated antibody” refers to an antibody that by virtue of its origin or source of derivation has one, two, three or four of the following: (1) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and (4) does not occur in nature absent the hand of man.
[0152] In an embodiment the antibody is humanized. “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. In one embodiment, a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from a hypervariable region (HVR) (or CDR) of the recipient are replaced by residues from a HVR (or CDR) of a non-human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity. In an embodiment, the antibody has 1, 2, 3, 4, 5, or all 6 CDR1-3 of both the heavy and light chain of the murine antibodies described herein. In a preferred embodiment, framework (FR) residues of the murine mAb are replaced with corresponding human immunoglobulin variable domain framework (FR) residues. These may be modified further in embodiments to further refine antibody performance. Furthermore, in a specific embodiment, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. In an embodiment, the humanized antibodies do not comprise residues that are not found in the recipient antibody or in the donor antibody. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all, or in embodiments substantially all, of the hypervariable loops correspond to those of a non-human immunoglobulin, and all, or in embodiments substantially all, of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); Presta, Curr. Op. Struct. Biol. 2:593-596 (1992); Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1:105-115 (1998); Harris, Biochem. Soc. Transactions 23:1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994); and U.S. Pat. Nos. 6,982,321 and 7,087,409, the contents of each of which references and patents are hereby incorporated by reference in their entirety. In one embodiment where the humanized antibodies do comprise residues that are not found in the recipient antibody or in the donor antibody, the Fc regions of the antibodies are modified as described in WO 99/58572, the content of which is hereby incorporated by reference in its entirety.
[0153] Techniques to humanize a monoclonal antibody are well known and are described in, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; and 6,180,370, the content of each of which is hereby incorporated by reference in its entirety. A number of “humanized” antibody molecules comprising an antigen-binding site derived from a non-human immunoglobulin have been described, including antibodies having rodent or modified rodent V regions and their associated complementarity determining regions (CDRs) fused to human constant domains. See, for example, Winter et al. Nature 349: 293-299 (1991), Lobuglio et al. Proc. Nat. Acad. Sci. USA 86: 4220-4224 (1989), Shaw et al. J. Immunol. 138: 4534-4538 (1987), and Brown et al. Cancer Res. 47: 3577-3583 (1987), the content of each of which is hereby incorporated by reference in its entirety. Other references describe rodent hypervariable regions or CDRs grafted into a human supporting framework region (FR) prior to fusion with an appropriate human antibody constant domain. See, for example, Riechmann et al. Nature 332: 323-327 (1988), Verhoeyen et al. Science 239: 1534-1536 (1988), and Jones et al. Nature 321: 522-525 (1986), the content of each of which is hereby incorporated by reference in its entirety. Another reference describes rodent CDRs supported by recombinantly veneered rodent framework regions—European Patent Publication No. 0519596 (incorporated by reference in its entirety). These “humanized” molecules are designed to minimize unwanted immunological response toward rodent anti-human antibody molecules which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients. The antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g., PCT Publication No. WO99/58572; UK Patent Application No. 9809951.8. Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty et al., Nucl. Acids Res. 19: 2471-2476 (1991) and in U.S. Pat. Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692; 6,210,671; and 6,350,861; and in PCT Publication No. WO 01/27160 (each incorporated by reference in their entirety).
[0154] Other forms of humanized antibodies have one or more, or all, CDRs (CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, or CDR H3) which are altered with respect to the original antibody, which are also termed one or more CDRs “derived from” one or more CDRs from the original antibody. In an embodiment, the antibody of the invention is a humanized antibody described herein with one or more, or all, CDRs (CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, or CDR H3) which are altered with respect to the original antibody. In an embodiment, the antibody of the invention is a humanized antibody described herein with none of its CDRs (CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, or CDR H3) altered with respect to the original antibody.
[0155] In embodiments, the antibodies or fragments herein can be produced recombinantly, for example antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes.
[0156] In an embodiment, the agonist anti-ENG coreceptor antibody described herein is capable of specifically binding to or specifically binds a human ENG coreceptor. In an embodiment, the agonist anti-ENG coreceptor antibody described herein which binds the BMP9-binding region within an ectodomain of the ENG coreceptor is capable of specifically binding or specifically binds a human BMP9-binding region within an ectodomain of the ENG coreceptor. As used herein, the terms “is capable of specifically binding” or “specifically binds” refers to the property of an antibody or fragment of binding to the (specified) antigen with a dissociation constant that is <1 μM, preferably <1 nM and most preferably <10 pM. In an embodiment, the Kd of the antibody (or fragment) for ENG coreceptor is better than 10.0 nM. In an embodiment, the Kd of the antibody (or fragment) for ENG coreceptor is better than 1.0 nM. In an embodiment, the Kd of the antibody (or fragment) for ENG coreceptor is better than 0.5 nM. In an embodiment, the Kd of the antibody (or fragment) for ENG coreceptor is 0.1 nM or stronger.
