Method of inhibiting angiogenesis using inhibitors of G-protein-coupled receptor kinase interacting protein-1 (GIT1)
09670259 ยท 2017-06-06
Assignee
Inventors
- Bradford C. Berk (Pittsford, NY, US)
- Jinjiang Pang (Rochester, NY, US)
- Syamantak Majumder (Rochester, NY, US)
Cpc classification
A61K39/3955
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61K38/16
HUMAN NECESSITIES
A61K47/66
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
Abstract
The present invention is directed to methods and compositions comprising G-protein-coupled receptor kinase interacting protein-1 (GIT1) inhibitors that are suitable for inhibiting angiogenesis in a subject and treating related conditions.
Claims
1. A method of inhibiting angiogenesis in a subject comprising: selecting a subject having a condition associated with abnormal angiogenesis and administering a G-protein-coupled receptor kinase interacting protein-1 (GIT1) inhibitor to the selected subject, wherein the GIT1 inhibitor is (i) an antibody or antigen-binding portion thereof that binds to at least a portion of an amino acid sequence of SEQ ID NO: 8, or (ii) a peptide comprising the amino acid sequence of SEQ ID NO: 17 or SEQ ID NO: 18, under conditions effective to inhibit angiogenesis in the selected subject.
2. The method of claim 1, wherein the condition associated with abnormal angiogenesis is selected from the group consisting of cancer, macular degeneration, and pulmonary arterial hypertension.
3. The method of claim 1, wherein the at least a portion of the amino acid sequence of SEQ ID NO: 8 bound by the antibody or antigen-binding portion thereof comprises an ankyrin repeat domain sequence (TPLH) of SEQ ID NO: 8.
4. The method of claim 1, wherein the antibody or antigen-binding portion thereof binds to at least a portion of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO: 6.
5. The method of claim 1, wherein the GIT1 inhibitor is administered via a delivery vehicle.
6. The method of claim 5, wherein the delivery vehicle is selected from the group consisting of viral vectors, biodegradable microspheres, microparticles, nanoparticles, liposomes, collagen minipellets, and cochleates.
7. The method of claim 6, wherein the delivery vehicle is a nanoparticle.
8. The method of claim 1, wherein the GIT1 inhibitor is coupled to an endothelial cell-targeting moiety.
9. The method of claim 8, wherein the endothelial cell-targeting moiety is an endothelial cell surface receptor ligand selected from the group consisting of vascular endothelial growth factor (VEGF), fibroblast growth factor (FGF), integrin, fibronectin, intracellular adhesion molecule (ICAM), platelet derived growth factor (PDGF), P-selectin ligand, vascular cell adhesion molecule (VCAM-1) ligand, and ICAM-1 ligand.
10. The method of claim 8, wherein the endothelial cell-targeting moiety comprises a tripeptide sequence of Arg-Gly-Asp (RGD) or Asn-Gly-Arg (NGR).
11. The method of claim 1, wherein the GIT1 inhibitor is administered via a nanoparticle delivery vehicle coupled to an endothelial cell-targeting moiety.
12. The method of claim 1, wherein the GIT1 inhibitor is coupled to a cell-penetrating moiety.
13. The method of claim 12, wherein the cell-penetrating moiety comprises a trans-activator of transcription (TAT) peptide.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
DETAILED DESCRIPTION OF THE INVENTION
(20) A first aspect of the present invention relates to a method of inhibiting angiogenesis in a subject. This method involves selecting a subject having a condition associated with abnormal angiogenesis and administering a G-protein-coupled receptor kinase interacting protein-1 (GIT1) inhibitor to the selected subject under conditions effective to inhibit angiogenesis in the subject.
(21) In accordance with this aspect of the present invention, the subject has a condition associated with abnormal angiogenesis, i.e., a condition associated with increased or enhanced angiogenesis. Conditions associated with abnormal angiogenesis include, without limitation, cancer, metastatic cancer, macular degeneration, and pulmonary arterial hypertension.
(22) As used herein, subject refers to any animal, preferably a mammal, that is amenable to treatment in accordance with the methods of the present invention. Preferably, the subject is a mammal. Exemplary mammalian subjects include, without limitation, humans, non-human primates, dogs, cats, rodents (e.g., mouse, rat, guinea pig), horses, cattle and cows, sheep, and pigs.
(23) GIT1 is a multi-domain scaffold protein that binds to the G-protein coupled receptor kinase-2 (GRK2) and plays a role in many cellular functions including receptor internalization, focal adhesion remodeling, and signaling pathways of both G-protein coupled receptors (GPCRs) and tyrosine kinase receptors. The full-length GIT1 protein has an N-terminal ARF GTPase activating protein domain, three ankyrin repeats, a Spa2-homology domain (SHD), a coiled-coil domain and a paxillin-binding site (PBS). The full-length amino acid sequence of human GIT1 is provided below as SEQ ID NO: 1
(24) TABLE-US-00001 1msrkgpraevcadcsapdpgwasisrgvlvcdeccsvhrslgrhisivkhlrhsawpptl 61lqmvhtlasngansiwehslldpaqvqsgrrkanpqdkvhpiksefirakyqmlafvhkl 121pcrdddgvtakdlskqlhssvrtgnletclrllslgaqanffhpekgttplhvaakagqt 181lqaellvvygadpgspdvngrtpidyarqaghhelaerlvecqyeltdrlafylcgrkpd 241hknghyiipqmadsldlselakaakkklqalsnrlfeelamdvydevdrrendavwlatq 301nhstivtersavpflpvnpeysatrnqgrqklarfnarefatliidilseakrrqqgksl 361ssptdnlelslrsqsdlddqhdydsvasdedtdqeplrstgatrsnrarsmdssdlsdga 421vtlqeylelkkalatseakvqqlmkvnsslsdelrrlqreihklqaenlqlrqppgpvpt 481pplpseraehtpmapggsthrrdrqafsmyepgsalkpfggppgdelttrlqpfhstele 541ddaiysvhvpaglyrirkgvsasavpftpsspllscsqegsrhtsklsrhgsgadsdyen 601tqsgdpllglegkrflelgkeedfhpelesldgdldpglpstedvilkteqvtkniqell 661raagefkhdsfvpcsekihlavtemaslfpkrpalepvrsslrllnasayrlqsecrktv 721ppepgapvdfqlltqqviqcaydiakaakqlvtittrekkq
(25) As demonstrated herein, GIT1 is an important regulator of angiogenesis via its role in mediating the VEGFR-Notch1-Delta like ligand 4 (Dll4) signaling pathway. Specifically, GIT1 competes with Notch binding to recombining binding protein suppressor of hairless (RBP-J) via its ankyrin repeat domain to enhance angiogenesis.
(26) In one embodiment of this aspect of the present invention, the GIT1 inhibitor is a GIT1 inhibitory peptide. One class of suitable GIT1 inhibitor peptides include peptides comprising the ankyrin repeat domain of GIT1 or any portion thereof. These peptides serve as blocking peptides, blocking GIT1 protein from binding to RBP-J, thereby inhibiting angiogenesis. Accordingly, peptides comprising the ankyrin repeat domain or a portion thereof, are useful for inhibiting angiogenesis in subjects having a condition associated with impaired angiogenesis.
(27) The ankyrin repeat domain of GIT1 spans amino acid residues 132-228 of the full-length human GIT1 amino acid sequence of SEQ ID NO: 1 (shown below as SEQ ID NO: 2).
(28) TABLE-US-00002 (SEQIDNO:2) kdlskqlhssvrtgnletclrllslgaganffhpekgttp lhvaakagqtlqaellvvygadpgspdvngrtpidyarqa ghhelaerlvecqyeltd
(29) The ankyrin repeat domain (ANK) of GIT1 is highly conserved across various species, including mouse, rat, chick, and drome as demonstrated by the sequence alignment shown in
(30) It is to be understood that the present invention contemplates the use of any mammalian or non-mammalian GIT1 ANK peptide sequence corresponding to the GIT1 ANK peptide of SEQ ID NO: 2 above. Homologous GIT1 peptides from mammals and non-mammals other than those described above are preferably characterized by an amino acid identity of at least about 60 percent, more preferably at least about 70 percent or 80 percent, most preferably at least about 85 percent or 90 percent or 95 percent as compared to human GIT1 ANK peptide of SEQ ID NO: 2.
(31) As noted above, there are three ANK repeats within the ANK domain of the GIT1 amino acid sequence, and smaller peptides comprising any one of the individual ANK repeats are considered to be therapeutically useful GIT1 inhibitory peptides in accordance with this aspect of the present invention. Accordingly, a suitable therapeutic GIT1 peptide comprises an amino acid sequence corresponding to the first ANK repeat, i.e., residues 1-30 of SEQ ID NOs: 7 or 8, including amino acid residues 132-161 of SEQ ID NO:1 or residues 1-30 of SEQ ID NO: 2 (DLSKQLHSSVRTGNLETCLRLLSLGAQANF). A suitable therapeutic GIT1 peptide may also comprise an amino acid sequence corresponding to the second ANK repeat which spans residues 35-64 of SEQ ID NOs:7 or 8, including amino acid residues 166-195 of SEQ ID NO: 1 or residue 35-64 of SEQ ID NO: 2 (KGTTPLHVAAKAGQTLQAELLVVYGADPGS). A suitable GIT1 therapeutic ANK peptide may also include a fragment of the second ANK repeat corresponding to amino acid residues 36-48 of SEQ ID NOs: 7 or 8, including amino acid residues 167-179 of SEQ ID NO:1 or 36-48 of SEQ ID NO:2 (GTTPLHVAAKAGQ). A suitable GIT1 therapeutic ANK peptide also comprises an amino acid sequence corresponding to the third ANK repeat which spans amino acid residues 68-97 of SEQ ID NOs: 7 or 8, including amino acid residues 199-228 of SEQ ID NO: 1 or residues 68-97 of SEQ ID NO: 2 (NGRTPIDYARQAGHHELAERLVECQYELTD). According to this aspect of the present invention, therapeutically useful GIT1 peptides for inhibiting angiogenesis comprise these individual ANK repeat sequences or fragments thereof.
