DIMERIC REVERSE TRANSCRIPTASE
20170159032 ยท 2017-06-08
Inventors
Cpc classification
C12N2740/13022
CHEMISTRY; METALLURGY
C12N9/1252
CHEMISTRY; METALLURGY
C12Y207/07007
CHEMISTRY; METALLURGY
International classification
Abstract
Covalently-linked DNA polymerases are provided.
Claims
1. A polypeptide comprising a first DNA polymerase and a second DNA polymerase covalently linked by a heterologous linker.
2. The polypeptide of claim 1, wherein the first DNA polymerase is a first reverse transcriptase and the second DNA polymerase is a second reverse transcriptase.
3. The polypeptide of claim 2, wherein the polypeptide is a fusion protein and the heterologous linker is an amino acid linker that links the carboxyl terminus of the first reverse transcriptase to the amino terminus of the second reverse transcriptase.
4. The polypeptide of claim 2, further comprising a third reverse transcriptase covalently linked by a second linker to the first or second reverse transcriptase.
5. The polypeptide of claim 1, wherein the polypeptide is no more than 1400, 1500, 1600, 1700, 1800, 1900, or 2000 amino acids in length.
6. The polypeptide of claim 2, wherein the first reverse transcriptase and the second reverse transcriptase are identical.
7. The polypeptide of claim 2, wherein the first reverse transcriptase and the second reverse transcriptase are at least 90% or 95% identical.
8. The polypeptide of claim 7, wherein the first and second reverse transcriptases are a murine leukemia virus (MLV) reverse transcriptase.
9. The polypeptide of claim 7, wherein the first and second reverse transcriptases are a Feline leukemia virus (FLV) reverse transcriptase.
10. The polypeptide of claim 2, wherein the first reverse transcriptase and the second reverse transcriptase are less than 70%, 80%, or 90% identical.
11. The polypeptide of claim 1, wherein the amino acid linker is between 1-30 amino acids long.
12. The polypeptide of claim 2, wherein the first or second reverse transcriptase is selected from the group consisting of murine leukemia virus (MLV) reverse transcriptase, Feline leukemia virus (FLV) reverse transcriptase, bovine leukemia virus (BLV), Avian Myeloblastosis Virus (AMV) reverse transcriptase, Respiratory Syncytial Virus (RSV) reverse transcriptase, Equine Infectious Anemia Virus (EIAV) reverse transcriptase, Rous-associated Virus-2 (RAV2) reverse transcriptase, SUPERSCRIPT II reverse transcriptase, SUPERSCRIPT I reverse transcriptase, THERMOSCRIPT reverse transcriptase and MMLV RNase H-reverse transcriptase.
13. The polypeptide of claim 2, wherein the first reverse transcriptase is a murine leukemia virus (MLV) reverse transcriptase and the second reverse transcriptase is a Feline leukemia virus (FLV) reverse transcriptase.
14. The polypeptide of claim 2, wherein the first reverse transcriptase is a Feline leukemia virus (FLV) reverse transcriptase and the second reverse transcriptase is a murine leukemia virus (MLV) reverse transcriptase.
15. The polypeptide of claim 2, wherein at least the first or the second reverse transcriptase have at least one mutation compared to a naturally-occurring reverse transcriptase.
16. The polypeptide of claim 15, wherein the first or the second reverse transcriptase is an RNase H-reverse transcriptase.
17. The polypeptide of claim 1, wherein the first DNA polymerase is a first DNA-dependent polymerase and/or the second DNA polymerase is a second DNA-dependent polymerase.
18. The polypeptide of claim 1, wherein the first DNA polymerase is a DNA-dependent polymerase and the second DNA polymerase is a reverse transcriptase.
19. The polypeptide of claim 1, wherein the first DNA polymerase is a reverse transcriptase and the second DNA polymerase is a DNA-dependent polymerase.
20. A nucleic acid encoding the polypeptide of claim 1.
21. A reaction mixture comprising: RNA or DNA template; and the polypeptide of claim 1.
22. The reaction mixture of claim 21, further comprising a buffer selected from the group consisting of Tris, HEPES, ACES, PIPES, MOPSO, BES, MOPS, TES, TAPSO, POPSO, BICINE, TAPS, and AMPSO.
23. The reaction mixture of claim 21, further comprising at least one oligonucleotide primer and/or deoxynucleotides.
Description
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
[0032] It has been surprisingly discovered that covalent linkage of two DNA polymerases results in a polypeptide that is more thermostable and in some cases has an improved (shorter) reaction time compared to monomer polymerases. For instance, as shown in the Examples, protein fusions of the same or different reverse transcriptases result in polypeptides with more heat stability and in some cases lower reaction times than a control monomeric reverse transcriptase.
II Dimeric Proteins
[0033] Dimeric (and trimeric) DNA polymerases are provided herein. Such polypeptide can be isolated or purified or can be in complex mixtures or, for example, in cells. The polypeptides as described herein can comprise, for example, at least two and in some embodiments, three different DNA polymerases. The different DNA polymerases can be identical or they can have different sequences.
