RECOMBINANT AAV FOR THE GENE THERAPY OF FABRY DISEASE
20250066812 ยท 2025-02-27
Assignee
Inventors
Cpc classification
C12N2750/14143
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K38/47
HUMAN NECESSITIES
A61K38/47
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N9/2465
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
A61K38/47
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
Abstract
The present invention provides a polynucleotide and recombinant AAV encoding human alpha galactosidase A. The present invention also provides a method of treating Fabry disease comprising administering the recombinant AAV to a subject in need thereof.
Claims
1. A recombinant adeno-associated virus (rAAV) comprising a genome comprising an expression construct comprising a polynucleotide of interest that comprises a nucleotide sequence selected from SEQ ID NOs: 1, 2, 3 and 4, and is operably linked to a promoter.
2. The rAAV of claim 1, wherein the construct further comprises an intron.
3. The rAAV of claim 2, wherein the intron is between the promoter and the polynucleotide of interest.
4. The rAAV of claim 2, wherein the intron is at least 200 nucleotides in length.
5. The rAAV claim 2, wherein the intron is selected from a chicken beta-actin (CBA) chimeric intron and a modified CBA chimeric intron set forth in SEQ ID NOs: 5 and 6, respectively.
6. The rAAV of claim 1, wherein the construct further comprises an enhancer.
7. The rAAV of claim 6, wherein the enhancer is upstream of the promoter.
8. The rAAV of claim 6, wherein the enhancer is a CMV early enhancer set forth in SEQ ID NO: 9.
9. The rAAV of claim 1, wherein the promoter is a chicken beta-actin core promoter set forth in SEQ ID NO: 10.
10. A pharmaceutical composition comprising the rAAV of claim 1.
11. The rAAV or the pharmaceutical composition of claim 10, for use in the treatment of a disease associated with the deficiency of alpha galactosidase A (-Gal A).
12. The rAAV or the pharmaceutical composition of claim 10, wherein the disease is Fabry disease.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
DETAILED DESCRIPTION
1. Definitions
[0035] Unless otherwise indicated, all terms used herein have the same meaning as they would to one skilled in the art, and the practice of the present invention will employ conventional techniques of microbiology and recombinant DNA technology, which are within the knowledge of those of skill in the art.
[0036] As used herein, GLA and -Gal A are exchangeable when referring to a protein, and mean alpha galactosidase A. For example, the GLA activity in a tissue means the activity of alpha galactosidase A therein. GLA may also mean the gene encoding alpha galactosidase A when referring to a nucleic acid.
[0037] Adeno-associated virus (AAV) is a member of Parvoviridae family. It is a simple single-stranded DNA virus, and requires a helper virus (such as adenovirus) for replication. The genome of a wildtype AAV contains approximately 4.7 kilobases (kb), comprising the cap and rep genes between two inverted terminal repeat (ITR) sequences, approximately 145 nucleotides in length, with interrupted palindromic sequences that can fold into hairpin structures that function as primers during initiation of DNA replication. The cap gene encodes the viral capsid protein, and the rep gene is involved in the replication and integration of AAV.
[0038] AAV can infect a variety of cells, and the viral DNA can be integrated into human chromosome 19 in the presence of the rep product.
[0039] As used herein, the term inverted terminal repeats or ITRs as used herein refers to AAV viral cis-elements named due to their symmetry. These elements are essential for efficient multiplication of an AAV genome. In the present invention, the term ITR refers to ITRs of known natural AAV serotypes, to chimeric ITRs formed by the fusion of ITR elements derived from different serotypes, and to functional variant thereof.
[0040] The production of a recombinant AAV particle may involve three plasmids, a transgene plasmid comprising an expression construct for expressing an exogenous polynucleotide, a packaging plasmid encoding the REP and/or CAP proteins, and a helper plasmid.
[0041] As used herein, the term expression construct refers to a single-stranded or double-stranded polynucleotide, which is isolated from a naturally occurring gene or modified to contain a nucleic acid segment that does not naturally occur. The expression construct may contain the control sequences required to express the coding sequence of the present invention.
[0042] As used herein, the term polynucleotide usually refers to generally a nucleic acid molecule (e.g., 100 bases and up to 30 kilobases in length) and a sequence that is either complementary (antisense) or identical (sense) to the sequence of a messenger RNA (mRNA) or miRNA fragment or molecule. The term can also refer to DNA or RNA molecules that are either transcribed or non-transcribed.
[0043] The term exogenous polynucleotide as used herein refers to a nucleotide sequence that does not originate from the host in which it is placed. It may be identical to the host's DNA or heterologous. An example is a sequence of interest inserted into a vector. Such exogenous DNA sequences may be derived from a variety of sources including DNA, cDNA, synthetic DNA, and RNA. Exogenous polynucleotides also encompass DNA sequences that encode antisense oligonucleotides.
[0044] As used herein, the term expression includes any step involved in the production of a polypeptide, including but not limited to transcription, post-transcriptional modification, translation, post-translational modification, and secretion.
[0045] A control sequence includes all elements necessary or beneficial for the expression of the polynucleotide encoding the polypeptide of the present invention. Each control sequence may be natural or foreign to the nucleotide sequence encoding the polypeptide, or natural or foreign to each other. Such control sequences include, but are not limited to, leader sequence, polyadenylation sequence, propeptide sequence, promoter, enhancer, signal peptide sequence, and transcription terminator. At a minimum, control sequences include a promoter and signals for the termination of transcription and translation.
[0046] For example, the control sequence may be a suitable promoter sequence, a nucleotide sequence recognized by the host cell to express the polynucleotide encoding the polypeptide of the present invention. The promoter sequence contains a transcription control sequence that mediates the expression of the polypeptide. The promoter may be any nucleotide sequence that exhibits transcriptional activity in the selected host cell, for example, lac operon of E. coli.
[0047] The promoters also include mutant, modified and hybrid promoters, and can be obtained from genes encoding extracellular or intracellular polypeptides, which are homologous or heterologous to the host cell.