(32) Other suitable GIT1 inhibitory peptides includes dominant negative GIT1 peptides that interfere with activation of GIT1-dependent signaling pathways by molecules such as VEGF. An exemplary inhibitor peptide of the present invention is a peptide that mimics a region of the SHD domain of GIT1 (i.e., amino acid residues 250-420 of SEQ ID NO: 1), which is involved in GIT1 signaling through PLC (see
(33) Such inhibitory peptides may be chemically synthesized using known peptide synthesis methodology or may be prepared and purified using recombinant technology. Such peptides are usually at least about 5 amino acids in length, but can be anywhere from 5 to 100 amino acids in length. Such peptides may be identified without undue experimentation using well known techniques. Techniques for screening peptide libraries for peptides that are capable of specifically binding to a polypeptide target, in this case GIT1, are well known in the art (see e.g., U.S. Pat. No. 5,556,762 to Pinilla et al.; U.S. Pat. No. 5,750,373 to Garrard et al.; U.S. Pat. No. 4,708,871 to Geysen; U.S. Pat. No. 4,833,092 to Geysen; U.S. Pat. No. 5,223,409 to Ladner et al.; U.S. Pat. No. 5,403,484 to Ladner et al.; U.S. Pat. No. 5,571,689 to Heuckeroth et al.; U.S. Pat. No. 5,663,143 to Ley et al.; and PCT Publication Nos. WO84/03506 to Geysen and WO84/03564 to Geysen, which are hereby incorporated by reference in their entirety).
(34) In another embodiment of this aspect of the present invention, the GIT1 inhibitor is an antibody or antigen binding portion thereof that binds to a GIT1 ankyrin repeat domain. Accordingly, a suitable antibody or antigen binding portion thereof is one that binds to at least a portion of an amino acid sequence of SEQ ID NO: 7. Alternatively, the antibody or antigen binding portion thereof binds to at least a portion of an amino acid sequence of SEQ ID NO: 8. In another embodiment of the present invention, the antibody or antigen binding portion thereof binds to at least a portion of an amino acid sequence of SEQ ID NO:2, or at least a portion of an amino acid sequence selected from the group consisting of SEQ ID NOs: 3-6. In a preferred embodiment of this aspect of the present invention, the antibody or binding portion thereof binds to the portion of SEQ ID NO: 2-8 containing the ankyrin repeat domain sequence, i.e., TTPLH (SEQ ID NO:16).
(35) An antibody of the present invention encompasses any immunoglobulin molecule that specifically binds to a GIT1 ankyrin repeat domain as described above. As used herein, the term antibody is meant to include intact immunoglobulins derived from natural sources or from recombinant sources, as well as immunoreactive portions (i.e., antigen binding portions) of intact immunoglobulins. The antibodies of the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, intracellular antibodies (intrabodies), antibody fragments (e.g. Fv, Fab and F(ab)2), as well as single chain antibodies (scFv), chimeric antibodies, and humanized antibodies (Ed Harlow and David Lane, U
(36) Methods for monoclonal and polyclonal antibody production may be carried out using the techniques described herein or other well-known in the art (M
(37) For monoclonal antibody production, the process generally involves obtaining immune cells (lymphocytes) from the spleen of a mammal which has been previously immunized with the antigen of interest (i.e., a GIT1 peptide comprising the ankyrin repeat domain, e.g. SEQ ID NOs: 2-8 or any portion thereof as described supra) either in vivo or in vitro. The antibody-secreting lymphocytes are fused with myeloma cells or transformed cells, which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line. Fusion with mammalian myeloma cells or other fusion partners capable of replicating indefinitely in cell culture is achieved by standard and well-known techniques, for example, by using polyethylene glycol (PEG) or other fusing agents (Milstein and Kohler, Derivation of Specific Antibody-Producing Tissue Culture and Tumor Lines by Cell Fusion, Eur J Immunol 6:511 (1976), which is hereby incorporated by reference in its entirety). The immortal cell line, which may be murine, but may also be derived from cells of other mammalian species, is selected to be deficient in enzymes necessary for the utilization of certain nutrients, to be capable of rapid growth, and have good fusion capability. The resulting fused cells, or hybridomas, are cultured, and the resulting colonies screened for the production of the desired monoclonal antibodies. Colonies producing such antibodies are cloned, and grown either in vivo or in vitro to produce large quantities of antibody.
(38) Alternatively monoclonal antibodies can be made using recombinant DNA methods (i.e. synthetic antibodies) as described in U.S. Pat. No. 4,816,567 to Cabilly et al, which is hereby incorporated by reference in its entirety. The polynucleotide(s) encoding a monoclonal antibody can further be modified using recombinant DNA technology to generate alternative antibodies. For example, the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for those regions of a human antibody to generate a chimeric antibody. Alternatively, the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for a non-immunoglobulin polypeptide to generate a fusion antibody. In other embodiments, the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Furthermore, site-directed or high-density mutagenesis of the variable region can be used to optimize specificity and affinity of a monoclonal antibody.
(39) The monoclonal antibody of the present invention can be a humanized antibody. Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g., murine) antibodies within the variable regions. Such antibodies are used therapeutically to reduce antigenicity and human anti-mouse antibody responses when administered to a human subject. In practice, humanized antibodies are typically human antibodies with minimal to no non-human sequences. An antibody can be humanized by substituting the complementarity determining region (CDR) of a human antibody with that of a non-human antibody (e.g., mouse, rat, rabbit, hamster, etc.) having the desired specificity, affinity, and capability (Jones et al., Replacing the Complementarity-Determining Regions in a Human Antibody With Those From a Mouse, Nature 321:522-525 (1986); Riechmann et al., Reshaping Human Antibodies for Therapy, Nature 332:323-327 (1988); Verhoeyen et al., Reshaping Human Antibodies: Grafting an Antilysozyme Activity, Science 239:1534-1536 (1988), which are hereby incorporated by reference in their entirety). The humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
(40) The GIT1 antibody of the present invention can also be a human monoclonal antibody. A human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human. Human antibodies can be produced using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See e.g., Reisfeld et al., M
(41) Also suitable for use in the present invention are antibody fragments engineered to bind to intracellular proteins, i.e. intrabodies. Intrabodies are generally obtained by selecting a single variable domain from variable regions of an antibody having two variable domains (i.e., a heterodimer of a heavy chain variable domain and a light chain variable domain). Single chain Fv fragments, Fab fragments, ScFv-C fusion proteins, single chain diabodies, V.sub.H-C.sub.H1 fragments, and even whole IgG molecules are suitable formats for intrabody development (Kontermann R. E., Intrabodies as Therapeutic Agents, Methods 34:163-70 (2004), which is here by incorporated by reference in its entirety).
(42) Intrabodies having antigen specificity for a specific epitope can be obtained from phage display, yeast surface display, or ribosome surface display. Methods for producing libraries of intrabodies and isolating intrabodies of interest are further described in U.S. Published Patent Application No. 20030104402 to Zauderer and U.S. Published Patent Application No. 20050276800 to Rabbitts, which are hereby incorporated by reference in their entirety. Methods for improving the stability and affinity binding characteristics of intrabodies are described in WO2008070363 to Zhenping, and Contreras-Martinez et al., Intracellular Ribosome Display via SccM Translation Arrest as a Selection for Antibodies with Enhanced Cytosolic Stability, J Mol Biol 372(2):513-24 (2007), which are hereby incorporated by reference in their entirety.
(43) Other GIT1 inhibitors that are suitable for use in accordance with this aspect of the present invention include inhibitory GIT1 nucleic acid molecules that interfere with GIT1 expression to cause a reduction in GIT1 expression levels and, hence, overall levels of GIT1 activity. Suitable GIT1 inhibitory nucleic acid molecules include, without limitation, GIT1 siRNA, a GIT1 microRNA, antisense GIT1 RNA, and a GIT1 shRNA.
(44) The use of antisense methods to inhibit the in vivo translation of genes and subsequent protein expression is well known in the art (e.g., U.S. Pat. No. 7,425,544 to Dobie et al.; U.S. Pat. No. 7,307,069 to Karras et al.; U.S. Pat. No. 7,288,530 to Bennett et al.; U.S. Pat. No. 7,179,796 to Cowsert et al., which are hereby incorporated by reference in their entirety). Antisense nucleic acids are nucleic acid molecules (e.g., molecules containing DNA nucleotides, RNA nucleotides, or modifications (e.g., modification that increase the stability of the molecule, such as 2-O-alkyl (e.g., methyl) substituted nucleotides) or combinations thereof) that are complementary to, or that hybridize to, at least a portion of a specific nucleic acid molecule, such as an mRNA molecule (see e.g., Weintraub, H. M., Antisense DNA and RNA, Scientific Am. 262:40-46 (1990), which is hereby incorporated by reference in its entirety). The antisense nucleic acid molecule hybridizes to its corresponding target nucleic acid molecule, such as the GIT1 mRNA, to form a double-stranded molecule, which interferes with translation of the mRNA, as the cell will not translate a double-stranded mRNA. Antisense nucleic acids used in the methods of the present invention are typically at least 10-12 nucleotides in length, for example, at least 15, 20, 25, 50, 75, or 100 nucleotides in length. The antisense nucleic acid can also be as long as the target nucleic acid with which it is intended to form an inhibitory duplex. Antisense nucleic acids can be introduced into cells as antisense oligonucleotides, or can be produced in a cell in which a nucleic acid encoding the antisense nucleic acid has been introduced, for example, using gene therapy methods.