[0034] For convenience, in a dimeric polypeptide, the DNA polymerase nearest at the amino terminus of the polypeptide is referred to as the first DNA polymerase and the DNA polymerase nearest the carboxyl terminus is referred to as the second DNA polymerase. In cases where the polypeptide is a trimer, the middle DNA polymerase is the second and the DNA polymerase nearest the carboxyl terminus of the polypeptide is the third DNA polymerase. DNA polymerase refers to any protein (full-length as occurs in nature or a fragment or variant thereof) having DNA polymerase activity. Similarly, a reverse transcriptase refers to any protein (full-length as occurs in nature or a fragment or variant thereof) having reverse transcriptase activity
[0035] In some embodiments one or both of the DNA polymerases in the polypeptide (or in the case of trimers, one, both, or all three) can be reverse transcriptases, i.e., an RNA-dependent DNA polymerase. In some embodiments, the polypeptides described herein comprise two reverse transcriptases. In embodiments in which the polypeptide comprises two reverse transcriptases, the reverse transcriptases can be identical in sequence or the reverse transcriptases can have different sequences. In some embodiments, the two reverse transcriptases are at least 80%, 85%, 90%, 95%, or 99% identical to each other. In other embodiments, the two reverse transcriptases are less than 70%, 80%, or 90% (e.g., 40-70, 40-80, 40-90%) identical to each other. For example, two different reverse transcriptases (or one reverse transcriptase and one DNA-dependent DNA polymerase) can be selected with complementary but different activities such that the polypeptide comprising the two reverse transcriptases (or one RT and one DNA-dependent DNA polymerase) has superior activity compared to either of the individual monomeric enzymes.
[0036] Exemplary reverse transcriptases that can be the first or second (or third) reverse transcriptase include, but are not limited to, murine leukemia virus (MLV) reverse transcriptase (Gerard and Grandgenett, Journal of Virology 15:785-797, 1975; Verma, Journal of Virology 15:843-854, 1975) or SEQ ID NO:1, feline leukemia virus (FLV) reverse transcriptase (Rho and Gallo, Cancer Lett., 10:207-221, 1980 or SEQ ID NO:1, bovine leukemia virus (BLV) (Demirhan et al., Anticancer Res., 16:2501-5, 1996; Drescher et al., Arch Geschwulstforsch., 49:569-79, 1979), Avian Myeloblastosis Virus (AMV) reverse transcriptase, Respiratory Syncytial Virus (RSV) reverse transcriptase, Equine Infectious Anemia Virus (EIAV) reverse transcriptase, Rous-associated Virus-2 (RAV2) reverse transcriptase, SUPERSCRIPT II reverse transcriptase, SUPERSCRIPT III reverse transcriptase (U.S. Pat. No. 8,541,219, U.S. Pat. No. 7,056,716, U.S. Pat. No. 7,078,208), THERMOSCRIPT reverse transcriptase and MMLV RNase H-reverse transcriptase.
[0037] In some one or both of the DNA polymerases (for example the reverse transcriptases) is a native polymerase. In other embodiments, one or both of the DNA polymerases (for example the reverse transcriptases) comprise one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1-20, 1-10, 1-5, 1-2) mutation compared to the native DNA polymerase (including but not limited to SEQ ID NO:1 or SEQ ID NO:2). Exemplary mutations include, but are not limited to, mutations that reduce (e.g., reduce by at least 50, 70, or 95%) or eliminate RNase H activity (referred to as RNase H mutations). Mutations that increase thermostability in RT can also be introduced. Exemplary mutations of this type are described in, for example, Arezi et al., Nucleic Acids Res. 2009 February; 37(2): 473-481.
[0038] In some embodiments, the polymerase comprises at least two (e.g., 2 or 3) DNA-dependent DNA polymerases. Exemplary DNA-dependent DNA polymerase include, but are not limited to, any of the polymerases of the five families of DNA-dependent DNA polymerases, although most will fall into families A, B and C. There is little or no structural or sequence similarity among the various families. Most family A polymerases are single chain proteins that can contain multiple enzymatic functions including polymerase, 3 to 5 exonuclease activity and 5 to 3 exonuclease activity. Family B polymerases typically have a single catalytic domain with polymerase and 3 to 5 exonuclease activity, as well as accessory factors. Family C polymerases are typically multi-subunit proteins with polymerizing and 3 to 5 exonuclease activity. In E. coli, three types of DNA polymerases have been found, DNA polymerases I (family A), II (family B), and III (family C). In eukaryotic cells, three different family B polymerases, DNA polymerases , , and are implicated in nuclear replication, and a family A polymerase, polymerase , is used for mitochondrial DNA replication. Exemplary DNA-dependent polymerases can include, but are not limited to, Taq polymerase or iProof DNA polymerases. See, e.g., U.S. Pat. No. 8,916,352.
[0039] Optionally, the DNA polymerase(s) can be linked to a non-specific DNA binding domain. Examples of such proteins include, but are not limited to, the Archaeal small basic DNA binding proteins Sso7d and Sso7d-like proteins (see, e.g., Choli et al., Biochimica et Biophysica Acta 950:193-203, 1988; Baumann et al., Structural Biol. 1:808-819, 1994; and Gao et al, Nature Struc. Biol. 5:782-786, 1998), Archaeal HMf-like proteins (see, e.g., Starich et al., J. Molec. Biol. 255:187-203, 1996; Sandman et al., Gene 150:207-208, 1994), and PCNA homologs (see, e.g., Cann et al., J. Bacteriology 181:6591-6599, 1999; Shamoo and Steitz, Cell:99, 155-166, 1999; De Felice et al., J. Molec. Biol. 291, 47-57, 1999; and Zhang et al., Biochemistry 34:10703-10712, 1995).