[0048] In some cases, an intron can be included in the construct to improve the expression of the coding sequence. A modified intron comprises a modification such as substitution, insertion or deletion of one or more nucleotides in an internal region of an initial intron.
[0049] As used herein, the term operably linked herein refers to a configuration in which a control sequence is placed at an appropriate position relative to the coding sequence of the polynucleotide sequence, whereby the control sequence directs the expression of the polypeptide coding sequence.
[0050] The polynucleotide encoding the GLA protein can be subjected to various manipulations to improve the expression of the polypeptide. Before the insertion thereof into a vector, manipulation of the polynucleotide according to the expression vector or the host, such as codon optimization, is desirable or necessary.
[0051] The term recombinant as used herein refers to nucleic acids, vectors, polypeptides, or proteins that have been generated using DNA recombination (cloning) methods and are distinguishable from native or wild-type nucleic acids, vectors, polypeptides, or proteins.
[0052] The terms polypeptide and protein are used interchangeably herein and refer to a polymer of amino acids and includes full-length proteins and fragments thereof.
[0053] As used herein, the term host cell refers to, for example microorganisms, yeast cells, insect cells, and mammalian cells, that can be, or have been, used as recipients of rAAV vectors. The term includes the progeny of the original cell which has been transduced. Thus, a host cell as used herein generally refers to a cell which has been transduced with an exogenous DNA sequence. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to natural, accidental, or deliberate mutation.
[0054] The term pharmaceutically acceptable as used herein refers to molecular entities and compositions that are physiologically tolerable and do not typically produce toxicity or an allergic or similar untoward reaction, such as gastric upset, dizziness and the like, when administered to a human.
[0055] The term subject as used herein includes, but is not limited to, humans, nonhuman primates such as chimpanzees and other apes and monkey species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats and guinea pigs, and the like. The term does not denote a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are intended to be covered.
2. The Polynucleotide or Construct for Expressing GLA
[0056] Gene therapy aims to correct defective genes that underlie the development of diseases, and to introduce exogenous gene into the cell of interest in a subject to express the product of the exogenous gene that is useful for treating a certain disease, such as Fabry disease. A common approach for this purpose involves the delivery of a functional gene such as GLA to the nucleus. This gene may then be inserted into the genome of the cell of interest or may remain episomal. Delivery of a functional gene to a subject's target cells can be carried out via numerous methods, including the use of viral vectors. Among the many viral vectors available (e.g, retrovirus, lentivirus, adenovirus, and the like), AAV is gaining popularity as a versatile vector in gene therapy.
[0057] Vectors derived from AAV are particularly attractive for delivering genetic material because (i) they are able to infect (transduce) a wide variety of non-dividing and dividing cell types including muscle fibers and neurons; (ii) they are devoid of the virus structural genes, thereby eliminating the natural host cell responses to virus infection, e.g., interferon-mediated responses; (iii) wild-type viruses have never been associated with any pathology in humans; (iv) in contrast to wild type AAVs, which are capable of integrating into the host cell genome, replication-deficient AAV vectors generally persist as episomes, thus limiting the risk of insertional mutagenesis or activation of oncogenes; and (v) in contrast to other vector systems, AAV vectors do not trigger a significant immune response (see ii), thus granting long-term expression of the therapeutic transgenes (provided their gene products are not rejected). AAV vectors can also be produced at high titer and it has been reported that intra-arterial, intra-venous, or intra-peritoneal injections allow gene transfer to significant muscle regions in rodents through a single injection.
[0058] The present invention thus intends to provide a polynucleotide of interest, an expression construct, or a vector comprising the polynucleotide of interest or the expression construct, for expressing GLA in a subject. In some embodiments, the GLA can be from any animal species, including but not limited to, human, nonhuman primates such as chimpanzees and other apes and monkey species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats and guinea pigs, and the like.
[0059] In some embodiments, the GLA is human GLA. In some embodiments, the GLA comprise the amino acid sequence of SEQ ID NO: 12 or an allelic variant thereof. In some embodiments, the GLA is a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12.
[0060] In some embodiments, the polynucleotide encoding GLA is codon-optimized to improve the expression.
[0061] In some embodiments, the polynucleotide comprises a nucleotide sequence selected from SEQ ID NOs: 1, 2, 3 and 4. Surprisingly, the inventors found that the polynucleotide with a nucleotide sequence of SEQ ID NO: 4 achieves a higher expression of GLA than SEQ ID NOs: 1, 2 and 3 in various tissues, including liver, heart, kidney, brain, spinal cord, plasma, etc.
[0062] In some embodiments, the polynucleotide comprises SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0063] In some embodiments, the polynucleotide comprises SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0064] In some embodiments, the polynucleotide comprises SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0065] In some embodiments, the polynucleotide comprises SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the polynucleotide comprises a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4 and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0066] The present invention also provides an expression construct for expressing GLA, which comprises a polynucleotide of interest encoding GLA operably linked to a promoter. In some embodiments, the GLA is human GLA. In some embodiments, the GLA comprises the amino acid sequence of SEQ ID NO: 12 or an allelic variant thereof.
[0067] In some embodiments, the nucleotide sequence is codon-optimized to improve the expression. In some embodiments, the codon-optimized nucleotide sequence is selected from SEQ ID NOs: 1, 2, 3 and 4. Surprisingly, the inventors found that the polynucleotide with a nucleotide sequence of SEQ ID NO: 4 achieves a higher expression of GLA than SEQ ID NOs: 1, 2 and 3 in various tissues, including liver, heart, kidney, brain, spinal cord, plasma, etc.