(45) siRNAs are double stranded synthetic RNA molecules approximately 20-25 nucleotides in length with short 2-3 nucleotide 3 overhangs on both ends. The double stranded siRNA molecule represents the sense and anti-sense strand of a portion of the target mRNA molecule, in this case a portion of the GIT1 nucleotide sequence. The mRNA sequence of GIT1 is known in the art (see NCBI sequence reference numbers NM_001085454 (transcript for GIT1 isoform 1), NM_014030.3 (transcript GIT1 isoform 2), which are hereby incorporated by reference in their entirety). siRNA molecules are typically designed to target a region of the mRNA target approximately 50-100 nucleotides downstream from the start codon. Upon introduction into a cell, the siRNA complex triggers the endogenous RNA interference (RNAi) pathway, resulting in the cleavage and degradation of the target mRNA molecule. siRNA molecules that effectively interfere with GIT1 expression are described herein in the Examples. Various improvements of siRNA compositions, such as the incorporation of modified nucleosides or motifs into one or both strands of the siRNA molecule to enhance stability, specificity, and efficacy, have been described and are suitable for use in accordance with this aspect of the invention (see e.g., WO2004/015107 to Giese et al.; WO2003/070918 to McSwiggen et al.; WO1998/39352 to Imanishi et al.; U.S. Patent Application Publication No. 2002/0068708 to Jesper et al.; U.S. Patent Application Publication No. 2002/0147332 to Kaneko et al; U.S. Patent Application Publication No. 2008/0119427 to Bhat et al., which are hereby incorporated by reference in their entirety). An siRNA specific to GIT1 is described in Example 4.
(46) MicroRNAs (miRNAs) are derived from endogenous genes that are initially transcribed as longer RNA transcripts. In mammals, the primary miRNA transcripts (pri-miRNAs) are processed by the nuclease Drosha into about 70 nt precursor miRNAs (pre-miRNAs) that are exported by exportin-5 to the cytoplasm. The Dicer nuclease excises the mature miRNAs from pre-miRNAs. miRNAs are bound to proteins that belong to the Argonaute family and, in humans, may also assemble with other proteins, including the Gemin3 and Gemin4 proteins, to form micro-Ribonucleoprotein complexes (miRNPs). Many miRNAs, like siRNAs, function by base pairing with miRNA-recognition elements (MREs) found in their mRNA targets and direct either target RNA endonucleolytic cleavage or translational repression. The manner by which a miRNA or siRNA base pairs with its mRNA target correlates with its function. If the complementarity between a miRNA and its target is extensive, the RNA target is cleaved, if the complementarity is partial, the stability of the target mRNA in not affected but its translation is repressed.
(47) Short or small hairpin RNA molecules are similar to siRNA molecules in function, but comprise longer RNA sequences that make a tight hairpin turn. shRNA is cleaved by cellular machinery into siRNA and gene expression is silenced via the cellular RNA interference pathway. shRNA molecules that effectively silence GIT1 expression are known in the art and are commercially available (OriGene, Rockville, Md.).
(48) Another aspect of the present invention relates to an isolated GIT1 peptide comprising the ankyrin repeat domain as described supra. Specifically, isolated peptides of the present invention may comprise the amino acid sequence of SEQ ID NO: 7, SEQ ID NO: 8, or an RBP-J binding fragment thereof. Suitable smaller peptides derived from SEQ ID NOs: 7 or 8, include peptides comprising residues 1-30 of SEQ ID NOs: 7 or 8 corresponding to the first ANK domain, residues 35-64 of SEQ ID NOs: 7 or 8 corresponding to the second ANK domain, residues 36-48 of SEQ ID NOs: 7 or 8 corresponding to a core region with the second ANK domain, and residues 68-97 of SEQ ID NOs: 7 or 8 corresponding to the third ANK domain. In another embodiment of the present invention, the isolated peptide of the present invention may comprise the amino acid sequence of the human ANK domain, i.e., residues 132-228 of SEQ ID NO: 1 (also shown above as SEQ ID NO: 2) or fragments thereof. Suitable smaller peptides derived from the human ANK domain, include peptides comprising residues 132-161 of SEQ ID NO: 1 or residues 1-30 of SEQ ID NO:2 corresponding to the first ANK domain (i.e., DLSKQLHSSVRTGNLETCLRLLSLGAQANF), residues 166-195 of SEQ ID NO: 1 or residues 35-64 of SEQ ID NO:2 corresponding to the second ANK domain (i.e., KGTTPLHVAAKAGQTLQAELLVVYGADPGS), residues 167-179 of SEQ ID NO: 1 or residues 36-48 of SEQ ID NO: 2 corresponding to a core region with the second ANK domain (i.e., GTTPLHVAAKAGQ), and residues 199-228 of SEQ ID NO: 1 or residues 68-97 of SEQ ID NO: 2 corresponding to the third ANK domain (i.e., NGRTPIDYARQAGHHELAERLVECQYELTD). In another embodiment of the present invention, the isolated GIT1 peptide of the present invention comprises an amino acid sequence selected from the amino acid sequences of SEQ ID NOs: 3-6, or smaller fragments thereof.
(49) Another aspect of the present invention relates to an isolated nucleic acid molecule encoding a GIT1 peptide of the present invention. An exemplary isolated nucleic acid molecule encoding the amino acid sequence of SEQ ID NO: 2 comprises a nucleotide sequence of SEQ ID NO: 9 as shown below.
(50) TABLE-US-00003 (SEQIDNO:9) AAAGATCTGAGCAAACAGCTGCATAGCAGCGTGCGC ACCGGCAACCTGGAAACCTGCCTGCGCCTGCTGAGC CTGGGCGCGCAGGCGAACTTTTTTCATCCGGAAAAA GGCACCACCCCGCTGCATGTGGCGGCGAAAGCGGGC CAGACCCTGCAGGCGGAACTGCTGGTGGTGTATGGC
(51) Due to the degeneracy of the DNA code, one of skill in the art readily appreciates that other nucleotide sequences will also encode an amino acid sequence of SEQ ID NO:2, or encode the functional equivalent of SEQ ID NO:2 (e.g., any one of SEQ ID NOs: 3-6). Additional GIT1 nucleic acid molecules can be identified based upon their alignment with the GIT1 nucleotide sequence of SEQ ID NO: 9 provided above, where such alignment preferably is at least about 60 percent identical, more preferably at least about 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, or 95 percent identical. Accordingly, another exemplary isolated nucleic acid molecule encoding the amino acid sequence of SEQ ID NO: 2 comprises the nucleotide sequence of SEQ ID NO: 10 as shown below.
(52) TABLE-US-00004 (SEQIDNO:10) AARGAYYTNWSNAARCARYTNCAYWSNWSNGTNMGN CANGGNAAYYTNGARCANTGYYTNMGNYTNYTNWSN YTNGGNGCNCARGCNAAYTTYTTYCAYCCNGARAAR GGNCANCANCCNYTNCAYGTNGCNGCNAARGCNGGN CARCANYTNCARGCNGARYTNYTNGTNGTNTAYGGN
The variable residues within SEQ ID NO: 10 are defined as follows: R is A or G; Y is T or C; N is G, A, T or C; W is A or T; and M is A or C.
(53) The nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form (i.e., purified away from other cellular components or other contaminants).
(54) The peptides of the present invention can be synthesized by solid phase or solution phase peptide synthesis, recombinant expression, or can be obtained from natural sources. Automatic peptide synthesizers are commercially available from numerous suppliers, such as Applied Biosystems, Foster City, Calif. Standard techniques of chemical peptide synthesis are well known in the art (see e.g., S
(55) Generally, the use of recombinant expression systems involves inserting the nucleic acid molecule encoding the amino acid sequence of the desired GIT1 peptide into an expression system to which the molecule is heterologous (i.e., not normally present). Suitable nucleic acid molecules encoding the peptides of the present invention are provided above as SEQ ID NO: 9 and SEQ ID NO: 10.
(56) One or more desired nucleic acid molecules encoding a peptide of the invention may be inserted into the vector. When multiple nucleic acid molecules are inserted, the multiple nucleic acid molecules may encode the same or different peptides. The heterologous nucleic acid molecule is inserted into the expression system or vector in proper sense (5.fwdarw.3) orientation relative to the promoter and any other 5 regulatory molecules, and correct reading frame.
(57) The preparation of the nucleic acid constructs can be carried out using standard cloning procedures well known in the art as described by Joseph Sambrook et al., M
(58) A variety of genetic signals and processing events that control many levels of gene expression (e.g., DNA transcription and messenger RNA (mRNA) translation) can be incorporated into the nucleic acid construct to maximize peptide production. For the purposes of expressing a cloned nucleic acid sequence encoding a desired peptide, it is advantageous to use strong promoters to obtain a high level of transcription. Depending upon the host system utilized, any one of a number of suitable promoters may be used. For instance, when cloning in E. coli, its bacteriophages, or plasmids, promoters such as the T7 phage promoter, lac promoter, trp promoter, recA promoter, ribosomal RNA promoter, the P.sub.R and P.sub.L promoters of coliphage lambda and others, including but not limited to, lacUV5, ompF, bla, lpp, and the like, may be used to direct high levels of transcription of adjacent DNA segments. Additionally, a hybrid trp-lacUV5 (tac) promoter or other E. coli promoters produced by recombinant DNA or other synthetic DNA techniques may be used to provide for transcription of the inserted gene. Common promoters suitable for directing expression in mammalian cells include, without limitation, SV40, MMTV, metallothionein-1, adenovirus E1a, CMV, immediate early, immunoglobulin heavy chain promoter and enhancer, and RSV-LTR.
(59) A nucleic acid molecule encoding an isolated peptide of the present invention, a promoter molecule of choice, including, without limitation, enhancers, and leader sequences; a suitable 3 regulatory region to allow transcription in the host, and any additional desired components, such as reporter or marker genes, are cloned into the vector of choice using standard cloning procedures in the art, such as described in Joseph Sambrook et al., M
(60) A variety of suitable host-vector systems may be utilized to express the recombinant GIT1 peptide of the present invention. Primarily, the vector system must be compatible with the host used. Host-vector systems include, without limitation, the following: bacteria transformed with bacteriophage DNA, plasmid DNA, or cosmid DNA; microorganisms such as yeast containing yeast vectors; mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); and plant cells infected by bacteria.