[0040] Sso7d and Sso7d-like proteins, Sac7d and Sac7d-like proteins, e.g., Sac7a, Sac7b, Sac7d, and Sac7e are small (about 7,000 kd MW), basic chromosomal proteins from the hyperthermophilic archaebacteria Sulfolobus solfataricus and S. acidocaldarius, respectively. These proteins are lysine-rich and have high thermal, acid and chemical stability. They bind DNA in a sequence-independent manner and when bound, increase the T.sub.m of DNA by up to 40 C. under some conditions (McAfee, Biochemistry 34:10063-10077, 1995; Gao et al., Nat. Struct. Biol. 5(9):782-786, 1998). These proteins and their homologs are typically believed to be involved in stabilizing genomic DNA at elevated temperatures. Suitable Sso7d-like DNA binding domains for use in the invention can be modified based on their sequence homology to Sso7d. Typically, DNA binding domains that are identical to or substantially identical to a known DNA binding protein over a comparison window of about 25 amino acids, optionally about 50-100 amino acids, or the length of the entire protein, can be used in the invention. The sequence can be compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the described comparison algorithms or by manual alignment and visual inspection. A variety of mutations in the Sso7 binding domain have been described in, e.g., US Patent Application Nos. 2005/0048530 and 2007/0141591.
[0041] The polypeptides can include additional amino acid sequences besides that of the two (or three) DNA polymerases and the linker(s). For example, in some embodiments, the polypeptide comprises additional sequence at the amino or carboxyl terminus of the polypeptide. Examples of such sequences include, but are not limited to, sequences for affinity purification of the polypeptide, or fluorescent proteins. In addition, in some embodiments, the polypeptide can include one or more fluorescent label or a fluorescent label/quencher pair.
III. Linkers
[0042] Two DNA polymerases as described can be joined via a linker by methods well known to those of skill in the art. These methods can include either chemical and recombinant means.
[0043] Chemical linking can be performed, for example, as described in Bioconjugate Techniques, Hermanson, Ed., Academic Press (1996). Joining can include, for example, derivitization for the purpose of linking the two proteins to each other, either directly or through a linking compound, by methods that are well known in the art of protein chemistry. For example, in one chemical conjugation embodiment, the means of linking the catalytic domain and the nucleic acid binding domain comprises a heterobifunctional-coupling reagent which ultimately contributes to formation of an intermolecular disulfide bond between the two moieties. Other types of coupling reagents that arc useful in this capacity for the present invention are described, for example, in U.S. Pat. No. 4,545,985. Alternatively, an intermolecular disulfide may conveniently be formed between cysteines in each moiety, which occur naturally or are inserted by genetic engineering. The means of linking moieties may also use thioether linkages between heterobifunctional crosslinking reagents or specific low pH cleavable crosslinkers or specific protease cleavable linkers or other cleavable or noncleavable chemical linkages. Other chemical linkers include carbohydrate linkers, lipid linkers, fatty acid linkers, polyether linkers, e.g., PEG, etc. For example, poly(ethylene glycol) linkers are available from Shearwater Polymers, Inc. Huntsville, Alabama. These linkers optionally have amide linkages, sulfhydryl linkages, or heterobifunctional linkages.
[0044] Linking two DNA polymerases may also comprise a peptidyl bond formed between moieties that are separately synthesized by standard peptide synthesis chemistry or recombinant means. The conjugate protein itself can also be produced using chemical methods to synthesize an amino acid sequence in whole or in part. For example, peptides can be synthesized by solid phase techniques, such as, e.g., the Merrifield solid phase synthesis method, in which amino acids are sequentially added to a growing chain of amino acids (see, Merrifield (1963) J. Am. Chem. Soc., 85:2149-2146). Equipment for automated synthesis of polypeptides is commercially available from suppliers such as PE Corp. (Foster City, Calif.), and may generally be operated according to the manufacturer's instructions. The synthesized peptides can then be cleaved from the resin, and purified, e.g., by preparative high performance liquid chromatography (see Creighton, Proteins Structures and Molecular Principles, 50-60 (1983)). The composition of the synthetic polypeptides or of subfragments of the polypeptide, may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure; see Creighton, Proteins, Structures and Molecular Principles, pp. 34-49 (1983)).
[0045] In addition, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the sequence. Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, -amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, -Abu, -Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxy-proline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, -alanine, fluoro-amino acids, designer amino acids such as -methyl amino acids, C-methyl amino acids, N-methyl amino acids, and amino acid analogs in general. Furthermore, the amino acid can be D (dextrorotary) or L (levorotary).
[0046] In some embodiments, two DNA polymerase are joined via a linking group. The linking group can be a chemical crosslinking agent, including, for example, succinimidyl-(N-maleimidomethyl)-cyclohexane-1-carboxylate (SMCC). The linking group can also be an additional amino acid sequence(s), including, for example, a polyalanine, polyglycine or similarly, linking group.