[0157] The term “K.sub.d”, as used herein, is intended to refer to the dissociation constant of an antibody-antigen interaction. One way of determining the K.sub.d or binding affinity of antibodies to, e.g., ENG coreceptor is by measuring binding affinity of monofunctional Fab fragments of the antibody. (The affinity constant is the inverted dissociation constant). To obtain monofunctional Fab fragments, an antibody (for example, IgG) can be cleaved with papain or expressed recombinantly. The affinity of a fragment of an agonist anti-ENG coreceptor antibody can be determined, for example, by surface plasmon resonance (BIAcore3000™ surface plasmon resonance (SPR) system, BIAcore Inc., Piscataway N.J.). CM5 chips can be activated with N-ethyl-N′-(3-dimethylaminopropyl)-carbodiinide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. The antigen can be diluted into 10 mM sodium acetate pH 4.0 and injected over the activated chip at a concentration of 0.005 mg/mL. Using variable flow time across the individual chip channels, two ranges of antigen density can be achieved: 100-200 response units (RU) for detailed kinetic studies and 500-600 RU for screening assays. Serial dilutions (0.1-10× estimated K.sub.d) of purified Fab samples are injected for 1 min at 100 microliters/min and dissociation times of up to 2 h are allowed. The concentrations of the Fab proteins are determined by ELISA and/or SDS-PAGE electrophoresis using a Fab of known concentration (as determined by amino acid analysis) as a standard. Kinetic association rates (k.sub.on) and dissociation rates (k.sub.off) are obtained simultaneously by fitting the data to a 1:1 Langmuir binding model (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994). Methods Enzymology 6. 99-110, the content of which is hereby incorporated in its entirety) using the BIA evaluation program. Equilibrium dissociation constant (K.sub.d) values are calculated as k.sub.off/k.sub.on. This protocol is suitable for use in determining binding affinity of an antibody or fragment to any antigen. Other protocols known in the art may also be used. For example, ELISA.
[0158] An epitope that “specifically binds” to an antibody or a polypeptide is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art. A molecular entity is said to exhibit “specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antibody “specifically binds” or “preferentially binds” to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. For example, an agonist antibody that specifically or preferentially binds to an ENG coreceptor is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other non-ENG coreceptor epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding.
[0159] The term “compete”, as used herein with regard to an antibody, means that a first antibody, or an antigen-binding portion thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen-binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody. The alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody, can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope. However, where each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to “cross-compete” with each other for binding of their respective epitope(s). Both competing and cross-competing antibodies are encompassed by the present invention. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
[0160] Depending on the amino acid sequences of the constant domains of their heavy chains, antibodies (immunoglobulins) can be assigned to different classes. The antibody or fragment can be, e.g., any of an IgM, IgG, IgD, IgE or IgA antibody or fragment thereof, respectively. In an embodiment the antibody is an immunoglobulin M. In an embodiment the antibody fragment is a fragment of an immunoglobulin G. In an embodiment the antibody is an IgG1, IgG2, IgG2a, IgG2b, IgG3 or IgG4. In an embodiment the antibody comprises sequences from a human IgG1, human IgG2, human IgG2a, human IgG2b, human IgG3 or human IgG4. A combination of any of these antibody subtypes can also be used. One consideration in selecting the type of antibody to be used is the desired serum half-life of the antibody. For example, an IgG generally has a serum half-life of 23 days, IgA 6 days, IgM 5 days, IgD 3 days, and IgE 2 days. (Abbas A K, Lichtman A H, Pober J S. Cellular and Molecular Immunology, 4th edition, W.B. Saunders Co., Philadelphia, 2000, hereby incorporated by reference in its entirety).
[0161] The “variable region” or “variable domain” of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody. The variable domain of the heavy chain may be referred to as “VH.” The variable domain of the light chain may be referred to as “VL.” These domains are generally the most variable parts of an antibody and contain the antigen-binding sites. The term “variable” refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions (HVRs) (or CDRs) both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institutes of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
[0162] The “light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (κ) and lambda (λ), based on the amino acid sequences of their constant domains.
[0163] “Framework” or “FR” residues are those variable domain residues other than the HVR residues as herein defined.