(61) Recombinantly expressed peptides can be purified using any one of several methods readily known in the art, including ion exchange chromatography, hydrophobic interaction chromatography, affinity chromatography, gel filtration, and reverse phase chromatography. The peptide is preferably produced in purified form (preferably at least about 80% or 85% pure, more preferably at least about 90% or 95% pure) by conventional techniques. Depending on whether the recombinant host cell is made to secrete the peptide into growth medium (see U.S. Pat. No. 6,596,509 to Bauer et al., which is hereby incorporated by reference in its entirety), the peptide can be isolated and purified by centrifugation (to separate cellular components from supernatant containing the secreted peptide) followed by sequential ammonium sulfate precipitation of the supernatant. The fraction containing the peptide is subjected to gel filtration in an appropriately sized dextran or polyacrylamide column to separate the peptides from other proteins. If necessary, the peptide fraction may be further purified by HPLC.
(62) The GIT1 peptides of the present invention can be coupled to one or more targeting moieties. A targeting moiety according to the present invention functions to (i) target the GIT1 peptide to a particular cell or tissue type (e.g., signaling peptide sequence) upon administration to a subject in accordance with the methods of the present invention and/or (ii) to promote the cellular uptake of the GIT1 peptide after administration to a subject.
(63) To achieve cell-specific delivery of the GIT1 ANK peptide or other GIT1 inhibitory peptides, the peptide is coupled to a cell-specific targeting moiety. A cell-specific targeting moiety confers cell-type specific binding to the peptide, and it is chosen on the basis of the particular cell population to be targeted. The cell-specific targeting moiety can be any type of moiety, such as an antibody, a growth factor, a hormone, a polypeptide, a peptide, an aptamer, or a cytokine that binds to a corresponding binding partner present on the surface of the target cell. In particular embodiments, the cell-specific targeting moiety is an antibody. For example, the antibody may be a full-length antibody, chimeric antibody, Fab, Fab, F(ab).sub.2, single domain antibody (DAB), Fv, single chain Fv (scFv), minibody, diabody, triabody, or a mixture thereof.
(64) In one embodiment of the present invention, the cell specific targeting moiety is an endothelial cell targeting moiety. A number of endothelial cell specific targeting moieties are known in the art and are suitable for use in accordance with the methods and compositions of the present invention. One exemplary endothelial cell targeting moiety comprises an Arg-Gly-Asp (RGD) tripeptide sequence motif that has specific binding affinity for the .sub.5.sub.3 integrin abundantly present on the endothelial cell surface (Curnis et al., Cancer Research 64(2): 565-571 (2004), which is hereby incorporated by reference in its entirety). Another .sub.5.sub.3 integrin specific peptide sequence useful for endothelial cell targeting comprises PHSRN (SEQ ID NO: 11).
(65) Another exemplary endothelial cell targeting moiety useful for targeting the GIT1 peptide of the present invention to endothelial cells comprises an Asn-Gly-Arg (NGR) tripeptide sequence motif. The NGR tripeptide sequence is a ligand for aminopeptidase N isoform CD13 that is abundantly expressed on endothelial cells. Other endothelial cell targeting moiety sequences that are suitable for use in the methods and compositions of the present invention include YIGSR (SEQ ID NO: 12), and HWGF (SEQ ID NO: 13) (Turunen et al., Peptide-Retargeted Adenovirus Encoding a Tissue Inhibitor of Metalloproteinase-1 Decreases Restenosis after Intravascular Gene Transfer, Mol Ther. 6(3):306-12 (2002); Jun et al., Endothelialization of Microporous YIGSR/PEG-modified Polyurethaneurea, Tissue Engineering 11(7-8):1133-1140 (2005), which are hereby incorporated by reference in their entirety).
(66) In an alternative embodiment of the invention, the endothelial cell targeting moiety comprises an endothelial cell surface receptor ligand having binding specificity for an endothelial cell surface receptor. Non-limiting examples of endothelial cell surface receptor ligands that can be utilized as endothelial cell targeting moieties in the present invention include, without limitation, VEGF (including VEGF isoforms VEGF.sub.121, VEGF.sub.165, VEGF.sub.189, VEGF.sub.206), FGF, integrin, fibronectin, ICAM, PDGF, P-selectin ligand, VCAM-1 ligand, ICAM-1 ligand. In another embodiment of the present invention, the endothelial cell surface moiety comprises an antibody that binds to an endothelial cell surface protein. Exemplary antibodies include, without limitation, anti-VEGFR1 antibody, anti-VCAM1 antibody, anti-ICAM-1 antibody, anti-P-selectin antibody, and anti-aminopeptidase N antibody.
(67) In another embodiment of the present invention, the GIT1 peptide is coupled to a cell-penetrating moiety to promote cellular uptake of the GIT1 peptide upon delivery to the target cell, e.g. target endothelial cell. Suitable cell penetrating moieties include cell penetrating peptides (CPP) that translocate across the plasma membrane of eukaryotic cells by a seemingly energy-independent pathway. CPPs have been used successfully for intracellular delivery of macromolecules, including antibodies, peptides, proteins, and nucleic acids, with molecular weights several times greater than their own. Many cell-penetrating peptides are designed from sequences of membrane-interacting proteins such as fusion proteins, signal peptides, transmembrane domains and antimicrobial peptides (Morris et al., Translocating peptides and proteins and their use for gene delivery CURR OPIN BIOTECHNOL 5:461-466 (2000); Jarver et al., The Use of Cell-Penetrating Peptides as a Tool for Gene Regulation Drug Discov Today 9:395-402 (2004); El-Andaloussi et al., Cell-Penetrating Peptides: Mechanisms and Applications Curr Pharm Des 28:3597-3611 (2005), each of which is hereby incorporated by reference in its entirety. Within these sequences, short sequences called Protein Transduction Domains (PTDs) efficiently cross biological membranes without the need of a carrier or of a receptor to deliver peptides or proteins into intracellular compartments. Several commonly used cell penetrating moieties include, without limitation, the third helix of the homeodomain of antennapedia called penetratin, the Tat peptide derived from the transactivating protein Tat of HIV-1 (amino acids 49-57 of HIV Tat protein), transportan and VP22.
(68) A second category of cell-penetrating peptides, designated as amphipathic peptides, are also suitable for use in the present invention. An amphipathic molecule can be defined, in short, as consisting of two domains: a hydrophilic (polar) domain and a hydrophobic (non-polar) domain. For peptides, the amphipathic character can arise either from the primary structure, or from the secondary structure. Primary amphipathic peptides can be defined as the sequential assembly of a domain of hydrophobic residues with a domain of hydrophilic residues. Secondary amphipathic peptides are generated by the conformational state which allows the positioning of the hydrophobic and hydrophilic residues on opposite sides of the molecule.
(69) Other peptides, such as polyarginine-based peptides, calcitonin-derived peptides, and oligomers, are also suitable cell penetrating peptides that can be coupled to the GIT1 peptides of the present invention to achieve intracellular peptide delivery.
(70) In some embodiments of the present invention, the isolated GIT1 peptide of the present invention is coupled to a tag. A tag as used herein includes any labeling moiety that facilitates the detection, quantitation, separation, and/or purification of the isolated GIT1 peptide of the present invention. Suitable tags include purification tags, and radioactive, enzymatic, or fluorescent detectable labels. Any detectable label recognized in the art as being useful in various assays could be used in the present invention. In particular, the detectable label component can include compositions detectable by spectroscopic, photochemical, biochemical, immunochemical, or chemical means. As such, the label component produces a detectable signal. For instance, suitable labels include soluble dyes, fluorescent dyes, chemiluminescent compounds, radioisotopes, electron-dense reagents, enzymes, colored particles, or dioxigenin. The label component can generate a measurable signal, such as radioactivity, fluorescent light, color, or enzyme activity, which can be used to identify and quantify the amount of label bound to a capture site. Thus, the label component can also represent the presence or absence of a particular antigen bound thereto.
(71) The GIT1 peptides of the present invention can be coupled to the one or more targeting moieties or tags by way of a short linker sequence. Suitable linker sequences include glycine (e.g. G.sub.3-5) or serine-rich (e.g. GSG, GSGS (SEQ ID NO: 14), GSGSG (SEQ ID NO: 15), GS.sub.NG) linker sequences. Alternatively, the targeting moiety or tag can be coupled to the isolated peptide of the present invention by chemical coupling in any suitable manner known in the art. In one embodiment, the chemical cross-linking method is a non-specific method, i.e. the point of coupling is not directed to any particular site on the transport or cargo peptide or polypeptide. Alternatively, the targeting moiety can be directly coupled to the isolated peptide of the present invention via a functional group (e.g., cysteine residue or primary amine), found only once or a few times in one or both of the targeting moiety and cargo peptide to be cross-linked.
(72) Coupling of the two constituents can be accomplished via a coupling or conjugating agent. There are several intermolecular cross-linking reagents which can be utilized, e.g., J-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) or N,N-(1,3-phenylene)bismaleimide (both of which are highly specific for sulfhydryl groups and form irreversible linkages); N,N-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 11 carbon methylene bridges (which are relatively specific for sulfhydryl groups); and 1,5-difluoro-2,4-dinitrobenzene (which forms irreversible linkages with amino and tyrosine groups). Other cross-linking reagents useful for this purpose include, without limitation, p,p-difluoro-m,m-dinitrodiphenylsulfone (which forms irreversible cross-linkages with amino and phenolic groups); dimethyl adipimidate (which is specific for amino groups); phenol-1,4-disulfonylchloride (which reacts principally with amino groups); hexamethylenediisocyanate or diisothiocyanate, or azophenyl-p-diisocyanate (which reacts principally with amino groups); glutaraldehyde (which reacts with several different side chains) and disdiazobenzidine (which reacts primarily with tyrosine and histidine). Heterobifunctional cross-linking agents having two different functional groups, e.g., amine- and thiol-reactive groups, that will cross-link two proteins having free amines and thiols, respectively, are also suitable cross-linking agents. Examples of heterobifunctional cross-linking agents include succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate, m-maleimidobenzoyl-N-hydroxysuccinimide ester, and succinimide 4-(p-maleimidophenyl)butyrate. The succinimidyl group of these cross-linkers reacts with a primary amine, and the thiol-reactive maleimide forms a covalent bond with the thiol of a cysteine residue.