[0047] Alternatively, in some embodiments, the coding sequences of each DNA polymerase in the polypeptide are directly joined and expressed as a fusion protein. Alternatively, an amino acid linker sequence may also be encoded in the polypeptide coding sequence and employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures. Such an amino acid linker sequence is incorporated into the fusion protein using recombinant techniques well known in the art. Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes. Typical peptide linker sequences contain Gly, Ser, Val and Thr residues. Other near neutral amino acids, such as Ala can also be used in the linker sequence. Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al. (1985) Gene 40:39-46; Murphy et al. (1986) Proc. Natl. Acad. Sci. USA 83:8258-8262; U.S. Pat. Nos. 4,935,233 and 4,751,180. The linker sequence may generally be from 1 to about 50 amino acids in length, e.g., 3, 4, 6, or 10 amino acids in length, but can be 100 or 200 amino acids in length. Linker sequences may not be required when the second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
IV. Expression and Purification
[0048] Nucleic acids encoding the DNA polymerases can be obtained using routine techniques in the field of recombinant genetics. Basic texts disclosing the general methods of use in this invention include Sambrook and Russell, Molecular Cloning, A Laboratory Manual (3rd ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994-1999). Such nucleic acids may also be obtained through in vitro amplification methods such as those described herein and in Berger, Sambrook, and Ausubel, as well as Mullis et al., (1987) U.S. Pat. No. 4,683,202; PCR Protocols A Guide to Methods and Applications (Innis et al., eds) Academic Press Inc. San Diego, Calif. (1990) (Innis); Arnheim & Levinson (Oct. 1, 1990) C&EN 36-47; The Journal Of NIH Research (1991) 3: 81-94; Kwoh et al. (1989) Proc. Natl. Acad. Sci. USA 86: 1173; Guatelli et al. (1990) Proc. Natl. Acad. Sci. USA 87, 1874; Lomell et al. (1989) J. Clin. Chem., 35: 1826; Landegren et al., (1988) Science 241: 1077-1080; Van Brunt (1990) Biotechnology 8: 291-294; Wu and Wallace (1989) Gene 4: 560; and Barringer et al. (1990) Gene 89: 117, each of which is incorporated by reference in its entirety for all purposes and in particular for all teachings related to amplification methods.
[0049] One of skill will recognize that modifications can additionally be made to the DNA polymerases without diminishing their biological activity. Some modifications may be made to facilitate the cloning, expression, or incorporation of a domain into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, the addition of codons at either terminus of the polynucleotide that encodes the binding domain to provide, for example, a methionine added at the amino terminus to provide an initiation site, or additional amino acids (e.g., poly His) placed on either terminus to create conveniently located restriction sites or termination codons or purification sequences.
[0050] The fusion polypeptides as described herein can be expressed in a variety of host cells, including E. coli, other bacterial hosts, yeasts, filamentous fungi, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines. Techniques for gene expression in microorganisms are described in, for example, Smith, Gene Expression in Recombinant Microorganisms (Bioprocess Technology, Vol. 22), Marcel Dekker, 1994. Examples of bacteria that are useful for expression include, but are not limited to, Escherichia, Enterobacter, Azotobacter, Erwinia, Bacillus, Pseudomonas, Klebsielia, Proteus, Salmonella, Serratia, Shigella, Rhizobia, Vitreoscilla, and Paracoccus. Filamentous fungi that are useful as expression hosts include, for example, the following genera: Aspergillus, Trichoderma, Neurospora, Penicillium, Cephalosporium, Achlya, Podospora, Mucor, Cochliobolus, and Pyricularia. See, e.g., U.S. Pat. No. 5,679,543 and Stahl and Tudzynski, Eds., Molecular Biology in Filamentous Fungi, John Wiley & Sons, 1992. Synthesis of heterologous proteins in yeast is well known and described in the literature. Methods in Yeast Genetics, Sherman, F., et al., Cold Spring Harbor Laboratory, (1982) is a well-recognized work describing the various methods available to produce the enzymes in yeast.
[0051] There are many expression systems for producing the polypeptides that are well known to those of ordinary skill in the art. (See, e.g., Gene Expression Systems, Fernandex and Hoeffler, Eds. Academic Press, 1999; Sambrook and Russell, supra; and Ausubel et al, supra.) Typically, the polynucleotide that encodes the polypeptide is placed under the control of a promoter that is functional in the desired host cell. Many different promoters are available and known to one of skill in the art, and can be used in the expression vectors of the invention, depending on the particular application. Ordinarily, the promoter selected depends upon the cell in which the promoter is to be active. Other expression control sequences such as ribosome binding sites, transcription termination sites and the like are also optionally included. Constructs that include one or more of these control sequences are termed expression cassettes. Accordingly, the nucleic acids that encode the joined polypeptides are incorporated for high level expression in a desired host cell.
[0052] Expression control sequences that are suitable for use in a particular host cell are often obtained by cloning a gene that is expressed in that cell. Commonly used prokaryotic control sequences, which are defined herein to include promoters for transcription initiation, optionally with an operator, along with ribosome binding site sequences, include such commonly used promoters as the beta-lactamase (penicillinase) and lactose (lac) promoter systems (Change et al., Nature (1977) 198: 1056), the tryptophan (trp) promoter system (Goeddel et al., Nucleic Acids Res. (1980) 8: 4057), the tac promoter (DeBoer, et al., Proc. Natl. Acad. Sci. U.S.A. (1983) 80:21-25); and the lambda-derived PL promoter and N-gene ribosome binding site (Shimatake et al., Nature (1981) 292: 128). The particular promoter system is not critical; any available promoter that functions in prokaryotes and provides the desired level of activity can be used. Standard bacterial expression vectors include plasmids such as pBR322-based plasmids, e.g., pBLUESCRIPT, pSKF, pET23D, lambda-phage derived vectors, and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc, HA-tag, 6-His tag, maltose binding protein, VSV-G tag, anti-DYKDDDDK tag, or any such tag, a large number of which are well known to those of skill in the art.
[0053] For expression in prokaryotic cells other than E. coli, a promoter that functions in the particular prokaryotic species is required. Such promoters can be obtained from genes that have been cloned from the species, or heterologous promoters can be used. For example, the hybrid trp-lac promoter functions in Bacillus sp. in addition to E. coli. These and other suitable bacterial promoters are well known in the art and are described, e.g., in Sambrook et al. and Ausubel et al. Bacterial expression systems for expressing the proteins of the invention are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al., Gene 22:229-235 (1983); Mosbach et al., Nature 302:543-545 (1983). Kits for such expression systems are commercially available.