[0164] The term “hypervariable region” or “HVR” when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six HVRs; three in the VH (H1, H2, H3) and three in the VL (L1, L2, L3). In native antibodies, H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al., Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, N.J., 2003). Indeed, naturally occurring camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al., Nature Struct. Biol. 3:733-736 (1996). A number of HVR delineations are in use and are encompassed herein. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) hereby incorporated by reference in its entirety). There are CDRs 1, 2, and 3 for each of the heavy and light chains. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. The “contact” HVRs are based on an analysis of the available complex crystal structures. HVRs may comprise “extended HVRs” as follows: 24-36 or 24-34 (L1), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH. The variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
[0165] The term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, an intact antibody as used herein may be an antibody with or without the otherwise C-terminal lysine.
[0166] Compositions or pharmaceutical compositions comprising the antibodies, ScFvs or fragments of antibodies disclosed herein preferably comprise stabilizers to prevent loss of activity or structural integrity of the protein due to the effects of denaturation, oxidation or aggregation over a period of time during storage and transportation prior to use. The compositions or pharmaceutical compositions can comprise one or more of any combination of salts, surfactants, pH and tonicity agents such as sugars (that can contribute to overcoming aggregation problems). Where a composition or pharmaceutical composition of the present invention is used as an injection, it is desirable to have a pH value in an approximately neutral pH range, it is also advantageous to minimize surfactant levels to avoid bubbles in the formulation which are detrimental for injection into subjects. In an embodiment, the composition or pharmaceutical composition is in liquid form and stably supports high concentrations of bioactive antibody in solution and is suitable for inhalational or parenteral administration. In an embodiment, the composition or pharmaceutical composition is suitable for intravenous, intramuscular, intraperitoneal, intradermal and/or subcutaneous injection. In an embodiment, the composition or pharmaceutical composition is in liquid form and has minimized risk of bubble formation and anaphylactoid side effects. In an embodiment, the composition or pharmaceutical composition is isotonic. In an embodiment, the composition or pharmaceutical composition has a pH or 6.8 to 7.4.
[0167] In an embodiment the ScFvs or fragments of antibodies disclosed herein are lyophilized and/or freeze dried and are reconstituted for use.
[0168] Examples of pharmaceutically acceptable carriers include, but are not limited to, phosphate buffered saline solution, sterile water (including water for injection USP), emulsions such as oil/water emulsion, and various types of wetting agents. Preferred diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline, for example 0.9% sodium chloride solution, USP. Compositions comprising such carriers are formulated by well known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, Pa., 1990; and Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000, the content of each of which is hereby incorporated in its entirety). In non-limiting examples, the carriers can comprise one or more of dibasic sodium phosphate, potassium chloride, monobasic potassium phosphate, polysorbate 80 (e.g. 2-[2-[3,5-bis(2-hydroxyethoxy)oxolan-2-yl]-2-(2-hydroxyethoxy)ethoxy]ethyl (E)-octadec-9-enoate), disodium edetate dehydrate, sucrose, monobasic sodium phosphate monohydrate, and dibasic sodium phosphate dihydrate.
[0169] The antibodies, or fragments of antibodies, or compositions, or pharmaceutical compositions described herein can also be lyophilized or provided in any suitable forms including, but not limited to, injectable solutions or inhalable solutions, gel forms and tablet forms.
[0170] The term “Fc domain” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc domain of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc domain is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine of the Fc domain may be removed, for example, by recombinantly engineering the nucleic acid encoding it. In embodiments, the antibody comprises an Fc domain. In an embodiment, the Fc domain has the same sequence or 99% or greater sequence similarity with a human IgG1 Fc domain. In an embodiment, the Fc domain has the same sequence or 99% or greater sequence similarity with a human IgG2 Fc domain. In an embodiment, the Fc domain has the same sequence or 99% or greater sequence similarity with a human IgG3 Fc domain. In an embodiment, the Fc domain has the same sequence or 99% or greater sequence similarity with a human IgG4 Fc domain. In an embodiment, the Fc domain is not mutated. In an embodiment, the Fc domain is mutated at the CH2-CH3 domain interface to increase the affinity of IgG for FcRn at acidic but not neutral pH (Dall'Acqua et al, 2006; Yeung et al, 2009). In an embodiment, the Fc domain has the same sequence as a human IgG1 Fc domain.
[0171] In embodiments, the invention encompasses modifications to the variable regions disclosed herein. For example, the invention includes antibodies comprising functionally equivalent variable regions and CDRs which do not significantly affect their properties as well as variants which have enhanced or decreased activity and/or affinity. Modification of polypeptides is routine practice in the art and need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or use of chemical analogs.
[0172] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.
[0173] Substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but framework alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of “conservative substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated “exemplary substitutions” in Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened.