[0068] In some embodiments, the nucleotide sequence is SEQ ID NO: 1 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0069] In some embodiments, the nucleotide sequence is SEQ ID NO: 2 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0070] In some embodiments, the nucleotide sequence is SEQ ID NO: 3 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0071] In some embodiments, the nucleotide sequence is SEQ ID NO: 4 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4 and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0072] The construct will generally be transferred to mammalian cells (such as human cells) for expression. Such constructs often include promoter-enhancers for high-level expression, for example the SV40 promoter-enhancer, the human cytomegalovirus (CMV) promoter and the long terminal repeat of Rous sarcoma virus (RSV). These promoter-enhancers are active in many cell types. Tissue and cell-type promoters and enhancer regions also can be used for expression. Exemplary promoter/enhancer regions include, but are not limited to, those from genes such as elastase I, insulin, immunoglobulin, mouse mammary tumor virus, albumin, alpha fetoprotein, alpha 1 antitrypsin, beta globin, myelin basic protein, myosin light chain 2, and gonadotropic releasing hormone gene.
[0073] In some embodiments, the promoter is a constitutive promoter. In some embodiments, the promoter is a chicken beta-actin core promoter. In some embodiments, the promoter comprises SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10.
[0074] In some embodiments, the expression construct further comprises an enhancer. In some embodiments, the enhancer is upstream of the promoter. In some embodiments, the enhancer is a cytomegalovirus (CMV) early enhancer. In some embodiments, the enhancer comprises SEQ ID NO: 9, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97% 98%, or 99% identical to SEQ ID NO: 9.
[0075] It is also desirable to include an intron (e.g., an intron derived from a eukaryotic organism or an artificial intron) in the construct to increase the expression in eukaryotic cells. In some embodiments, the expression construct further comprises an intron. In some embodiments, the intron is upstream of the nucleotide encoding GLA. In some embodiments, the intron is downstream of the promoter.
[0076] The inventor surprisingly found that the incorporation of a longer intron led to an increased expression. In some embodiments, the intron is at least 200 nucleotides in length. In some embodiments, the intron is up to about 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1,000, 1,050, 1,100, 1,200, 1,300, 1,400, or 1,500 nucleotides in length. In some embodiments, the intron is 200-1,500, 200-1,400, 250-1,300, 300-1,200, 400-1,300, 400-1,200, or 400-1,100 nucleotides in length.
[0077] In some embodiments, the intron is a chicken beta-actin (CBA) chimeric intron, which is, e.g., set forth in SEQ ID NO: 5. In some embodiments, the intron is a modified CBA chimeric intron. In some embodiments, the modified intron comprises a modification such as substitution, insertion or deletion of one or more nucleotides in a region of 662 nucleotides between positions 223 and 893 as compared to SEQ ID NO: 5. In some embodiments, the modification is a deletion. In some embodiments, the modification is a deletion of 662 consecutive nucleotides, e.g. nucleotides 224-885, 225-886, 226-887, 227-888, 228-889, 229-890, 230-891, or 231-892 In some embodiments, the modified CBA chimeric intron is set forth in SEQ ID NO: 6.
[0078] In some embodiments, the modified CBA chimeric intron, as compared to SEQ ID NO: 5, comprises a deletion of a fragment, which is up to 662 bp in length, from the region between positions 223 and 893 of SEQ ID NO: 5. In some embodiments, the fragment is 2-660, 5-650, 10-600, 25-500, 50-400, 75-300, 100-200 nucleotides in length. In some embodiments, the fragment is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650 nucleotides and up to 662 nucleotides in length. In some embodiments, the fragment comprises 2-660, 5-650, 10-600, 25-500, 50-400, 75-300, 100-200 consecutive nucleotides between positions 223 and 893 of SEQ ID NO: 5. In some embodiments, the fragment comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, and up to 662 consecutive nucleotides between positions 223 and 893 of SEQ ID NO: 5.
[0079] In some embodiments, the intron comprises SEQ ID NO: 5 or 6, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5 or 6.
[0080] The expression construct further comprises a polyadenylation signal sequence for the processing of the transcript. In some embodiments, the construct comprises a polyadenylation signal sequence downstream of the nucleotide sequence encoding GLA. In some embodiments, the polyadenylation signal sequence comprises SEQ ID NO: 11, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0081] In some embodiments, the expression construct comprises, in the order of 5 to 3, an enhancer, a promoter, an intron, a polynucleotide of interest encoding GLA, and a polyadenylation signal sequence.
[0082] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0083] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0084] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0085] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0086] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and [0087] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0088] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0089] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0090] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0091] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0092] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and [0093] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0094] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0095] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0096] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0097] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0098] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and [0099] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0100] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0101] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0102] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0103] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0104] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and [0105] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0106] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0107] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0108] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0109] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0110] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and [0111] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0112] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0113] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0114] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0115] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0116] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and [0117] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0118] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0119] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0120] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0121] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0122] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and [0123] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0124] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0125] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0126] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0127] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0128] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and [0129] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0130] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0131] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0132] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0133] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0134] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0135] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0136] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0137] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0138] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0139] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0140] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0141] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0142] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0143] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0144] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0145] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0146] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0147] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0148] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0149] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0150] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0151] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0152] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0153] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0154] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0155] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0156] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0157] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0158] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0159] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0160] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0161] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0162] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0163] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0164] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0165] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0166] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0167] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0168] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0169] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0170] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0171] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0172] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0173] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0174] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0175] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0176] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0177] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0178] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11.
[0179] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11.
[0180] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11.
[0181] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11.
[0182] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0183] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0184] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0185] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0186] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 1, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 1, and SEQ ID NO: 11.
[0187] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 2, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 2, and SEQ ID NO: 11.
[0188] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 3, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 3, and SEQ ID NO: 11.
[0189] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 4, and SEQ ID NO: 11.
3. Recombinant AAV, Pharmaceutical Composition and Host Cell
[0190] The present invention further provides a recombinant AAV (rAAV) comprising a genome comprising the expression construct of the invention. In some embodiments, the expression construct flanked by 5 and 3 inverted terminal repeats (ITRs) of AAV.