(73) In one embodiment of the present invention, a cross-linking reagent that forms a cleavable covalent bond (e.g., disulfide bond) under cellular conditions is preferentially utilized. Exemplary cross-linking agents that form cleavable bonds include, without limitation, Traut's reagent, dithiobis(succinimidylpropionate), and N-succinimidyl 3-(2-pyridyldithio)propionate. The use of a cleavable cross-linking reagent permits the cargo moiety (i.e., the GIT1 peptide) to separate from the targeting moiety after delivery into the target cell.
(74) Another aspect of the present invention is directed to pharmaceutical compositions comprising any one of the therapeutic GIT1 agents described herein.
(75) In one embodiment of this aspect of the invention, the pharmaceutical agent comprises a GIT1 inhibitory peptide comprising an ankryin repeat domain (e.g., a peptide comprising an amino acid sequence of SEQ ID NOs: 2-8, of fragments thereof as described supra) or the SHD domain (e.g., a peptide comprising an animo acid sequence of SEQ ID Nos: 17 or 18), and a pharmaceutically acceptable carrier. In another embodiment of this aspect of the invention, the pharmaceutical agent comprises a GIT1 antibody or GIT1 inhibitory nucleic acid, and a pharmaceutically acceptable carrier.
(76) The pharmaceutical composition of the present invention can further contain, in addition to the GIT1 therapeutic component, other pharmaceutically acceptable components (see R
(77) Pharmaceutical compositions can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized sepharose, agarose, cellulose), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes).
(78) In some embodiments of the present invention, the pharmaceutical composition or therapeutic agents themselves (i.e., GIT1 peptides) are housed in a delivery vehicle. Any suitable passive or targeted delivery vehicle can be employed including, but not limited to, viral vectors, biodegradable microspheres, microparticles, nanoparticles, liposomes, collagen minipellets, and cochleates.
(79) In one embodiment of the present invention, the delivery vehicle is a liposome delivery vehicle. Liposomes are vesicles comprised of one or more concentrically ordered lipid bilayers which encapsulate an aqueous phase. A liposome which includes a GIT1 inhibitor (e.g., GIT1 peptide or nucleic acid inhibitor) is contacted with the target cell under conditions effective for delivery of the therapeutic into the target cell, e.g., an endothelial cell. For direct administration, the liposomal vesicles need not be targeted to endothelial cells per se. Alternatively, the liposome delivery system can be made to accumulate at a target organ, tissue, or cell via active targeting (e.g., by incorporating an antibody or other ligand on the surface of the liposomal vehicle). This can be achieved using any of the endothelial cell targeting moieties described supra. See also, Holig et al., Novel RGD Lipopeptides for Targeting of Liposomes to Integrin-Expressing Endothelial and Melanoma Cells, Protein Engineering Design Selection 17(5):433-441 (2004) and Vader et al., Targeted Delivery of Small Interfering RNA to Angiogenic Endothelial Cells with Liposome-Polycation-DNA Particles, J. Control Release 160(2):211-6 (2011), which are hereby incorporated by reference in their entirety.
(80) Different types of liposomes can be prepared according to Bangham et al., Diffusion of Univalent Ions across the Lamellae of Swollen Phospholipids, J. Mol. Biol. 13:238-252 (1965); U.S. Pat. No. 5,653,996 to Hsu et al.; U.S. Pat. No. 5,643,599 to Lee et al.; U.S. Pat. No. 5,885,613 to Holland et al.; U.S. Pat. No. 5,631,237 to Dzau et al.; and U.S. Pat. No. 5,059,421 to Loughrey et al., each of which is hereby incorporated by reference in its entirety.
(81) These liposomes can be produced such that they contain, in addition to the GIT1 therapeutic agents, other therapeutic agents, such as other anti-angiogenic agents, which would also be released at the target site.
(82) In another embodiment of the present invention, the delivery vehicle is a nanoparticle. A variety of nanoparticle delivery vehicles are known in the art and are suitable for delivery of a GIT1 therapeutic agent of the invention. A nanoparticle delivery system can be made to accumulate at a target organ, tissue, or cell via active targeting (e.g., by incorporating an antibody or other ligand on the surface of the nanoparticle vehicle) (see e.g., Oda et al., Nanoparticle-Mediated Endothelial Cell-Selective Delivery of Pitavastatin Induces Functional Collateral Arteries (Therapeutic Arteriogenesis) in a Rabbit Model of Chronic Hind Limb Ischemia, J. Vasc. Surg. 52(2):412-420 (2010), which is hereby incorporated by reference in its entirety). Any of the endothelial cell targeting moieties described supra can be coupled to the nanoparticle delivery vehicle to achieve cell specific delivery.
(83) Suitable nanoparticles include conjugated pH-sensitive lipopolyplex nanoparticles (LPs) as described by Jin et al., Targeted Delivery of Antisense Oligodeoxynucleotide by Transferrin Conjugated pH-sensitive Lipopolyplex Nanoparticles: A Novel Oligonucleotide-based Therapeutic Strategy in Acute Myeloid Leukemia, Mol. Pharm. 7(1):196-206 (2010), which is hereby incorporated by reference in its entirety. The lipopolyplex nanoparticle carrying a therapeutic agent (e.g. GIT1 peptide) releases its cargo at acidic endosomal pH to facilitate the cytoplasmic delivery of the therapeutic agent after endocytosis. Other suitable nanoparticles include, without limitation, poly(beta-amino esters) (Sawicki et al., Nanoparticle Delivery of Suicide DNA for Epithelial Ovarian Cancer Cell Therapy, Adv. Exp. Med. Biol. 622:209-219 (2008), which is hereby incorporated by reference in its entirety), polyethylenimine-alt-poly(ethylene glycol) copolymers (Park et al., Degradable Polyethylenimine-alt-Poly(ethylene glycol) Copolymers As Novel Gene Carriers, J. Control Release 105(3):367-80 (2005) and Park et al., Intratumoral Administration of Anti-KITENIN shRNA-Loaded PEI-alt-PEG Nanoparticles Suppressed Colon Carcinoma Established Subcutaneously in Mice, J Nanosci. Nanotechnology 10(5):3280-3 (2010), which are hereby incorporated by reference in their entirety), and liposome-entrapped siRNA nanoparticles (Kenny et al., Novel Multifunctional Nanoparticle Mediates siRNA Tumor Delivery, Visualization and Therapeutic Tumor Reduction In Vivo, J. Control Release 149(2): 111-116 (2011), which is hereby incorporated by reference in its entirety). Nanoparticles may also be formed from compatible polymers and biomaterials such as poly(lactide-co-glycolide) (PLGA), poly(lactide) (PLA), poly(epsilon-caprolactone), albumin, and chitosan. Other nanoparticle delivery vehicles suitable for use in the present invention include microcapsule nanotube devices disclosed in U.S. Patent Publication No. 2010/0215724 to Prakash et al., which is hereby incorporated by reference in its entirety.
(84) In another embodiment of the present invention, the delivery vehicle is a viral vector. Viral vectors are particularly suitable for the delivery of inhibitory nucleic acid molecules, such as GIT1 siRNA or shRNA molecules. Suitable gene therapy vectors include, without limitation, adenoviral vectors, adeno-associated viral vectors, retroviral vectors, lentiviral vectors, and herpes viral vectors.
(85) Adenoviral viral vector delivery vehicles can be readily prepared and utilized as described in Berkner, Development of Adenovirus Vectors for the Expression of Heterologous Genes, Biotechniques 6:616-627 (1988) and Rosenfeld et al., Adenovirus-Mediated Transfer of a Recombinant Alpha 1-Antitrypsin Gene to the Lung Epithelium In Vivo, Science 252:431-434 (1991), WO 93/07283 to Curiel et al., WO 93/06223 to Perricaudet et al., and WO 93/07282 to Curiel et al., which are hereby incorporated by reference in their entirety. Adeno-associated viral delivery vehicles can be constructed and used to deliver an inhibitory nucleic acid molecule of the present invention to cells as described in Shi et al., Therapeutic Expression of an Anti-Death Receptor-5 Single-Chain Fixed Variable Region Prevents Tumor Growth in Mice, Cancer Res. 66:11946-53 (2006); Fukuchi et al., Anti-A Single-Chain Antibody Delivery via Adeno-Associated Virus for Treatment of Alzheimer's Disease, Neurobiol. Dis. 23:502-511 (2006); Chatterjee et al., Dual-Target Inhibition of HIV-1 In Vitro by Means of an Adeno-Associated Virus Antisense Vector, Science 258:1485-1488 (1992); Ponnazhagan et al., Suppression of Human Alpha-Globin Gene Expression Mediated by the Recombinant Adeno-Associated Virus 2-Based Antisense Vectors, J. Exp. Med. 179:733-738 (1994); and Zhou et al., Adeno-associated Virus 2-Mediated Transduction and Erythroid Cell-Specific Expression of a Human Beta-Globin Gene, Gene Ther. 3:223-229 (1996), which are hereby incorporated by reference in their entirety. In vivo use of these vehicles is described in Flotte et al., Stable in Vivo Expression of the Cystic Fibrosis Transmembrane Conductance Regulator With an Adeno-Associated Virus Vector, Proc. Nat'l. Acad. Sci. 90:10613-10617 (1993) and Kaplitt et al., Long-Term Gene Expression and Phenotypic Correction Using Adeno-Associated Virus Vectors in the Mammalian Brain, Nature Genet. 8:148-153 (1994), which are hereby incorporated by reference in their entirety. Additional types of adenovirus vectors are described in U.S. Pat. No. 6,057,155 to Wickham et al.; U.S. Pat. No. 6,033,908 to Bout et al.; U.S. Pat. No. 6,001,557 to Wilson et al.; U.S. Pat. No. 5,994,132 to Chamberlain et al.; U.S. Pat. No. 5,981,225 to Kochanek et al.; U.S. Pat. No. 5,885,808 to Spooner et al.; and U.S. Pat. No. 5,871,727 to Curiel, which are hereby incorporated by reference in their entirety.