[0054] Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available. In yeast, vectors include Yeast Integrating plasmids (e.g., YIp5) and Yeast Replicating plasmids (the YRp series plasmids) and pGPD-2. Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
[0055] Either constitutive or regulated promoters can be used. Regulated promoters can be advantageous because the host cells can be grown to high densities before expression of the fusion polypeptides is induced. High level expression of heterologous proteins slows cell growth in some situations. An inducible promoter is a promoter that directs expression of a gene where the level of expression is alterable by environmental or developmental factors such as, for example, temperature, pH, anaerobic or aerobic conditions, light, transcription factors and chemicals.
[0056] For E. coli and other bacterial host cells, inducible promoters are known to those of skill in the art. These include, for example, the lac promoter, the bacteriophage lambda P.sub.L promoter, the hybrid trp-lac promoter (Amann et al. (1983) Gene 25: 167; de Boer et al. (1983) Proc. Nat'l. Acad. Sci. USA 80: 21), and the bacteriophage T7 promoter (Studier et al. (1986) J. Mol. Biol.; Tabor et al. (1985) Proc. Nat'l Acad. Sci. USA 82: 1074-8). These promoters and their use are also discussed in Sambrook et al., supra.
[0057] Translational coupling may be used to enhance expression. The strategy uses a short upstream open reading frame derived from a highly expressed gene native to the translational system, which is placed downstream of the promoter, and a ribosome binding site followed after a few amino acid codons by a termination codon. Just prior to the termination codon is a second ribosome binding site, and following the termination codon is a start codon for the initiation of translation. The system dissolves secondary structure in the RNA, allowing for the efficient initiation of translation. See Squires, et. al. (1988), J. Biol. Chem. 263: 16297-16302.
[0058] The construction of polynucleotide constructs generally requires the use of vectors able to replicate in bacteria. Such vectors are commonly used in the art. A plethora of kits are commercially available for the purification of plasmids from bacteria (for example, EasyPrep, FlexiPrep, from Pharmacia Biotech; StrataClean, from Stratagene; and, QIAexpress Expression System, Qiagen). The isolated and purified plasmids can then be further manipulated to produce other plasmids, and used to transform cells.
[0059] The polypeptides described herein can be expressed intracellularly, or can be secreted from the cell. Intracellular expression often results in high yields. If necessary, the amount of soluble, active fusion polypeptide may be increased by performing refolding procedures (see, e.g., Sambrook et al., supra.; Marston et al., Bio/Technology (1984) 2: 800; Schoner et al., Bio/Technology (1985) 3: 151). Polypeptides can be expressed in a variety of host cells, including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines. The host cells can be mammalian cells, insect cells, or microorganisms, such as, for example, yeast cells, bacterial cells, or fungal cells.
[0060] Once expressed, the polypeptides can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like (see, generally, R. Scopes, Protein Purification, Springer-Verlag, N.Y. (1982), Deutscher, Methods in Enzymology Vol. 182: Guide to Protein Purification., Academic Press, Inc. N.Y. (1990)). Substantially pure compositions of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity are most preferred. Once purified, partially or to homogeneity as desired, the polypeptides may then be used (e.g., as immunogens for antibody production).
[0061] To facilitate purification of the polypeptides, the nucleic acids that encode the polypeptides can also include a coding sequence for an epitope or tag for which an affinity binding reagent is available. Examples of suitable epitopes include the myc and V-5 reporter genes; expression vectors useful for recombinant production of fusion polypeptides having these epitopes are commercially available (e.g., Invitrogen (Carlsbad Calif.) vectors pcDNA3.1/Myc-His and pcDNA3.1/V5-His are suitable for expression in mammalian cells). Additional expression vectors suitable for attaching a tag to the fusion proteins of the invention, and corresponding detection systems are known to those of skill in the art, and several are commercially available (e.g., FLAG (Kodak, Rochester N.Y.). Another example of a suitable tag is a polyhistidine sequence, which is capable of binding to metal chelate affinity ligands. Typically, six adjacent histidines are used, although one can use more or less than six. Suitable metal chelate affinity ligands that can serve as the binding moiety for a polyhistidine tag include nitrilo-tri-acetic acid (NTA) (Hochuli, E. (1990) Purification of recombinant proteins with metal chelating adsorbents In Genetic Engineering: Principles and Methods, J. K. Setlow, Ed., Plenum Press, N.Y.; commercially available from Qiagen (Santa Clarita, Calif.)).
[0062] One of skill in the art would recognize that after biological expression or purification, the polymerase peptide (s) may possess a conformation substantially different than the native conformations of the constituent polypeptides. In this case, it may be necessary or desirable to denature and reduce the polypeptide and then to cause the polypeptide to re-fold into the preferred conformation. Methods of reducing and denaturing proteins and inducing re-folding are well known to those of skill in the art (See, Debinski et al. (1993) J. Biol. Chem. 268: 14065-14070; Kreitman and Pastan (1993) Bioconjug. Chem. 4: 581-585; and Buchner et al. (1992) Anal. Biochem. 205: 263-270). Debinski et al., for example, describe the denaturation and reduction of inclusion body proteins in guanidine-DTE. The protein is then refolded in a redox buffer containing oxidized glutathione and L-arginine.