[0191] In some embodiments, the rAAV of the invention can be selected from human serotype 1 AAV (hAAV1), hAAV2, hAAV3, hAAV4, hAAV5, hAAV6, hAAV7, hAAV8, hAAV9, hAAV10, and hAAV11. In some embodiments, the rAAV is hAAV9.
[0192] In some embodiment, the genome of the rAAV comprises an expression construct flanked by 5 and 3 ITRs of AAV.
[0193] In some embodiments, the construct comprises a nucleotide sequence encoding GLA that is operably linked to a promoter. In some embodiments, the GLA is human GLA. In some embodiments, the GLA comprise the amino acid sequence of SEQ ID NO: 12 or an allelic variant thereof.
[0194] In some embodiments, the nucleotide sequence is codon-optimized to improve the expression. In some embodiments, the codon-optimized nucleotide sequence is selected from SEQ ID NOs: 1, 2, 3 and 4. Surprisingly, the inventors found that the polynucleotide with a nucleotide sequence of SEQ ID NO: 4 achieves a higher expression of GLA than SEQ ID NOs: 1, 2 and 3 in various tissues, including liver, heart, kidney, brain, spinal cord, plasma, etc.
[0195] In some embodiments, the nucleotide sequence is SEQ ID NO: 1 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0196] In some embodiments, the nucleotide sequence is SEQ ID NO: 2 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0197] In some embodiments, the nucleotide sequence is SEQ ID NO: 3 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0198] In some embodiments, the nucleotide sequence is SEQ ID NO: 4 or at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and encodes a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the polypeptide of SEQ ID NO: 12. In some embodiments, the nucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4 and encodes the polypeptide of SEQ ID NO: 12 or an allelic variant thereof.
[0199] In some embodiments, the promoter is a constitutive promoter. In some embodiments, the promoter is a chicken beta-actin core promoter. In some embodiments, the promoter comprises SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10.
[0200] In some embodiments, the expression construct further comprises an enhancer. In some embodiments, the enhancer is upstream of the promoter. In some embodiments, the enhancer is a cytomegalovirus (CMV) early enhancer. In some embodiments, the enhancer comprises SEQ ID NO: 9, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97% 98%, or 99% identical to SEQ ID NO: 9.
[0201] It is also desirable to include an intron (e.g., an intron derived from a eukaryotic organism or an artificial intron) in the construct to increase the expression in eukaryotic cells. In some embodiments, the expression construct further comprises an intron. In some embodiments, the intron is upstream of the nucleotide encoding GLA. In some embodiments, the intron is downstream of the promoter.
[0202] The inventor surprisingly found that the incorporation of a longer intron led to an increased expression. In some embodiments, the intron is at least 200 nucleotides in length. In some embodiments, the intron is up to about 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1,000, 1,050, 1,100, 1,200, 1,300, 1,400, or 1,500 nucleotides in length. In some embodiments, the intron is 200-1,500, 200-1,400, 250-1,300, 300-1,200, 400-1,300, 400-1,200, or 400-1,100 nucleotides in length.
[0203] In some embodiments, the intron is a chicken beta-actin (CBA) chimeric intron, which is, e.g., set forth in SEQ ID NO: 5. In some embodiments, the intron is a modified CBA chimeric intron. In some embodiments, the modified intron comprises a modification such as substitution, insertion or deletion of one or more nucleotides in a region of 662 nucleotides between positions 223 and 893 as compared to SEQ ID NO: 5. In some embodiments, the modification is a deletion. In some embodiments, the modification is a deletion of 662 consecutive nucleotides, e.g. nucleotides 224-885, 225-886, 226-887, 227-888, 228-889, 229-890, 230-891, or 231-892 In some embodiments, the modified CBA chimeric intron is set forth in SEQ ID NO: 6.
[0204] In some embodiments, the modified CBA chimeric intron, as compared to SEQ ID NO: 5, comprises a deletion of a fragment, which is up to 662 bp in length, from the region between positions 223 and 893 of SEQ ID NO: 5. In some embodiments, the fragment is 2-660, 5-650, 10-600, 25-500, 50-400, 75-300, 100-200 nucleotides in length. In some embodiments, the fragment is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650 nucleotides and up to 662 nucleotides in length. In some embodiments, the fragment comprises 2-660, 5-650, 10-600, 25-500, 50-400, 75-300, 100-200 consecutive nucleotides between positions 223 and 893 of SEQ ID NO: 5. In some embodiments, the fragment comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, and up to 662 consecutive nucleotides between positions 223 and 893 of SEQ ID NO: 5.
[0205] In some embodiments, the intron comprises SEQ ID NO: 5 or 6, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5 or 6.
[0206] The expression construct further comprises a polyadenylation signal sequence for the processing of the transcript. In some embodiments, the construct comprises a polyadenylation signal sequence downstream of the nucleotide sequence encoding GLA. In some embodiments, the polyadenylation signal sequence comprises SEQ ID NO: 11, or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0207] In some embodiments, the expression construct comprises, in the order of 5 to 3, an enhancer, a promoter, an intron, a nucleotide encoding GLA, and a polyadenylation signal sequence.
[0208] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0209] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0210] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0211] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0212] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and [0213] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0214] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0215] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0216] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0217] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0218] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and [0219] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0220] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0221] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0222] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0223] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0224] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and [0225] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0226] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0227] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0228] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0229] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0230] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and [0231] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0232] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0233] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0234] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0235] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0236] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and [0237] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0238] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0239] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0240] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0241] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0242] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and [0243] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0244] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0245] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0246] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0247] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0248] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and [0249] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0250] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0251] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0252] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0253] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0254] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and [0255] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0256] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0257] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0258] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0259] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0260] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0261] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0262] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0263] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0264] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0265] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0266] SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0267] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0268] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0269] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0270] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0271] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0272] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0273] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0274] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0275] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0276] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0277] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0278] SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0279] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0280] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0281] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0282] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0283] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0284] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0285] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0286] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0287] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0288] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0289] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0290] SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0291] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0292] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0293] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0294] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0295] SEQ ID NO: 5 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 5, [0296] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0297] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0298] In some embodiments, the expression construct comprises, in the order of 5 to 3, [0299] SEQ ID NO: 9 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 9, [0300] SEQ ID NO: 10 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 10, [0301] SEQ ID NO: 6 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 6, [0302] SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12, and [0303] SEQ ID NO: 11 or a nucleotide sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 11.