(86) Retroviral vectors which have been modified to form infective transformation systems can also be used to deliver a nucleic acid molecule to a target cell. One such type of retroviral vector is disclosed in U.S. Pat. No. 5,849,586 to Kriegler et al., which is hereby incorporated by reference. Other nucleic acid delivery vehicles suitable for use in the present invention include those disclosed in U.S. Patent Publication No. 20070219118 to Lu et al., which is hereby incorporated by reference in its entirety.
(87) Viral vectors are administered to a subject by, for example, intravenous injection, local administration (U.S. Pat. No. 5,328,470 to Nabel et al., which is hereby incorporated by reference in its entirety) or by stereotactic injection (see e.g., Chen et al., Gene Therapy for Brain Tumors: Regression of Experimental Gliomas by Adenovirus Mediated Gene Transfer In Vivo, Proc. Nat'l. Acad. Sci. USA 91:3054-3057 (1994), which is hereby incorporated by reference in its entirety). The pharmaceutical preparation of a viral vector can include the vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded.
(88) In practicing the methods of the present invention, the administering step is carried out to achieve a decrease in GIT1 activity. In some embodiments of the present invention such administration is carried out systemically. Alternatively, such administration is carried out via direct or local administration. By way of example, suitable modes of systemic administration include, without limitation, orally, topically, transdermally, parenterally, subcutaneously, intravenously, intramuscularly, intraperitoneally, by intranasal instillation, by intracavitary or intravesical instillation, intraocularly, intraarterially, intralesionally, or by application to mucous membranes. Suitable modes of local administration include, without limitation, catheterization, implantation, direct injection, dermal/transdermal application, stenting, ear/eye drops, or portal vein administration to relevant tissues, or any other local administration technique, method or procedure, as is generally known in the art.
(89) The therapeutic agents of the present invention may be orally administered, for example, with an inert diluent, or with an assimilable edible carrier, or it may be enclosed in hard or soft shell capsules, or it may be compressed into tablets, or they may be incorporated directly with the food of the diet. Agents of the present invention may also be administered in a time release manner incorporated within such devices as time-release capsules or nanotubes. Such devices afford flexibility relative to time and dosage. For oral therapeutic administration, the agents of the present invention may be incorporated with excipients and used in the form of tablets, capsules, elixirs, suspensions, syrups, and the like. Such compositions and preparations should contain at least 0.1% of the agent, although lower concentrations may be effective and indeed optimal. The percentage of the agent in these compositions may, of course, be varied and may conveniently be between about 2% to about 60% of the weight of the unit. The amount of an agent of the present invention in such therapeutically useful compositions is such that a suitable dosage will be obtained.
(90) When the GIT1 therapeutic agents of the present invention are administered parenterally, solutions or suspensions of the agent can be prepared in water suitably mixed with a surfactant such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil. In general, water, saline, aqueous dextrose and related sugar solution, and glycols, such as propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
(91) Pharmaceutical formulations suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), suitable mixtures thereof, and vegetable oils.
(92) When it is desirable to deliver the agents of the present invention systemically, they may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
(93) Intraperitoneal or intrathecal administration of the agents of the present invention can also be achieved using infusion pump devices. Such devices allow continuous infusion of desired compounds avoiding multiple injections and multiple manipulations.
(94) Compositions containing GIT1 therapeutic agents may also be formulated as a depot preparation. Such long acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
(95) Effective doses of the compositions of the present invention, for the treatment of conditions associated with abnormal angiogenesis vary depending upon many different factors, including the particular conditions, means of administration, target site, physiological state of the patient, other medications or therapies administered, and physical state of the patient relative to other medical complications. Treatment dosages need to be titrated to optimize safety and efficacy using methods known to those of skill in the art.
EXAMPLES
(96) The following examples are provided to illustrate embodiments of the present invention but they are by no means intended to limit its scope.
(97) Materials and Methods for Examples
(98) Generation of Global and Endothelial Cell (EC)-Specific GIT1 KO.
(99) Global GIT1 KO mice were generated as described before (Pang et al., Circulation 1524 (2009), which is hereby incorporated by reference in its entirety). To generate the conditional GIT1 KO mice, exons 3 to 7 of Git1 were targeted by flanking them with loxP sites, in combination with an frt-flanked neomycin phosphotransferase module to positively select putative homologous recombinant ES cells. Correctly targeted recombinants were identified with Xba I and EcoR I restriction digest and Southern blot and PCR by amplifying the region with the primers 5-TAC AGT GTG GAA ATG GGA AGT GAA AGC-3 (SEQ ID NO: 19) and 5-GGA GAA GGT GCC AGG AAG GCT TTA-3 (SEQ ID NO: 20), then digesting the products with EcoR I. Only the recombinant fragments will be digested by EcoR I, producing fragments of 347 and 221 bp while the wild-type remains a 521 bp fragment. Following implantation of ES cells into blastocysts, chimeric mice were generated and bred to the F1 generation. Then Git1-targeted mice were bred with Flp transgenic mice to delete the neomycin selection cassette. Progeny were crossed to remove the Flp transgene, resulting in mice bearing floxed Git1 alleles (heterozygous Git1.sup.f/+; homozygous Git1.sup.f/f). There are two independently generated floxed Git1 mouse lines. To generate homozygous floxed Git1-Cre recombinase mice, mice carrying both a Tie2-Cre transgene and one floxed Git1 allele were bred to homozygous floxed Git1 mice. The presence of the floxed Git1 gene was detected by PCR. Only homozygous KO animals (ie, GIT1.sup.f/f:Tie2-Cre+, EC-GIT1 KO) and control littermates (GIT1.sup.f/f:Tie2-Cre) were used.
(100) Retina Whole Mount Immunohistochemistry.
(101) Mouse pups were anesthetized by 2% isofluorane and sacrificed at P5. Eyes were fixed in 4% paraformaldehyde (PFA) in PBS at 4 C. overnight and washed in PBS. Retinas were dissected, permeabilized in PBS, 5% Normal goat serum (NGS), and 0.3% Triton X-100 at 4 C. overnight. Then they were rinsed in PBS and incubated in FITC-conjugated isolectin B4 (Bandeiraea simplicifolia; L-2140; Sigma-Aldrich) 20 g/ml in PBS at 4 C. overnight. After washing and a brief post-fixation in PFA, the retinas were either flat mounted or processed for multiple labeling. The following antibodies were used: GIT1 (1:100; Santa Cruz) and Alexa-568 conjugated secondary antibodies (Molecular Probes). Flat mounted retinas were analyzed by fluorescence microscopy using an Olympus BX51 microscope equipped with a digital camera (Spot CCD camera) and by confocal laser scanning microscopy (Olympus confocal system (Fluoroview)). Images were processed using Adobe Photoshop.
(102) Cell Culture.
(103) Human umbilical vein endothelial cells (HUVECs) were isolated and grown in Medium 200 with low serum growth supplement (Cascade Biologics, Inc., Portland, Oreg.) as described previously (Carmeliet et al., Nature 436:193 (2005), which is hereby incorporated by reference in its entirety). GIT1 siRNA (AAGCTGCCAAGAAGAAGCTAC) (SEQ ID NO: 21) and control non-silencing siRNA(AATTCTCCGACACGTGTCACT) (SEQ ID NO: 22) were designed and synthesized (Ambion) and Dll4 siRNA was purchased (Santa Cruz). The siRNA were transfected at 100 nM for 48 h as previously described by our laboratory (Yin et al., Mol. Cell Biol., 24:875 (2004), which is hereby incorporated by reference in its entirety). HEK293 cells were cultured in Dulbecco's modified Eagle's medium supplemented with 10% fetal bovine serum (FBS), penicillin, and streptomycin at 37 C. in 5% CO.sub.2. HEK293T cells were transfected by Lipofectamine/plus (Invitrogen).
(104) Immunoprecipitation and Immunoblotting.
(105) For immunoblotting, cells were lysed in RIPA buffer (150 mM NaCl, 1% Nonidet P-40, 60.5% deoxycholic acid, 0.1% SDS, 50 mM Tris-HCl, pH 8.0). Protein concentrations in the lysates were determined. The protein samples were separated by SDS-PAGE, transferred to nitrocellulose membranes, and incubated with appropriate primary antibodies. After incubating with fluorescence-conjugated secondary antibodies, immunoreactive proteins were visualized by an Odyssey infrared imaging system (LI-COR Biotechnology, Nebraska). Densitometric analysis of the blots was performed with Odyssey software (LI-COR Biotechnology). Results were normalized by arbitrarily setting the densitometry of control samples to 1.0. The antibodies used were GIT1 (Santa Cruz), Notch1 (Santa Cruz), N1-ICD (Millipore), Dll4 (Santa Cruz) Hey1 (Millipore), RBP-J (Santa Cruz), PLC (BD Transduction Laboratories), phospho-PLC1 (Tyr783) antibody (Cell Signaling) and phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) antibody (Cell Signaling). The immunoprecipitation was performed as published previously (Wang et al., Arterioscler. Thromb. Vasc. Biol., (2008), which is hereby incorporated by reference in its entirety).