V. Methods of Use
[0063] Reverse transcription (RT) is an amplification method that copies RNA into DNA. RT reactions can be performed with reaction mixtures as described herein. For example, the invention provides for reverse transcribing one or more RNA (including for example, all RNA in a cell, e.g., to make a cDNA library) under conditions to allow for reverse transcription and generation of a first and optionally second strand cDNA. The RT reaction can be primed with a random primer, an oligo dT, or an RNA-specific primer. Components and conditions for RT reactions are generally known.
[0064] If desired, the reactions can further comprise RT-PCR. Standard techniques for performing PCR assays are known in the art (PCR Technology: Principles and Applications for DNA Amplification (Erlich, ed., 1989); PCR Protocols: A Guide to Methods and Applications (Innis, Gelfland, Sninsky, &, White, eds., 1990); Mattila et al., Nucleic Acids Res. 19: 4967 (1991); Eckert & Kunkel, PCR Methods and Applications 1: 17 (1991); Wallace et al., Ligase Chain Reaction, in Technologies for Detection of DNA Damage and Mutations, pp. 307-322 (Pfiefer, ed., 1996)). RT and PCR reactions are often used in the same assay and are referred to as RT-PCR. RT-PCR combines reverse transcription of RNA into DNA and subsequent DNA amplification reactions in a single reaction. Optimal reverse transcription, hybridization, and amplification conditions will vary depending upon the sequence composition and length(s) of the primers and target(s) employed, and the experimental method selected by the practitioner. Various guidelines may be used to select appropriate primer sequences and hybridization conditions (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd ed.) (1989); Ausubel, F. M. et al., eds. (1999) Short Protocols in Molecular Biology, 4th edition, John Wiley & Sons); Ausubel, F. M. et al., eds. (1999-2010) Current Protocols in Molecular Biology, John Wiley & Sons).
[0065] The practice of the present invention can employ conventional methods of chemistry, biochemistry, molecular biology, cell biology, genetics, immunology and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Gennaro, A. R., ed. (1990) Remington's Pharmaceutical Sciences, 18th ed., Mack Publishing Co.; Hardman, J. G., Limbird, L. E., and Gilman, A. G., eds. (2001) The Pharmacological Basis of Therapeutics, 10th ed., McGraw-Hill Co.; Colowick, S. et al., eds., Methods In Enzymology, Academic Press, Inc.; Weir, D. M., and Blackwell, C. C., eds. (1986) Handbook of Experimental Immunology, Vols. I-IV, Blackwell Scientific Publications; Maniatis, T. et al., eds. (1989) Molecular Cloning: A Laboratory Manual, 2nd edition, Vols. I-III, Cold Spring Harbor Laboratory Press; Ausubel, F. M. et al., eds. (1999-2010) Current Protocols in Molecular Biology, John Wiley & Sons; Ream et al., eds. (1998) Molecular Biology Techniques: An Intensive Laboratory Course, Academic Press; Newton, C. R., and Graham, A., eds. (1997) PCR (Introduction to Biotechniques Series), 2nd ed., Springer Verlag; Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd ed.) (1989).
[0066] An advantage of the reaction mixtures of the invention is that the reaction mixtures allow for use of a reverse transcriptase in an RT or DNA-dependent DNA polymerase reaction at a higher temperature than would otherwise be possible. Thus, in embodiments, the dimeric or trimeric enzymes described herein can be used at, 37 or 42 C., or a temperature greater than 42 C., for example, between 43-55, 45-56, 45-65 C., etc. Higher temperature RT reactions are particularly helpful in situations where the template RNA forms secondary structure at normal RT temperatures (e.g., 37 or 42 C.) that partially or completely inhibit reverse transcription.
[0067] In cases in which the polypeptide as described herein comprises one or two DNA-dependent DNA polymerases, the polypeptide can be used in a primer extension reaction in a template-dependent manner. In some embodiments, the primer extension reaction is an amplification reaction. In some embodiments, the amplification reaction is monitored in real-time and optionally is used to quantify the initial amount of target nucleic acid.
[0068] Such amplification reactions include without limitation polymerase chain reaction (PCR), DNA ligase chain reaction (LCR), and RNA transcription-based (such as TAS and 3SR) amplification reactions as well as others known to those of skill in the art. Polymerase chain reactions that can be conducted using the compositions described herein include without limitation reverse-transcription PCR (rt-PCR) and quantitative PCR (qPCR).
[0069] In some embodiments, dye-based qPCR detection methods are used to monitor amplification reactions utilizing components of the invention. Such detection methods generally rely on monitoring the increase in fluorescence signal due to the binding of DNA-binding dye to the amplified DNA. For example, SYBR Green I, a commonly used fluorescent DNA binding dye, binds all double-stranded DNA and detection is monitored by measuring the increase in fluorescence throughout the cycle. SYBR Green I has an excitation and emission maxima of 494 nm and 521 nm, respectively.
[0070] In other embodiments, probe-based qPCR detection methods are used to monitor amplification reactions utilizing components of the invention. Such detection methods generally rely on the sequence-specific detection of a desired PCR product. Unlike dye-based qPCR methods that detect all double-stranded DNA, probe-based qPCR utilizes a fluorescent-labeled target-specific probe, which detects specific sequences in the amplified DNA.