TABLE-US-00023 TABLE 1 Amino Acid Substitutions Original Residue Conservative Substitutions Exemplary Substitutions Ala (A) Val Val; Leu; Ile Arg (R) Lys Lys; Gln; Asn Asn (N) Gln Gln; His; Asp, Lys; Arg Asp (D) Glu Glu; Asn Cys (C) Ser Ser; Ala Gln (Q) Asn Asn; Glu Glu (E) Asp Asp; Gln Gly (G) Ala Ala His (H) Arg Asn; Gln; Lys; Arg Ile (I) Leu Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Ile Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg Arg; Gln; Asn Met (M) Leu Leu; Phe; Ile Phe (F) Tyr Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr Tyr; Phe Tyr (Y) Phe Trp; Phe; Thr; Ser Val (V) Leu Ile; Leu; Met; Phe; Ala; Norleucine
[0174] Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a β-sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side-chain properties:
[0175] (1) Non-polar: Norleucine, Met, Ala, Val, Leu, Ile;
[0176] (2) Polar without charge: Cys, Ser, Thr, Asn, Gln;
[0177] (3) Acidic (negatively charged): Asp, Glu;
[0178] (4) Basic (positively charged): Lys, Arg;
[0179] (5) Residues that influence chain orientation: Gly, Pro; and
[0180] (6) Aromatic: Trp, Tyr, Phe, His.
[0181] Non-conservative substitutions are made by exchanging a member of one of these classes for another class.
[0182] One type of substitution, for example, that may be made is to change one or more cysteines in the antibody, which may be chemically reactive, to another residue, such as, without limitation, alanine or serine. For example, there can be a substitution of a non-canonical cysteine. The substitution can be made in a CDR or framework region of a variable domain or in the constant region of an antibody. In some embodiments, the cysteine is canonical. Any cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant cross-linking. Conversely, cysteine bond(s) may be added to the antibody to improve its stability, particularly where the antibody is an antibody fragment such as an Fv fragment.
[0183] The antibodies may also be modified, e.g., in the variable domains of the heavy and/or light chains, e.g., to alter a binding property of the antibody. Changes in the variable region can alter binding affinity and/or specificity. In some embodiments, no more than one to five conservative amino acid substitutions are made within a CDR domain. In other embodiments, no more than one to three conservative amino acid substitutions are made within a CDR domain. For example, a mutation may be made in one or more of the CDR regions to increase or decrease the K.sub.D of the agonist anti-ENG coreceptor, to increase or decrease k.sub.off, or to alter the binding specificity of the antibody. Techniques in site-directed mutagenesis are well-known in the art.
[0184] A modification or mutation may also be made in a framework region or constant region to increase the half-life of an agonist anti-ENG coreceptor antibody. See, e.g., PCT Publication No. WO 00/09560. A mutation in a framework region or constant region can also be made to alter the immunogenicity of the antibody, to provide a site for covalent or non-covalent binding to another molecule, or to alter such properties as complement fixation, FcR binding and antibody-dependent cell-mediated cytotoxicity. According to the invention, a single antibody may have mutations in any one or more of the CDRs or framework regions of the variable domain or in the constant region.
[0185] In an embodiment, an antibody described herein is recombinantly produced. In an embodiment, the antibody produced in the eukaryotic expression system comprises glycosylation at a residue on the Fc portion corresponding to Asn297.
[0186] In an embodiment the composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein is substantially pure with regard to the antibody, or antigen-binding fragment thereof. A composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein is “substantially pure” with regard to the antibody or fragment when at least 60% to 75% of a sample of the composition or pharmaceutical composition exhibits a single species of the antibody, or antigen-binding fragment thereof. A substantially pure composition or pharmaceutical composition comprising the antibody, or antigen-binding fragment thereof, described herein can comprise, in the portion thereof which is the antibody, or antigen-binding fragment, 60%, 70%, 80% or 90% of the antibody, or antigen-binding fragment, of the single species, more usually about 95%, and preferably over 99%. Purity or homogeneity may be tested by a number of means well known in the art, such as polyacrylamide gel electrophoresis or HPLC.
[0187] Human ENG co-receptor encoding sequences are known in the art. For example, NCBI Reference Sequence: NG_009551.1; Ensembl Gene ID: ENG ENSG00000106991.
[0188] In regard to BMP9, both BMP9 and BMP10 are circulating ligands with comparable and high affinity for ENG binding. Both ligands induce expression of similar downstream target genes, suggesting the presence of a strong functional redundancy between BMP9 and BMP10. Although only the structural interaction between BMP9 and ENG has been resolved so far, it is highly likely that BMP9 and BMP10, knowing their sequence and functional similarities, should bind to the same domain on ENG to activate the receptor, see Refs PMID: 31828546, 28564608. Therefore, it is predicted that an agonist mAb binding ENG will mimic BMP9 and BMP10 signaling.