(106) Quantitative Reverse Transcriptase PCR Analysis (qRT-PCR).
(107) Total RNA from retinas and lungs of GIT1 WT and KO mice or HUVECs was obtained using TRIzol reagent (Invitrogen) according to the manufacturer's protocol. Genomic/mitochondrial DNA was isolated using Trizol, followed by back extraction with 4 M guanidine thiocyanate, 50 mM sodium citrate, and 1 M tris, and an alcohol precipitation. Target genes mRNA expression and mitochondrial DNA content were determined by qRT-PCR (Applied Biosystems). The sequences of sense and antisense primers, corresponding PCR conditions, and cycle counts were as follows: D114 (mouse): 5-CCGCATTTGCCTTAAGCACTTCCA-3 (SEQ ID NO: 23) and 5-AAATTGAAGGGCAACTGCAGAGGG-3 (SEQ ID NO: 24); D114 (human): 5-CCTGCATTGTGAACACAGCACCTT-3 (SEQ ID NO: 25) and 5-ACCTGTCCACTTTCTTCTCGCAGT-3 (SEQ ID NO: 26); Hey1 (mouse): 5-GAAACTTGAGTTCGGCGCTGTGTT-3 (SEQ ID NO: 27) and 5-AGATCCCTGCTTCTCAAAGGCACT-3 (SEQ ID NO: 28); Hey1 (human): 5-AGAGTGCGGACGAGAATGGAAACT-3 (SEQ ID NO: 29) and 5-ACCAGCCTTCTCAGCTCAGACAAA-3 (SEQ ID NO: 30); 30 s at 94 C., 30 s at 55 C., and 30 s at 72 C., 35 cycles. Actin cDNA was amplified as a control.
(108) Aortic Ring Assay.
(109) This ex vivo angiogenesis assay was performed essentially as described with some modification (Takeshita et al., Circ. Res., 100:70 (2007), which is hereby incorporated by reference in its entirety). Briefly, descending thoracic aortas from GIT1 WT and GIT1 KO mice were harvested and placed in ice-cold M199 medium (Invitrogen). Aortas were flushed with ice-cold M199 medium until free of blood (n=3 from each group). The adventitia was dissected free, and the aorta was cut into multiple 1-mm rings under a dissecting microscope. 24-well culture plates were coated with 400 L of growth factor-reduced Matrigel (BD Bioscience) per well, then allowed to polymerize for 30 minutes at 37 C. Rings were meanwhile embedded in the growth factor-reduced Matrigel, then supplemented with medium 199, 1% fetal bovine serum, heparin (10 U/mL), antibiotics, and VEGF (50 ng/ml, Peprotech Inc.). Quantitative analysis of endothelial sprouting was performed using images from day 8, and sprout length and sprout area were quantified using ImagePro Plus software (Media Cybernetics Inc, Silver Spring, Md.).
(110) Cell Fractionation.
(111) HUVECs were harvested using buffer A (250 mM Sucrose, 20 mM HEPES, 10 mM KCl, 1.5 mM MgCl2, 1 mM EDTA, 1 mM EGTA) by incubation on ice for 20 minutes followed by shearing through a 25 G needle 10 times. The nuclear pellet was collected by centrifugation for 5 minutes. The supernatant contained membrane and cytoplasmic fractions. The nuclear pellet was washed once with buffer A. The nuclear fraction was sheared through a 25 G needle 10 times and centrifuged again at 3000 rpm for 10 minutes. The nuclear pellet was resuspended in the nuclear buffer (buffer A containing 10% glycerol and 0.1% SDS).
(112) Plasmid cDNA.
(113) Using PCR, GIT1(ANK), GIT1(ANK), and GIT1(SHD) were cloned into EGFP-C1 vector.
(114) Luciferase Reporter Assay.
(115) To assess Notch-dependent reporter hairy/enhancer-of-split1(Hey1) luciferase activity, HEK293 cells cultured in a 6-well plate were cotransfected with Hey1 luciferase reporter gene, pCMV-N1-ICD (generous gift from Dr. Eileen M. Redmond), -galactosidase (-gal) and GIT1 WT or GIT1 mutants using lipofectamine. After transfection for 20 hours, cells were harvested. The luciferase activity in cell lysates was determined using the Luciferase Reporter Assay kit (Promega) and Wallac 1420 multilabel counter (PerkinElmer). -gal activity was assayed and used to normalize for differences in transfection efficiency.
(116) Tube Formation.
(117) Tube formation was performed as described before (Pang et al., Circulation 1524 (2009), which is hereby incorporated by reference in its entirety).
(118) Sequence Analysis.
(119) The sequence alignment was performed using Uniprot.
(120) Statistical Analysis.
(121) All values are expressed as meanSE from three to eight independent experiments. Data were assessed using the student's t-test or ANOVA and P<0.05 was considered statistically significant.
Example 1
Impaired Retina Vascular Development and Vessel Sprouting in GIT1 KO Mice
(122) To define the mechanistic role of GIT1 in angiogenesis, the retina vasculature at postnatal day 5 (P5) was visualized by isolectin B4 staining. The retinas of GIT1 KO mice displayed decreases of 49.52.1% in vessel length (
Example 2
Impaired Retina Vascular Development in EC-Specific GIT1 KO Mice
(123) To demonstrate the essential role of GIT1 in ECs for postnatal retina vascular development, a floxed Git1 allele was generated and Tie2-Cre was used to conditionally inactivate Git1 in ECs (
Example 3
GIT1 Depletion Enhances Dll4-Notch1 Feedback Loop In Vivo
(124) Endothelial tip cell and filopodia numbers are tightly regulated by the VEGF-Notch-Dll4 pathway. The pathway is controlled by a feedback loop in which VEGF activates Notch1 which then increases Dll4 expression (Liu et al., Mol. Cell Biol., 23:14 (2003); Williams et al., Blood 107:931 (2006), each of which is hereby incorporate by reference in its entirety). Dll4 in turn activates Notch1 signaling in neighboring cells. This feedback acts as a negative regulator of VEGF signaling by inhibiting VEGF receptor 2 (VEGFR2) expression and is essential for the formation of a stable vascular plexus (Suchting et al., Proc. Natl. Acad. Sci. 104:3225 (2007), which is hereby incorporated by reference in its entirety). Because Dll4 is localized prominently in ECs at the leading front of the superficial retinal plexus (Hofmann et al., Circ. Res. 100:1556 (2007), which is hereby incorporated by reference in its entirety), and altering Dll4 expression dramatically changes EC tip cell and filopodia numbers, regulation of Dll4 is particularly important (Lobov et al., Proc. Natl. Acad. Sci. 104:3219 (2007); Suchting et al., Proc. Natl. Acad. Sci. 104:3225 (2007); Hellstrom et al., Nature 445:776 (2007), each of which is hereby incorporated by reference in its entirety). Dll4 protein expression was increased 5.00.3 fold in retinas and 6.00.6 fold in lungs of GIT1 KO mice compared to WT mice (
Example 4
GIT1 Depletion Enhances Dll4-Notch1 Feedback Loop In Vitro
(125) Based on these in vivo data, it was hypothesized that GIT1 inhibited the Dll4-Notch1 feedback loop. To test this hypothesis, the effect of GIT1 on Dll4-Notch1 signaling was assayed in human umbilical vein endothelial cells (HUVECs). In the canonical Notch signaling pathway, upon ligand (Delta and Serrate/Jagged) binding, Notch1 is proteolytically cleaved by -secretase to generate the Notch intracellular domain (N1-ICD). Upon N1-ICD formation, it translocates to the nucleus, where it binds to recombining binding protein suppressor of hairless (RBP-J, a known repressor of Notch angiogenesis signaling) and regulates gene expression (Phng et al., Dev. Cell 16:196 (2009); Roca et al., Genes Dev. 21:2511 (2007), each of which is hereby incorporated by reference in its entirety. It is known that Dll4 is highly expressed in confluent ECs (Zhang et al., J Biol. Chem. 286:8055 (2011), which is hereby incorporated by reference in its entirety). Therefore HUVECs were transfected with control or GIT1 siRNA for 48 h. Similar to the in vivo data, Dll4 mRNA and protein expression significantly increased by 3.20.6 and 6.30.3 fold respectively in GIT1 siRNA compared to control siRNA (
Example 5
Ankyrin Repeat Domain is Indispensible for the Effect of GIT1 on Notch Signaling and Angiogenesis
(126) A likely target for GIT1 inhibition of Dll4-Notch1 signaling is RBP-J, a known repressor of Notch signaling (Phng et al., Dev. Cell 16:196 (2009); Gridley, Development 134:2709 (2007), each of which is hereby incorporated by reference in its entirety). GIT1 localized to the nucleus by both immunohistochemistry and cell fractionation (
(127) To identify the specific domains of GIT1 required for the regulation of Notch signaling, the effects of several GIT1 domain deletion mutants on expression of Hey1 (a Notch target gene) induced by N1-ICD were studied. As a model system, HEK293 cells were used since they express almost no GIT1 (Pang et al., Arterioscler. Thromb. Vasc. Biol. 28:892 (2008), which is hereby incorporated by reference in its entirety). Transfection of GIT1(WT) decreased Hey1 luciferase activity by 50% (
(128) Previously it has been shown that GIT1 was required for VEGF stimulation of phospholipase C (PLC) and ERK1/2, and modulated EC migration and cell proliferation (Pang et al., Circulation 1524 (2009); Yin et al., Mol. Cell Biol. 24:875 (2004); Za et al., J Cell Sci. 119:2654 (2006), each of which is hereby incorporated by reference in its entirety). These critical functions of GIT1 contribute to the abnormal phenotypes observed in the lung and bone of GIT1 KO mice (Pang et al., Circulation 1524 (2009); Menon et al., J Cell Physiol. 225:777 (2010), each of which is hereby incorporated by reference in its entirety). However, the effect of GIT1 on Notch signaling is probably not due to PLC and ERK1/2 pathways, since previous data demonstrated that GIT1 interacts with PLC and MEK1-ERK1/2 through the Spa homology domain (SHD), not the ankyrin repeat domain. The major finding in this example is that GIT1 is a novel regulator of Notch1 signaling in EC. GIT1 deficiency leads to increased Dll4 expression associated with decreased tip cell formation and sprouting angiogenesis (
Example 6
Overexpression of GIT1(SHD) Inhibits PLC Activation Induced by VEGF
(129) The spa homology domain (SHD) of GIT1 is essential for several GIT1 mediated signaling pathways that are induced by tyrosine kinase receptor (TKR) and other growth factors, including PLC, MEK1-ERK1/2 and Rac1/cdc42. These signaling pathways are important for EC proliferation, migration and tube formation, which are also major steps during angiogenesis. Most importantly, GIT1 and its ortholog GIT2 are the only proteins in the mammalian genome that contain a SHD. The GIT2-KO has no defects in vasculature development suggesting that the GIT1-SHD is unique.