[0304] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11.
[0305] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11.
[0306] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11.
[0307] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11.
[0308] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 1 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 1, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0309] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 2 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 2, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0310] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 3 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 3, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0311] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 4 or a nucleotide sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 4, and SEQ ID NO: 11, wherein the nucleotide sequence encodes the GLA of SEQ ID NO: 12 or an allelic variant thereof, or a functional GLA polypeptide, such as a GLA polypeptide having at least 10%, 20%, 30%, 40%, 50%, 60% 70%, 80%, 90%, 100% or more activity of the GLA of SEQ ID NO: 12.
[0312] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 1, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 1, and SEQ ID NO: 11.
[0313] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 2, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 2, and SEQ ID NO: 11.
[0314] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 3, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 3, and SEQ ID NO: 11.
[0315] In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4, and SEQ ID NO: 11. In some embodiments, the expression construct comprises, in the order of 5 to 3, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 6, SEQ ID NO: 4, and SEQ ID NO: 11.
[0316] The inventors found that the rAAV of the present invention can achieve a desired safety, e.g., when being administered by intravenous injection. For example, the safety can be evaluated by the comparison of the body weight gain of a subject injected with the rAAV with the body weight gain of a control subject injected with the vehicle for delivering the rAAV Alternatively, the desired safety can be demonstrated by low or even no liver toxicity upon administration by intravenous injection, which can be evaluated, e.g., by ALT and/or AST levels after the injection of the rAAV similar to or same with the control.
[0317] The present invention also provides a method for preparing the rAAV. In some embodiments, the rAAV is prepared by a system containing a transgene plasmid comprising the genome of the rAAV, a packaging plasmid encoding the REP and/or CAP proteins, and a helper plasmid, e.g., a host cell such as a mammalian cell comprising the transgene plasmid comprising the genome of the rAAV, the packaging plasmid encoding the REP and/or CAP proteins, and the helper plasmid. Therefore, the present invention also provides a vector such as a plasmid comprising the genome of the rAAV of the invention.
[0318] In some embodiments, the rAAV can be packaged as described in Crosson S M et al. [12].
[0319] In some embodiments, the genome of the rAAV, from 5 end of the 5 ITR to the 3 end of the 3 ITR, is about 4,700 nucleotides in length. In some embodiments, the genome of the rAAV, from 5 end of the 5 ITR to the 3 end of the 3 ITR, is 4,600-4,800, 4,620-4,780, 4,640-4,760, 4,650-4,750, 4,660-4,740, 4,670-4,730, 4,680-4,720 or 4,690-4,710 nucleotides in length. In some embodiments, the genome of the rAAV comprises a stuffer fragment. In some embodiments, the stuffer fragment is downstream of the polyadenylation signal sequence.
[0320] In some embodiments, the genome of the rAAV comprises, in the order of 5 to 3, 5 ITR, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4, SEQ ID NO: 11, SEQ ID NO: 26, and 3 ITR. In some embodiments, the genome of the rAAV comprises, in the order of 5 to 3, 5 ITR, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 5, SEQ ID NO: 4, SEQ ID NO: 11, SEQ ID NO: 27, and 3 ITR.
[0321] The present invention also provides a pharmaceutical composition comprising the rAAV Pharmaceutical compositions containing the AAV of the invention can be formulated in any conventional manner by mixing a selected amount of the rAAV with one or more pharmaceutically acceptable carriers or excipients.
[0322] Selection of the carrier or excipient is within the skill of the administering professional and can depend upon a number of parameters. These include, for example, the mode of administration (i.e., systemic, oral, local, topical or any other mode) and the disease to be treated. Pharmaceutical carriers or vehicles suitable for administration of the rAAV provided herein include any such carriers known to those skilled in the art to be suitable for the particular mode of administration.
[0323] In some embodiments, the pharmaceutical composition is formulated for parenteral administration, e.g., intravenous, intramuscular, or subcutaneous injection. In some embodiments, the pharmaceutical composition is formulated for local administration.
[0324] The inventors found that the pharmaceutical composition of the present invention can achieve a desired safety, e.g., when being administered by intravenous injection. For example, the safety can be evaluated by the comparison of the body weight gain of a subject injected with the pharmaceutical composition with the body weight gain of a control subject injected with the vehicle for delivering the rAAV. Alternatively, the desired safety can be demonstrated by low or even no liver toxicity upon administration by intravenous injection, e.g., the liver toxicity can be evaluated by ALT and/or AST levels after the injection of the rAAV similar to or same with the control.
[0325] The present invention further provides a vector comprising the genome of the rAAV, wherein the genome of rAAV comprises the expression construct of the invention flanked by 5 and 3 ITRs. In some embodiments, the vector is a transgene plasmid for the packaging of rAAV.
[0326] The present invention further provides a host cell comprising the polynucleotide, the expression construct, and/or the vector of the present invention. In some embodiment, the host cell is a mammalian cell, such as a human cell. In some embodiment, the host cell is HEK293T cell.
4. Treatment of Diseases
[0327] The present invention provides a method of treating a disease associated with the deficiency of alpha galactosidase A (-Gal A), comprising administering the rAAV or the pharmaceutical composition of the present invention to a subject in need thereof. In some embodiments, the disease is Fabry disease. In some embodiments, the rAAV or the pharmaceutical composition is administered by intravenous injection.
[0328] The present invention further provides use of the polynucleotide, the expression construct, the rAAV, the pharmaceutical composition, the vector or the host cell of the present invention in the preparation of a medicament for treating a disease associated with the deficiency of alpha galactosidase A (-Gal A) in a subject in need thereof. In some embodiments, the disease is Fabry disease. In some embodiments, the medicament is administered by intravenous injection.