[0189] A host cell comprising one or more of the nucleic acids described herein.
[0190] An antibody or fragment thereof described herein linked or conjugated to a therapeutic agent.
[0191] In embodiments, the therapeutic agent is a cytotoxic drug, a radioactive isotope, an immunomodulator, or a second antibody.
[0192] A pharmaceutical composition comprising an effective amount of the isolated antibody or antibody fragment as described herein, and a pharmaceutically acceptable carrier or excipient, is provided.
[0193] In embodiments, the subject is a mammal.
[0194] In embodiments, the mammal is a human.
[0195] “And/or” as used herein, for example, with option A and/or option B, encompasses the separate embodiments of (i) option A, (ii) option B, and (iii) option A plus option B.
[0196] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0197] When introducing elements of the present invention or the preferred embodiment(s) thereof, the articles “a”, “an”, “the” and “said” are intended to mean that there are one or more of the elements. The terms “comprising”, “including” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
[0198] Pharmaceutically active: The term “pharmaceutically active” as used herein refers to the beneficial biological activity of a substance on living matter and, in particular, on cells and tissues of the human body. A “pharmaceutically active agent” or “drug” is a substance that is pharmaceutically active and a “pharmaceutically active ingredient” (API) is the pharmaceutically active substance in a drug.
[0199] Pharmaceutically acceptable: The term “pharmaceutically acceptable” as used herein means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia, other generally recognized pharmacopoeia in addition to other formulations that are safe for use in animals, and more particularly in humans and/or non-human mammals.
[0200] Pharmaceutically acceptable salt: The term “pharmaceutically acceptable salt” as used herein refers to acid addition salts or base addition salts of the compounds, such as the multi-drug conjugates, in the present disclosure. A pharmaceutically acceptable salt is any salt which retains the activity of the present antibody or fragment. Examples of pharmaceutically acceptable salts include sulfates, pyrosulfates, bisulfates, sulfites, bisulfites, phosphates, monohydrogen-phosphates, dihydrogenphosphates, metaphosphates, pyrophosphates, chlorides, bromides, iodides, acetates, propionates, decanoates, caprylates, acrylates, formates, isobutyrates, caproates, heptanoates, propiolates, oxalates, malonates, succinates, suberates, sebacates, fumarates, maleates, butyne-1,4-dioates, hexyne-1,6-dioates, benzoates, chlorobenzoates, methylbenzoates, dinitrobenzoates, hydroxybenzoates, methoxybenzoates, phthalates, sulfonates, methylsulfonates, propylsulfonates, besylates, xylenesulfonates, naphthalene-1-sulfonates, naphthalene-2-sulfonates, phenyl acetates, phenylpropionates, phenylbutyrates, citrates, lactates, [gamma]-hydroxybutyrates, glycolates, tartrates, and mandelates.
[0201] Pharmaceutically acceptable carrier: The term “pharmaceutically acceptable carrier” as used herein refers to an excipient, diluent, preservative, solubilizer, emulsifier, adjuvant, and/or vehicle with which the present antibody or fragment is administered. Such carriers may be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfate; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose may also be a carrier. Methods for producing compositions in combination with carriers are known to those of skill in the art. In some embodiments, the language “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. See, e.g., Remington, The Science and Practice of Pharmacy. 20′″ ed., (Lippincott, Williams & Wilkins 2003). Except insofar as any conventional media or agent is incompatible with the active compound, such use in the compositions is contemplated.
[0202] “Treating” or “treatment” or “alleviation” refers to therapeutic treatment wherein the object is to slow down (lessen) if not cure the targeted pathologic condition or disorder or prevent recurrence of the condition. A subject is successfully “treated” if, after receiving a therapeutic amount of a therapeutic agent, the subject shows observable and/or measurable reduction in or absence of one or more signs and symptoms of the particular disease. Reduction of the signs or symptoms of a disease may also be felt by the patient. A patient is also considered treated if the patient experiences stable disease. In some embodiments, treatment with a therapeutic agent is effective to result in the patients being disease-free 3 months after treatment, preferably 6 months, more preferably one year, even more preferably 2 or more years post treatment. These parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician of appropriate skill in the art.
[0203] As used herein, “preventative” treatment is meant to indicate a postponement of development of a disease, a symptom of a disease, or medical condition, suppressing symptoms that may appear, or reducing the risk of developing or recurrence of a disease or symptom. “Curative” treatment includes reducing the severity of or suppressing the worsening of an existing disease, symptom, or condition.
[0204] It is understood that aspects and embodiments of the invention described herein include “consisting” and/or “consisting essentially of” aspects and embodiments.
[0205] Throughout this disclosure, various aspects of this invention are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range. Thus, “85% or more” identity to something shall mean all percentage identities from 85% up to 100%.