(130) In an effort to identify the potential GIT1 inhibitor peptides, a flag-tagged SHD domain of GIT1 (SHD-Flag) was cloned into a lentivirus vector. Since it was previously demonstrated that GIT1 interacts with PLC and MEK1-ERK1/2 through the SHD, the effect of overexpression of this domain on the ability of VEGF to activate PLC was tested.
(131) HUVECs were seeded on 6 well plate at 80% confluence. The next day, cells were infected with control and SHD-Flag containing Lentivirus with Polybrene. After 1 day, infection media was changed with fresh complete M200 media (containing 5% FBS+1% Penicillin-Streptomycin and 2% LSGS). After 48 hours, cells were serum starved with serum free M200 media for 1 hour and stimulated with VEGF (10 ng/mL) for different time points ranging from 0 to 30 minutes. Next cells were lysed and used for western blot analysis to measure PLC and ERK1/2 activation. VEGF treatment induced PLC activation after 2 minutes of treatment while overexpression of flag tagged SHD blocked VEGF induced PLC activation in HUVEC. No effect of SHD overexpression on VEGF induced ERK1/2 activation was observed. Flag tagged SHD expression in HUVECs were confirmed by detecting Flag in the lysate
(132) In addition to PLC signaling, the effect of SHD overexpression on HUVEC tube formation in vitro was also assessed. Endothelial cells reorganize themselves in a 3D matrix like matrigel and form tubes which is an index of in vitro angiogenesis. After 48 hours, cells were cultured at a constant number (104 cells/well) with VEGF on growth factor reduced matrigel (30 uL) coated 96 well plate and incubated for 16 hours. SHD overexpression inhibited the formation of tube-like structures by HUVECs compared to control treatment groups.
(133) This data demonstrates that overexpression of GIT1-SHD significant decreased PLC activation and tube formation in response to VEGF. These finding indicate that GIT1-SHD domain is a potential drug target of angiogenesis related diseases
Materials and Methods for Examples 7-13
Lentiviral Virus Preparation and Infection
(134) pLV-CMV-IRES-GFP is an HIV-1 based lentiviral expression vector that allows simultaneous expression of GIT1-ANK and EGFP from the CMV promoter. Infectious viral particles were generated by co-transfection of the transgene, with plasmids expressing viral gag/pol genes (psPAX2) and VSV-G coat protein (pMD2.G) into HEK293T cells using Fugene6 (Promega). Forty-eight to seventy-two hours post-transfection viral containing supernatants were collected, filtered through 0.45 m cellulose acetate filters and stored in aliquots at 80 C. For viral concentration, supernatants were spun at 25,000 rpm in a SW28 rotor for 2 h at 4 C. and the viral pellet resuspended in 200 l of HBSS.
(135) HUVECs were grown to 70% confluence in 6 well plate. Lentiviral particles were mixed with 8 g of Polybrene (hexadimethrine bromide) in complete M200 media and then added to the HUVECs and incubated for 48 h at 5% CO.sub.2/37 C. After 48 h of infection, cells were used for functional and biochemical studies.
(136) Generating ANK Peptide Using Interpro Tools.
(137) Interpro was used to design a GIT1-ANK blocking peptide having the amino acid sequence of GTTPLHVAAKAGQ (called ANK-Active ANK peptide; SEQ ID NO: 31). In addition to the blocking peptide, a peptide having a scrambled amino acid sequence of TLQAELLVVYGA (called sANK-Scrambled ANK peptide; SEQ ID NO: 32) was also designed as a control peptide. The HIV-1 TAT sequence YGRKKRRQRRR (SEQ ID NO: 33) was added to the front end of both the active ANK peptide and the scrambled ANK peptide sequences to achieve cell permeabilization. The peptides were synthesized by Biomatik USA, Delaware, USA.
(138) Western Blot Analysis.
(139) Cells were harvested and lysed in lysis buffer (20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM Na2EDTA, 1 mM EGTA, 1% Triton, 2.5 mM sodium pyrophosphate, 1 mM b-glycerophosphate, 1 mM Na3VO4, 1 g/ml leupeptin, Cell Signaling) with protease inhibitor cocktail. Protein concentration was determined by Bradford assay (Bio-Rad), and cell lysates were subjected to SDS-polyacrylamide gel electrophoresis (PAGE). Proteins were then transferred onto nitrocellulose membranes, and the membranes were subsequently blocked with 5% milk in PBST for 1 hour. Blots were incubated overnight at 4 C. with appropriate primary antibodies. After being washed 3 times with PBS/0.1% Tween20, membranes were incubated with HRP conjugated secondary antibodies for 1 hour. Blots were developed using the ECL technique. Densitometry analysis was performed using the Image J software.
(140) Matrigel Plug Angiogenesis Assay.
(141) Matrigel (250 L) containing VEGF (50 ng/mL) with lenti-virus vector/lenti-GIT1-ANK and sANK/ANK peptide (75 M) were injected subcutaneously on the ventral side of the mouse in the groin area close to the dorsal midline, vector or sANK peptide on left center of back, and GIT1-ANK or ANK peptide on right center of back. Seven days after injections, matrigel plugs were harvested, fixed with 10% neutral buffered formalin, sectioned and processed for hematoxylin and eosin staining (HE staining) Vessel density was evaluated by von Willebrand factor (vWF), and infection efficiency of lentivirus was detected by green fluorescent protein (GFP) staining.
(142) Endothelial Tube Formation Assay.
(143) Growth Factor reduced Matrigel (BD Bioscience 354230) was thawed overnight at 4 C. Each well of 96 well plates were coated with 40 L of matrigel and kept in the 37 C. incubator for 30 minutes for gelatinization. HUVEC at P4 were harvested and suspended in non-supplemented Medium 200. The concentration of the cells was determined by hemocytometer counting technique. HUVECs (3000) in suspension with 30 M ANK peptide and 50 ng/mL VEGF were loaded per 96 well and incubated at 37 C., 5% CO.sub.2 overnight. The following day, formed tubes were imaged under 4 objective of the microscope and analyzed using Image J software.
Example 7
Overexpression of ANK in HUVEC Increases Dll4 Protein Expression
(144) HUVEC were plated on 6 well plates at 90% confluence and incubated overnight. Cells were treated with Lenti-vector or Lenti-ANK and incubated for 24 hour at 37 C., 5% CO.sub.2. Cells were lysed and western blotting was performed to measure the Dll4 protein expression. ANK overexpression in HUVEC increased Dll4 protein expression by 1.6 fold compared to vector treated cells (
Example 8
ANK Lenti-Virus Treatment Blocks In Vivo Angiogenesis
(145) Matrigel plugs were generated by subcutaneous injection of 250 l matrigel containing lenti-GFP and lenti-GFP-ANK in GIT1-WT mice. After 7 days, plugs were harvested and imaged. Paraffin embedded sections of the plugs were stained for hematoxylin and eosin.
(146) The Notch signaling system is extremely complex. Therefore, while these in vivo results appear somewhat inconsistent with the in vitro angiogenesis data of
Example 9
ANK Lenti-Virus Treatment Rescues Impaired Angiogenesis in GIT1-KO Mice
(147) The effects of lenti-GIT1-ANK on angiogenesis in GIT1-KO mice was also assessed using VEGF containing matrigel plugs. There was a significant increase in vessel number in lenti-GIT1-ANK treated plugs compared to lenti-vector treated plugs both on gross appearance (compare
Example 10
ANK Peptide Increases Dll4 Protein Expression in HUVEC
(148) HUVEC were plated in 6 well plate at 90% confluence and incubated overnight at 37 C., 5% CO.sub.2. Cells were treated with 15 M sANK and ANK peptide and incubated for 24 hours. ANK treatment increased Dll4 expression by 2.7 fold compared to sANK treated controls as shown in the Western blot of
Example 11
ANK Peptide Attenuates VEGF Induced Tube Formation in HUVEC
(149) To study the effect of ANK peptide on in vitro angiogenesis, tube formation assays were performed. ANK peptide treatment inhibited tube formation by 59% compared to sANK treated controls (
Example 12
ANK Peptide Inhibits Angiogenesis In Vivo
(150) Matrigel plugs were generated by subcutaneous injection of 250 L matrigel containing sANK and ANK (75 M) in C57 mice. Plugs were harvested and imaged. The images showed significant inhibition of peripheral vascular structures in the plugs treated with ANK peptide compared to sANK treated controls (compare
Example 13
ANK Peptides Inhibit VEGF Induced PLC Activation in HUVEC
(151) HUVECs were plated on 6 well tissue culture plates and grown overnight. The following day, cells were treated with 15 M of sANK and ANK peptide for 4 hours in low serum media. After 4 hours, cells were stimulated with 10 ng/mL of VEGF for different time points. Cells were lysed for western blot to measure ERK1/2 and PLC activation. A significant inhibition of VEGF induced PLC activation at 15 and 30 minutes in ANK treated HUVEC was observed (