[0329] Provided is the rAAV and/or the pharmaceutical composition of the present invention, for use in the treatment of a disease associated with the deficiency of alpha galactosidase A (-Gal A) in a subject in need thereof. In some embodiments, the disease is Fabry disease. In some embodiments, the rAAV and/or the pharmaceutical composition is administered by intravenous injection.
[0330] In some embodiments, the treatment increases the GLA activity in the subject. In some embodiments, the treatment increases the GLA activity in the tissues including but not limited to plasma, kidney, liver, heart, brain and spinal cord.
[0331] In some embodiments, the treatment decreases the Gb3 and/or lyso-Gb3 concentrations in the subject. In some embodiments, the treatment decreases the Gb3 and/or lyso-Gb3 concentrations in the tissues including but not limited to plasma, kidney, liver, heart, brain and spinal cord.
[0332] In some embodiments, the subject is a human. In some embodiments, the subject is male. In some embodiments, the subject is female.
[0333] In some embodiments, the treatment cures, improves, alleviates, blocks or partially blocks the symptoms of Fabry disease.
EXAMPLES
[0334] The following Examples are provided for illustration only, rather than for any limitation to the present application.
Example 1. Preparation of the rAAVs
[0335] Seven constructs comprising the genomes of rAAVs were prepared by Gibson Assembling the pGCB108 plasmid comprising the cytomegalovirus (CMV) early enhancer (SEQ ID NO: 9) and the chicken beta-actin core promoter (SEQ ID NO: 10) with the introns and coding sequences (various versions of codon optimization) shown in Table 1. The structure of the constructs is shown in
TABLE-US-00001 TABLE 1 Elements in the constructs Enhancer and hGLA Coding Promoter Intron Sequence PolyA (SEQ (SEQ (SEQ (SEQ Constructs ID NO:) ID NO:) ID NO:) ID NO:) 103 9 and 10 5 1 11 104 9 and 10 5 2 11 105 9 and 10 5 3 11 106 9 and 10 5 4 11 108 9 and 10 6 4 11 109 9 and 10 7 4 11 110 9 and 10 8 4 11
[0336] As an example, and the map of the transgene plasmid comprising construct 108 is shown in
[0337] The rAAVs were produced by packaging the genomes in hAAV9 capsid as described in Crosson S M et al. [12]. Briefly, HEK293T cells were cotransfected, using polyethylenimine, with the helper plasmid, the packaging plasmid encoding rep2/cap9 and the transgene plasmid. Following 72 h incubation at 37 C., cells were harvested, and viral particles were purified through an iodixanol gradient. Virus titer, expressed as vg per milliliter, was measured by qPCR using a pair of primers (SEQ ID NOs: 14 and 15) and a probe (SEQ ID NO: 16, with 5 FAM and 3 BHQ-1 modifications) targeting RBG polyA. A Pvu I linearized transgene plasmid was prepared to generate a standard curve. The thermal cycling conditions were 95 C. for 10 min, followed by 40 cycles of 95 C. for 15 s and 60 C. for 1 min.
[0338] The titers of the obtained rAAVs were shown in Table 2, in which the rAAVs were named with the constructs comprised therein, e.g., rAAV 106 means the rAAV comprising construct 106 in Table 1. It can be seen that the rAAVs were obtained at comparable levels.
TABLE-US-00002 TABLE 2 Titers of the obtained rAAVs rAAVs Titer (vg/mL) 103 3.60E+13 104 1.91E+13 105 2.76E+13 106 3.10E+13 108 6.32E+13 109 8.51E+13 110 6.70E+13
Example 2. Expression of GLA in Wild-Type Mice with the rAAVs
[0339] The seven rAAVs prepared in Example 1 were diluted in formulation buffer (DPBS) and injected into the tail veins of 6- to 8-week-old wild-type C57BL/6 male mice at the dose of 5e10 vg, 1.6e11 vg or 5e11 vg per mouse.
[0340] Mice were sacrificed 1 month after the injection of the rAAVs. Blood samples were collected in EDTA K2-coated tubes from medial canthus of the eye, and plasma was isolated by centrifugation at 2,000 g for 15 min at 4 C. The tissues were snap frozen in liquid nitrogen and stored at 80 C. until use.
[0341] The GLA activity in plasma and the tissue samples were analyzed using the BioVision alpha galactosidase (-Gal) activity assay kit according to the manufacturer's instructions.
[0342] As shown in
[0343] The higher level of GLA activities achieved by rAAVs 106 and 108 than rAAVs 109 and 110 (
Example 3. Treatment of Fabry Disease Model (GLA KO Mice) with rAAVs
3.1. Evaluation of the Short-Term Efficacy of the Treatments with rAAVs 106 and 108 in GLA KO Mice
[0344] The rAAVs 106 and 108 were diluted in formulation buffer (DPBS) and injected into the tail veins of 3-month-old female and male GLA KO mice (Purchased from The Jackson Laboratory, https://www.jax.org/strain/003535) at the dose of 5e10 vg or 5e11 vg per mouse. WT male, HE (one of the GLA copies was mutated) female and GLA KO mice injected with DPBS were used as controls.
[0345] Mice were sacrificed 1 month after the injection of the rAAVs. Blood samples were collected in EDTA K2-coated tubes from medial canthus of the eye, and plasma was isolated by centrifugation at 2,000 g for 15 min at 4 C. The tissues were snap frozen in liquid nitrogen and stored at 80 C. until use.
[0346] The GLA activity of in plasma and the tissue samples were analyzed using the BioVision alpha galactosidase (-Gal) activity assay kit according to the manufacturer's instructions. The Gb3 concentrations in plasma and kidney were determined using liquid chromatography with tandem mass spectrometry (LC-MS/MS) at Chempartner.