[0206] As used herein, a subject, unless otherwise indicated, refers to an animal, a non-human mammal or a human. As used herein, “animals” include a pet, a farm animal, an economic animal, a sport animal and an experimental animal, such as a cat, a dog, a horse, a cow, an ox, a pig, a donkey, a sheep, a lamb, a goat, a mouse, a rabbit, a chicken, a duck, a goose, a primate, including a monkey and a chimpanzee.
[0207] Other objects, advantages and features of the present invention will become apparent from the following specification taken in conjunction with the accompanying drawings.
[0208] This invention may be better understood from the Experimental Details, which follow.
EXPERIMENTAL DETAILS
[0209] By targeting a BMP9 binding sequence of endoglin, an antibody has been created which is able to directly and efficiently activate endoglin signaling. This endoglin agonist antibody serves as a BMP9 mimetic that directly activates endoglin (ENG) and rescues endoglin functions in HHT and PAH.
[0210] An ENG agonist IgM mAb, “A18-384” or “A18”, has been generated in mice. Using a combination of ammonium sulfate precipitation and IgM purification columns, small quantities of ENG mAb A18-384 were successfully purified (purification yield ˜80%). These purification experiments were performed with hybridoma-conditioned medium containing FBS. It was also confirmed that the use of a serum-free hybridoma medium did not significantly affect ENG mAb titer.
[0211] The antibody was successfully tested on MS1 endothelial cells for ENG-SMAD1/5/8 signaling activation (see
[0212] The agonist mAb A18-384 is also tested on primary endothelial cells isolated from lungs and livers of wild-type C57BL/6 mice. In addition, the agonist mAb A18-384 is injected in wild-type C57BL/6 mice to assess its SMAD1/5/8 signaling activating properties and its stability in the blood circulation. Intraperitoneal injections of doses of up to 10 mg/kg are used. Endothelial SMAD1/5/8 signaling activation is assessed in the lungs and liver by immunohistochemistry and Western blotting techniques and by measuring phospho-SMAD1/5/8 and ID1 (inhibitor of DNA binding protein 1) levels, as before [9,10].
[0213] The in vivo efficacy of the ENG agonist mAb A18-384 in rescuing endothelial SMAD1/5/8 signaling and in preventing and reversing AVM pathology in HHT mice is tested. The HHT model used is BMP9/10-immunoblocked mice, which develop retinal AVMs, but also robust vascular pathology in the liver, lungs, and mucosa, as well as pronounced anemia [9,10,15]. This model is of particular interest because neutralization of the BMP9/10 ligands leads to a clear inhibition of ALK1-ENG receptor function [9]. An ENG agonist mAb such as A18-384 that can bypass ligand neutralization and activate ENG will prevent the resulting SMAD1/5/8 inhibition-mediated pathogenesis.
[0214] The in vivo efficacy of the ENG agonist mAb A18-384 in blocking PAH pathology in rodents is tested on the monocrotaline-induced PH rodent model. It is determined whether ENG agonist mAb A18-384 treatment prevents right ventricular systolic pressure (RVSP), prevents RV hypertrophy, pulmonary arterial muscularization, and endothelial cell apoptosis.
[0215] Human cell testing for HHT and PAH treatment can be effected using the mAb(s) in human endothelial cell cultures, including in HHT-derived blood outgrowth endothelial cells (BOECs) for its efficacy in activating ENG-SMAD1/5/8 signaling. BOECs were isolated from both HHT1 and HHT2 patients [9,10].
[0216] CDR sequencing from the A18 hybridoma revealed heavy chain CDR1: GFTFNTYA (SEQ ID NO:3); CDR2: IRSKSSNYAT (SEQ ID NO:4) and CDR3: VRDRTGSWFAY (SEQ ID NO:5). Similarly, CDR sequencing from the A18 hybridoma revealed light chain CDR1: QDIGSS (SEQ ID NO:6); CDR2: ATS (SEQ ID NO:7); and CDR3: LQYASSPYT (SEQ ID NO:8). The variable heavy chain had the sequence SEQ ID NO:17. Full heavy chain, signal, variable and constant, was encoded by SEQ ID NO:10, and had the sequence SEQ ID NO:11. The variable light chain had the sequence SEQ ID NO:18. Full light chain, signal, variable and constant, was encoded by SEQ ID NO:12, and had the sequence SEQ ID NO:13.