VI. Reaction Mixtures
[0071] Reaction mixtures comprising the polypeptides described herein are provided. The reaction mixtures can comprise, for example, a target nucleic acid, e.g., an RNA target where reverse transcription is to take place, or DNA where a DNA-dependent polymerase reaction is to take place. The reaction mixtures can comprise appropriate nucleotides (e.g., deoxynucleotides (dNTPs) or dideoxynucleotides) and in some embodiments, at least one buffer. Exemplary buffers can include, for example and without limitation, Tris, HEPES, ACES, PIPES, MOPSO, BES, MOPS, TES, TAPSO, POPSO, BICINE, TAPS, or AMPSO. The reaction mixtures can optionally comprise one or more oligonucleotides that function as a primer for template-dependent nucleic acid extension, one or more oligonucleotides that function as a probe (e.g., linked to a label such as a quencher, fluorescent dye, etc.), and/or a double stranded DNA binding dye (e.g., SYBRGREEN). In some embodiments, the reaction mixture will further comprises a separate DNA-dependent DNA polymerase. In some embodiments, the reaction mixture will further comprises magnesium (Mg++).
VII. Kits
[0072] In one aspect, kits for conducting nucleic acid extension (and optionally cyclic amplification, e.g., such as PCR) reactions are provided. In some embodiments, such kits include polymerases, and optionally dNTPs, and at least one buffer. Such kits may also include stabilizers and other additives (e.g., heparin and/or sarcosine) to increase the efficiency of the amplification reactions. Such kits may also include one or more primers as well as instructions for conducting nucleic acid amplification reactions using the components of the kits. In some embodiments, the kits will further comprises a separate DNA-dependent DNA polymerase.
EXAMPLES
Methods and Materials
Cloning and Expression:
[0073] MLV reverse transcriptase gene was cloned into the pET28 vector by PCR to amplify the gene and followed by restriction enzyme digestion and ligation. The expression construct contained a gene encoding a histidine tag that was fused to the N-terminus of the reverse transcriptase. Two MLV genes were linked together through a linker sequence that contains restriction sites HindIII, NheI, and SacI.
[0074] The expression plasmid was transformed into E. coli BL21/DE3 cells. The cells containing the expression plasmid were inoculated for overnight culturing in LB medium, 1/100 of the culture was used to seed a fresh LB medium the following morning. Cells were grown at 16 C. After cell density reached OD600=0.6 to 0.8, IPTG was added to 0.1mM to induce the protein expression. Cells were collected 15 hrs after induction.
TABLE-US-00001 MLVRTaasequence SEQIDNO:1: TLNIEDEHRLHETSKEPDVSLGSTWLSDFPQAWAETGGMGLAVRQAPLIEPLKATSTPVSI KQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKKPGTNDYRPVQDLREVNK RVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEMGIS GQLTWTRLPQGFKNSPTLFDEALBRDLADFRIQHPDLELLQYVDDLLLAATSELDCQQG TRALLQTLGNLGYRASAKKAQICQKQVKYLGYLLKEGQRWLTEARKETVMGQPTPKT PRQLREFLGTAGFCRLWIPGFAEMAAPLYPLTKTGTLFNWGPDQQKAYQEIKQALLTAP ALGLPDLTKPFELFVDEKQGYAKGVLTQKLGPWRRPVAYLSKKLDPVAAGWPPCLRM VAAIAVLTKDAGKLTMGQPLVILAPHAVEALVKQPPDRWLSNARMTHYQALLLDTDR VQFGPVVALNPATLLPLPEEGLQHNCLDILAEAHGTRPDLTDQPLPDADHTWYTDGSSL LQEGQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRY AFATAHIHGEIYRRRGLLTSEGKEIKNKDEILALLKALFLPKRLSIIHCPGHQKGHSAEAR GNRMADQAARKAAITETPDTSTLL FLVRTaasequence SEQIDNO:2: TLQLEEEYRLFEPESTQKQEMDIWLKNFPQAWAETGGMGMAHCQAPVLIQLKATATPIS IRQYPMPHEAYQGIKPHIRRMLDQGILKPCQSPWNTPLLPVKKPGTKDYRPVQDLREVN KRVEDIHPTVPNPYNLLSTLPPSHPWYTVLDLKDAFFCLRLHSESQLLFAFEWRDPEIGLS GQLTWTRLPQGFKNSPTLFDEALHSDLADFRVRYPALVLLQYVDDLLLAAATRTECLEG TKALLETLGNKGYRASAKKAQICLQEVTYLGYSLKDGQRWLTKARKEAILSIPVPKNPR QVREFLGTAGYCRLWIPGFAELAAPLYPLTRPGTLFQWGTEQQLAFENIRKALLSSPALG LPDITKPFELFIDENSGFAKGVLVQKLGPWKRPVAYLSKKLDTVASGWPPCLRMVAAIA ELVKDAGKLTLGQPLTILTSHPVEALVRQPPNKWLSNARMTHYQAMLLDAERVHFGPT VSLNPATLLPLPSGKPPRLSPDLAETMAQTDLTDQPLPDADLTWYTDGSSFIRNGERKAG AAVTTESEVIWAASLPPGTSAQRAELIALTQALKMAKGKKLTVYTDSRYAFATAHVHG EIYRRRGLLTSEGKEIKNKNEILALLEALFLPKRLSIIHCPGHQKGDSPQAKGNRLADDTA KKAATETQSSLTIL MMDimericRTsequence(linkerunderlined) SEQIDNO:3: EFTLNIEDEHRLITETSKEPDVSLGSTWLSDFPQAWAETGGMGLAVRQAPLIIPLKATSTP VSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKKPGTNDYRPVQDLREV NKRVEDIFIPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEM GISGQLTWTRLPQGFKNSPTLFDEALIIRDLADFRIQHPDLILLQYVDDLLLAATSELDCQ QGTRALLQTLGNLGYRASAKKAQICQKQVKYLGYLLKEGQRWLTEARKETVMGQPTP KTPRQLREFLGTAGFCRLWIPGFAEMAAPLYPLTKTGTLFNVVGPDQQKAYQEIKQALLT APALGLPDLTKPFELFVDEKQGYAKGVLTQKLGPWRRPVAYLSKKLDPVAAGWPPCLR MVAAIAVLTKDAGKLTMGQPLVILAPHAVEALVKQPPDRWLSNARMTHYQALLLDTD RVQFGPVVALNPATLLPLPEEGLQHNCLDILAEAHGTRPDLTDQPLPDADHTWYTDGSS LLQEGQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSR YAFATAHIHGEIYRRRGLLTSEGKEIKNKDEILALLKALFLPKRLSIEFICPGHQKGHSAEA
Enzyme purification:
[0075] E.coli cells expressed the enzyme were re-suspended in a lysis buffer. Cells were disrupted on ice with pulses of sonication (230 sec, duty cycle 80%, output 10), and centrifuged at 19,000 rpm for 10 min. The supernatant was filtered through a 0.22 um filtration unit, diluted with 10 buffer A for iMAC chromatography (50 mM KPO4, pH6.5, 300 mM KCl, 0.1% Tween 20), and loaded onto a Nuvia iMAC column. The enzyme was eluted with a linear gradient to buffer B (buffer A plus 500 mM imidazole). The fraction containing the enzyme was pooled and concentrated with an Amicon Ultra-15 centrifugal filter unit. The sample was applied to a size exclusion column (SEC650), the fractions containing the purified enzyme was collected.