[0347] In particular, tissues were homogenized in 5-fold water. An aliquot of 15 L tissue homogenates or plasma was diluted with 30 l water, and the mixture was vortexed for 1 min. 45 L diluted plasma or tissue homogenates was mixed with 25 L internal standard (N-C18:0-CD3-GB3 (IS), 1000 ng/mL) in DMSO, and then mixed with 1 mL chloroform/methanol (2:1, v/v). The mixture was vortexed for 10 min, and centrifuged at 14000 rpm for 5 min. 750 L supernatant was transferred to a new tube, and dried under N.sub.2. The sample was reconstituted with 100 L DMSO, and then mixed with 100 L MeOH. The mixture was vortexed for 2 min, and centrifuged at 5800 rpm for 10 min. 60 L supernatant was transferred to a new plate. 3 l of the supernatant was injected to LC-MS/MS. The LC system comprised a Shimadzu (Shimadzu Co., Japan) liquid chromatography equipped with a binary pump (LC-30AD), an autosampler (SIL-30AC), a column oven (CTO-20A), a system controller (CBM-20A) and a degasser (DGU-20A). Mass spectrometric analysis was performed using an AB SCIEX API6500+ triple-quadrupole (Ontario, Canada) instrument with an ESI interface. The data acquisition and control system were created by using Analyst 1.6.3 software from AB SCIEX (Ontario, Canada). Chromatographic separation on a Waters BEH C18 Column (2.1*50 mm, 1.7 m), mobile phase A is H.sub.2O-acetonitrile (ACN) (95:5)-0.1% Fomic acid (FA), mobile phase B is ACN-isopropanol (IPA)-MeOH(40:40:20)-0.1% FA. The column was eluted at a flow rate of 0.5 mL/min in a gradient program consisting of 70% phase B(0-0.2 min), from 70 to 100% B(0.2-1.0 min), 100% B (1.00-3.00 min), from 100 to 70% B (3.00-3.10 min), 70% B (3.10-4.00 min). For Gb3, the retention time for the analyte and IS (N-C18:0-CD3-GB3) were Gb3(d18:1)(C16:0) 1.60 min, Gb3(d18:1)(C18:0) 1.69 min, Gb3(d18:1)(C20:0) 1.79 min, Gb3(d18:1)(C22:0) 1.91 min, Gb3(d18:1)(C24:1) 1.89 min, Gb3(d18:1)(C24:0) 2.05 min and N-C18:0-CD3-GB3(IS) 1.69 min, respectively. The injection volume is 3 L. The precursor product ion pair was m/z 1046.7.fwdarw.884.6 for Gb3(d18:1)(C16:0), m/z 1074.7.fwdarw.912.6 for Gb3(d18:1)(C18:0), m/z 1102.7.fwdarw.940.6 for Gb3(d18:1)(C20:0), m/z 1130.7.fwdarw.968.6 for Gb3(d18:1)(C22:0), m/z 1156.7.fwdarw.994.6 for Gb3(d18:1)(C24:1), m/z 1158.7.fwdarw.996.6 for Gb3(d18:1)(C24:0), m/z 1077.8.fwdarw.915.6 for N-C18:0-CD3-GB3.
[0348] The samples were IHC stained for GLA (liver, heart, brain and spinal cord tissues) and Gb3 (liver tissues).
[0349] hGLA IHC was performed using an automatic protocol developed for the detection of human GLA protein. Briefly, formalin-fixed paraffin embedded (FFPE) tissue samples were sectioned, and de-paraffinized and rehydrated. Antigen retrieval was performed with Bond Epitope Retrieval Solution (ER1) pH6.0 at 100 C. for 20 min (AR9961, Leica) prior to immunohistochemical analysis. Specific detection of human hGLA protein was achieved using a human-specific anti-GLA rabbit polyclonal antibody (HPA000237, Sigma).
[0350] Visualization under light microscopy was achieved following incubation with Anti-rabbit Poly-HRP-immunoglobulin G (IgG) secondary antibody for subsequent reaction with 3,3-diaminobenzidene (DAB) substrate (DS9800, Leica, containing both the Anti-rabbit Poly-HRP-immunoglobulin G (IgG) and DAB substrate), resulting in the deposition of brown stain. The slides were counterstained with hematoxylin and the images were captured using an Aperio ScanScope for whole slide.
[0351] Gb3 IHC was performed using a manual protocol developed for the detection of GB3 protein. Briefly, the tissues were fixed in 4% paraformaldehyde, cryoprotected by infiltration with 30% sucrose, and frozen in freezing medium (Tissue-Tek OCT compound, SAKURA, #4583). The frozen tissues were sectioned and the sections (10 m) were rinsed in PBS and then immersed in 0.3% hydrogen peroxide (in PBS) for 30 min at room temperature. Specific detection of Gb3 protein was achieved using goat anti-mouse IgG Fab fragment (115-007-003, Jackson IR) followed by the incubation with anti-Gb3 mouse monoclonal antibody (BGR23, AMS.A2506, Amsbio). Visualization under light microscopy was achieved following incubation with mouse-on-mouse HRPpolymer secondary antibody (MM620, Biocare) for subsequent reaction with 3, 3-diaminobenzidene (DAB) substrate (BDB2004, Biocare), resulting in the deposition of brown stain. The slides were counterstained with hematoxylin and the images were captured using an Aperio ScanScope for whole slide.
[0352] It was shown that the GLA activities in the tissues of GLA KO mice were significantly increased in plasma, kidney, liver and heart by the administration of rAAVs in a dose-dependent manner, i.e., the administration of rAAV at a higher dose (5e11 vg) resulted in a higher GLA activity (
[0353] The Gb3 concentrations in plasma and kidney were significantly higher in the GLA KO mice injected with DPBS than the WT and HE mice; the Gb3 concentrations were significantly decreased by the administration of rAAVs; and the Gb3 concentrations in GLA KO mice treated with high dose of rAAVs were similar to that in the WT mice (
[0354] The administration of rAAVs also resulted in the clearance of Gb3 in liver (
[0355] The GLA activities and Gb3 concentrations in various samples are detailed in Tables 2 to 9 (HO represents homozygous knockout mouse).