[0217] Sequencing was performed by:
1. Total RNA extraction from B cells
2. mRNA denaturing
3. cDNA synthesis
4. 5′ RACE (Rapid Amplification of cDNA Ends) reaction
5. PCR result analysis
6. Cloning PCR positive bands
7. Plasmid miniprep
8. Sequencing 10 clones in total per sample
9. CDR analysis using DNA sequencing data (CDR regions were defined using IMGT/V-QUEST, world wide web at imgt.org).
[0218] Recombinant Alb scFv-Fc: CDR sequences were used to generate recombinant antibodies carrying the native variable heavy (VH) chain and variable light (VL) chain. Different combinations of VH chain, VL chain, and linkers (15 amino acids, 15aa; or 20 aa) fused to human IgG1-Fc (Fc) were generated:
LH15: VL-15aa-VH-Fc;
HL15: VH-15aa-VL-Fc;
LH20: VL-20aa-VH-Fc; and
HL20: VH-20aa-VL-Fc.
[0219] The ScFv were made by subcloning into pFuse vector (Zoecin resistance, see world wide web at invivogen.com/pfuse-higg1-fc). The sequences for each of these constructs are set forth above. All constructs showed activity, but LH15 (VL-15aa-VH-Fc) showed the strongest activity when tested by ELISA (˜1:1000 titer against the original epitope peptide (SEQ ID NO:1) used for immunization).
[0220] Notch activation: An anti-endoglin coreceptor agonist antibody as described herein, A18, could also robustly activate Notch signaling, via a mechanism that requires the endoglin/ALK1 receptor complex. As show in
[0221] Notch is critically involved in tissue development and homeostasis, and its deregulation controls the pathogenesis of multiple diseases, including several cancer types. In HHT, strong evidence suggests that Notch inhibition is involved in arteriovenous malformation (AVM) development, a cardinal feature of HHT vascular pathology. Experiments showed that Alb mAb is a potent Notch signaling activator.
[0222] Since Notch loss-of-function has been associated with several cancer types, including head and neck squamous cell carcinoma (HNSCC) or squamous cancer of the skin, lung, and esophagus, increasing Notch signaling is considered therapeutic in these cancer types. Interestingly, although endoglin is preferentially expressed in endothelial cells and some stem cells, its expression is increased in squamous cell carcinoma.
Discussion
[0223] At least 85% of HHT patients carry disease-causing loss-of-function mutations in the genes ENG (encoding endoglin, ENG) or ACVRL1 (encoding activin receptor-like kinase 1, ALK1), which define the two disease subtypes: HHT1 (OMIM #187300) and HHT2 (#600376), respectively [1,2]. ALK1 and ENG are members of the transforming growth factor-β signaling superfamily and physically and functionally interact in the same signal transduction axis [3]. The cell surface receptor complex composed of the co-receptor ENG, the endothelial BMP type I receptor ALK1, and a BMP type II receptor (e.g., BMPR2) is activated by binding of the circulating ligands BMP9 and BMP10 [4-6]. Loss-of-function mutations in BMPR2 cause familial PAH, which can be observed in HHT patients [7], further supporting the notion that ALK1, ENG, and BMPR2 functionally interact. ALK1-ENG-BMPR2 receptor activation leads to phosphorylation of the signal transducers SMAD1, SMAD5 and SMAD8 to trigger the formation of SMAD1/5/8-SMAD4 complexes that translocate into the nucleus to control specific gene expression programs [8]. Therefore, interventions that could activate ALK1-ENG-BMPR2 receptor function have therapeutic potential in both HHT and PAH by correcting endothelial SMAD1/5/8 signaling inhibition and the associated vascular pathology.
[0224] Pharmacological enhancement of ALK1 signaling has been actively explored, including by our laboratory, and several FDA-approved drugs have shown encouraging effects in HHT mouse models [9-11]. Targeting of BMPR2 using exogenous BMP9 administration has also been investigated and demonstrated efficacy in treating PAH models [12]. These approaches, although of great interest in the absence of any other therapeutic options, suffer from their relative lack of specificity and thus might lead to possible side effects, especially in an already fragile population. In this context, it was sought to determine whether selective activation of ENG, using an agonistic anti-ENG mAb, could be achieved to overcome ENG loss-of-function in both HHT and PAH. We generated an mAb with BMP9-binding mimetic properties. This mAb (given the designation “A18-384”) successfully activated ENG receptor activity and SMAD1/5/8 signaling in mouse endothelial MS1 cells, an ideal cell culture system for the analysis of ENG-SMAD1/5/8 signaling [13].
[0225] Interestingly, an anti-endoglin coreceptor agonist antibody as described herein, A18, could also robustly activate Notch signaling, via a mechanism that requires the endoglin/ALK1 receptor complex. Notch is critically involved in tissue development and homeostasis, and its deregulation controls the pathogenesis of multiple diseases, including several cancer types. Since experiments showed that treatment of endothelial MS1 cells with A18 led to a strong increase of the Notch ligand D114 and the generation of the Notch activated fragment NICD, and since Notch loss-of-function has been associated with several cancer types, including head and neck squamous cell carcinoma (HNSCC) or squamous cancer of the skin, lung, and esophagus, increasing Notch signaling can be considered therapeutic in these cancer types.