RT-qPCR Assay:
[0076] iScript Advanced reverse transcription mix was used for the reverse transcription of cDNA. The purified enzyme was added into the reaction. iScript advanced reverse transcriptase was used as a control. In order to study the effect of temperature on cDNA synthesis the reverse transcription reaction was carried out at 42, 55, and 60 C for 30 min respectively. The cDNA synthesis speed by the purified enzymes was also compared to the iScript Advanced reverse transcriptase, in which the reverse transcription was carried out in iScript Advanced reaction mix for 30, 2, 1 min respectively. After the cDNA synthesis, qPCR was performed on different targets. To assess the performance of the cDNA synthesis, delta Cq (dCq) was calculated using a cDNA reaction at 42 C for 30 min as a control.
TABLE-US-00002 TABLE 1 Dimeric MLV RTs (MNM and MM) displayed better thermostability than the wild type control. Two-step RT-qPCR was performed on 6 different targets. MNM MM Control MNM MM Control MNM MM Control APC CBP beta Actin Cq 42 C. 25.19 26.99 25.17 26.65 27.20 26.78 16.20 16.89 16.46 55 C. 26.26 26.75 26.30 27.74 28.27 29.21 17.32 17.71 19.23 60 C. 26.21 27.21 26.73 27.65 28.38 29.52 17.26 17.56 19.38 dCq 55 C.-42 C. 1.07 0.24 1.13 1.10 1.07 2.43 1.12 0.82 2.77 60 C.-42 C. 1.01 0.22 1.56 1.00 1.19 2.74 1.06 0.67 2.92 GAPDH 18s Tub Cq 42 C. 16.59 17.45 16.16 4.58 5.15 4.88 18.61 19.23 18.49 55 C. 17.13 18.48 18.62 10.54 10.89 14.08 19.37 20.09 21.14 60 C. 17.15 18.68 19.24 10.96 11.45 14.68 19.24 19.92 21.53 dCq 55 C.-42 C. 0.54 1.02 2.46 5.96 5.74 9.20 0.76 0.86 2.64 60 C.-42 C. 0.56 1.22 3.08 6.38 6.30 9.80 0.63 0.69 3.03
TABLE-US-00003 TABLE 2 Additional dimeric RTs displayed better thermostability than the wild type control. The template target was human GAPDH. MF MNF MM MNM FNM RT control Cq (55 C.) 20.64 20.88 16.91 16.64 21.63 17.16 Cq (42 C.) 19.60 19.70 15.99 15.86 20.75 13.28 dCq 1.04 1.18 0.92 0.78 0.88 3.88 Cq (60 C.) 21.32 20.79 17.58 17.35 21.54 19.40 Cq (42 C.) 18.41 18.39 14.67 14.65 19.66 13.30 dCq 2.91 2.39 2.91 2.69 1.88 6.10 Cq (42 C. 5 min) 18.63 18.62 14.63 14.55 19.53 16.06 Cq (42 C. 30 min) 18.41 18.39 14.67 14.65 19.66 13.30 dCq 0.22 0.23 0.04 0.11 0.13 2.76 Cq (42 C. 2.5 min) 19.54 19.60 15.35 15.19 20.41 17.00 Cq (42 C. 30 min) 18.41 18.39 14.67 14.65 19.66 13.30 dCq 1.13 1.21 0.68 0.53 0.75 3.70 MF: MLVRT-FLVRT dimer; MNF: MLVRT RNaseH()-FLVRT dimer; MM: MLVRT-MLVRT dimer; MNM: MLVRT RNaseH()-MLVRT dimer; FNM: FLVRT RNaseH()-MLVRT dimer; RT control: Purified monomeric RT.
[0077] All five dimeric RT's exhibited better stability than the monomeric RT control at the two temps, as shown for example by the lower dCq values. All five dimeric RTs also exhibited reduced reaction time vs the RT control.
[0078] The examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.