REFERENCES
[0226] McAllister K A, Grogg K M, Johnson D W, Gallione C J, Baldwin M A, Jackson C E, Helmbold E A, Markel D S, McKinnon W C, Murrell J, et al. (1994) Endoglin, a TGF-beta binding protein of endothelial cells, is the gene for hereditary haemorrhagic telangiectasia type 1. Nat Genet 8: 345-351. [0227] 2. Johnson D W, Berg J N, Baldwin M A, Gallione C J, Marondel I, Yoon S J, Stenzel T T, Speer M, Pericak-Vance M A, Diamond A, et al. (1996) Mutations in the activin receptor-like kinase 1 gene in hereditary haemorrhagic telangiectasia type 2. Nat Genet 13: 189-195. [0228] 3. Cai J, Pardali E, Sanchez-Duffhues G, ten Dijke P (2012) BMP signaling in vascular diseases. FEBS Lett 586: 1993-2002. [0229] 4. Goumans M-J, Zwijsen A, Ten Dijke P, Bailly S (2018) Bone Morphogenetic Proteins in Vascular Homeostasis and Disease. Cold Spring Harb Perspect Biol 10.: a031989. [0230] 5. Seki T, Yun J, Oh S P (2003) Arterial endothelium-specific activin receptor-like kinase 1 expression suggests its role in arterialization and vascular remodeling. Circ Res 93: 682-689. [0231] 6. Saito T, Bokhove M, Croci R, Zamora-Caballero S, Han L, Letarte M, de Sanctis D, Jovine L (2017) Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell Rep 19: 1917-1928. [0232] 7. Newman J H, Trembath R C, Morse J A, Grunig E, Loyd J E, Adnot S, Coccolo F, Ventura C, Phillips J A 3rd, Knowles J A, et al. (2004) Genetic basis of pulmonary arterial hypertension: current understanding and future directions, J Am Coll Cardiol 43: 33S-39S. [0233] 8. Massagué J (2012) TGFβ signalling in context. Nat Rev Mol Cell Biol 13: 616-630. [0234] 9. Ruiz S, Chandakkar P, Zhao H, Papoin J, Chatterjee P K, Christen E, Metz C N, Blanc L, Campagne F, Marambaud P (2017) Tacrolimus rescues the signaling and gene expression signature of endothelial ALK1 loss-of-function and improves HHT vascular pathology. Hum Mol Genet 26: 4786-4798. [0235] 10. Ruiz S, Zhao H, Chandakkar P, Papoin J, Choi H, Nomura-Kitabayashi A, Patel R, Gillen M, Diao L, Chatterjee P K, et al. (2019) Correcting SMAD1/5/8, mTOR, and VEGFR2 treats pathology in hereditary hemorrhagic telangiectasia models. J Clin Invest. 2020 Feb. 3; 130(2):942-957. [0236] 11. Kim Y H, Kim M-J, Choe S-W, Sprecher D, Lee Y J, P Oh S (2017) Selective effects of oral antiangiogenic tyrosine kinase inhibitors on an animal model of hereditary hemorrhagic telangiectasia. J Thromb Haemost 15: 1095-1102. [0237] 12. Long L, Ormiston M L, Yang X, Southwood M, Graf S, Machado R D, Mueller M, Kinzel B, Yung L M, Wilkinson J M, et al. (2015) Selective enhancement of endothelial BMPR-II with BMP9 reverses pulmonary arterial hypertension. Nat Med 21: 777-785. [0238] 13. Nolan-Stevaux O, Zhong W, Culp S, Shaffer K, Hoover J, Wickramasinghe D, Ruefli-Brasse A (2012) Endoglin requirement for BMP9 signaling in endothelial cells reveals new mechanism of action for selective anti-endoglin antibodies. PLoS One 7: e50920. [0239] 14. Vitale F, Giliberto L, Ruiz S, Steslow K, Marambaud P, d'Abramo C (2018) Anti-tau conformational scFv MC1 antibody efficiently reduces pathological tau species in adult JNPL3 mice. Acta Neuropathol Commun 6: 82. [0240] 15. Ruiz S, Zhao H, Chandakkar P, Chatterjee P K, Papoin J, Blanc L, Metz C N, Campagne F, Marambaud P (2016) A mouse model of hereditary hemorrhagic telangiectasia generated by transmammary-delivered immunoblocking of BMP9 and BMP10. Sci Rep 5: 37366.