TABLE-US-00003 TABLE 2 GLA activities in plasma. GLA activity Activity relative Mice Treatment (nmol/hr/ml) to WT male HE-female DPBS 4.69 0.65 HO-female DPBS 1.75 0.24 HO-female rAAV 106 5E11 1250.78 173.18 HO-female rAAV 106 5E10 24.34 3.37 HO-female rAAV 108 5E11 797.65 110.44 HO-female rAAV 108 5E10 14.82 2.05 WT-male DPBS 7.22 1.00 HO-male DPBS 0.71 0.10 HO-male rAAV 106 5E11 38490.04 5329.20 HO-male rAAV 106 5E10 3112.42 430.94 HO-male rAAV 108 5E11 184954.62 25608.18 HO-male rAAV 108 5E10 1733.51 240.02
TABLE-US-00004 TABLE 3 Gb3 concentration in plasma. Gb3 Percent of the Gb3 concentration concentration in HO Mice Treatment (ng/ml) male control HE-female DPBS 448.25 9.71% HO-female DPBS 4613.5 99.93% HO-female rAAV 106 5E11 252.25 5.46% HO-female rAAV 106 5E10 653 14.14% HO-female rAAV 108 5E11 246.75 5.34% HO-female rAAV 108 5E10 1036.5 22.45% WT-male DPBS 150.5 3.26% HO-male DPBS 4616.75 100.00% HO-male rAAV 106 5E11 231.25 5.01% HO-male rAAV 106 5E10 281.5 6.10% HO-male rAAV 108 5E11 135.5 2.93% HO-male rAAV 108 5E10 357 7.73%
TABLE-US-00005 TABLE 4 GLA activity in kidney. GLA activity Activity relative Mice Treatment (nmol/hr/mg) to WT male HE-female DPBS 12.92 0.83 HO-female DPBS 5.66 0.36 HO-female rAAV 106 5E11 542.46 34.87 HO-female rAAV 106 5E10 10.33 0.66 HO-female rAAV 108 5E11 189.84 12.20 HO-female rAAV 108 5E10 42.08 2.71 WT-male DPBS 15.55 1.00 HO-male DPBS 5.26 0.34 HO-male rAAV 106 5E11 307.5 19.77 HO-male rAAV 106 5E10 47.37 3.05 HO-male rAAV 108 5E11 1581.75 101.69 HO-male rAAV 108 5E10 27.9 1.79
TABLE-US-00006 TABLE 5 Gb3 concentration in kidney. Gb3 Percent of the Gb3 concentration concentration in HO Mice Treatment (ng/g) male control HE-female DPBS 1.26E+06 57.59% HO-female DPBS 2.60E+06 118.91% HO-female rAAV 106 5E11 5.63E+05 25.74% HO-female rAAV 106 5E10 1.45E+06 66.22% HO-female rAAV 108 5E11 6.76E+05 30.93% HO-female rAAV 108 5E10 1.84E+06 84.06% WT-male DPBS 2.05E+05 9.37% HO-male DPBS 2.19E+06 100.00% HO-male rAAV 106 5E11 1.53E+05 6.98% HO-male rAAV 106 5E10 4.59E+05 20.99% HO-male rAAV 108 5E11 6.72E+04 3.07% HO-male rAAV 108 5E10 5.27E+05 24.10%
TABLE-US-00007 TABLE 6 GLA activity in liver. GLA activity Activity relative Mice Treatment (nmol/hr/mg) to WT male HE-female DPBS 16.65 0.49 HO-female DPBS 7.14 0.21 HO-female rAAV 106 5E11 4552.26 134.68 HO-female rAAV 106 5E10 26.4 0.78 HO-female rAAV 108 5E11 1183.12 35.00 HO-female rAAV 108 5E10 14.3 0.42 WT-male DPBS 33.8 1.00 HO-male DPBS 14.44 0.43 HO-male rAAV 106 5E11 44872.29 1327.57 HO-male rAAV 106 5E10 2921.14 86.42 HO-male rAAV 108 5E11 64750.18 1915.67 HO-male rAAV 108 5E10 2006.77 59.37
TABLE-US-00008 TABLE 7 GLA activity in heart. GLA activity Activity relative Mice Treatment (nmol/hr/mg) to WT male HE-female DPBS 2.27 0.52 HO-female DPBS 2.1 0.48 HO-female rAAV 106 5E11 2372.09 542.06 HO-female rAAV 106 5E10 42.26 9.66 HO-female rAAV 108 5E11 2216.14 506.42 HO-female rAAV 108 5E10 15.88 3.63 WT-male DPBS 4.38 1.00 HO-male DPBS 2.23 0.51 HO-male rAAV 106 5E11 4462.37 1019.72 HO-male rAAV 106 5E10 189.5 43.30 HO-male rAAV 108 5E11 9347.89 2136.13 HO-male rAAV 108 5E10 87.88 20.08
TABLE-US-00009 TABLE 8 GLA activity in brain. GLA activity Activity relative Mice Treatment (nmol/hr/mg) to WT male HE-female DPBS 11.21 0.77 HO-female DPBS 1.94 0.13 HO-female rAAV 106 5E11 1.9 0.13 HO-female rAAV 106 5E10 1.98 0.14 HO-female rAAV 108 5E11 2.52 0.17 HO-female rAAV 108 5E10 1.91 0.13 WT-male DPBS 14.51 1.00 HO-male DPBS 2.60 0.18 HO-male rAAV 106 5E11 8.18 0.56 HO-male rAAV 106 5E10 1.60 0.11 HO-male rAAV 108 5E11 32.55 2.24 HO-male rAAV 108 5E10 1.31 0.09
TABLE-US-00010 TABLE 9 GLA activity in spinal cord. GLA activity Activity relative Mice Treatment (nmol/hr/mg) to WT male HE-female DPBS 12.67 0.47 HO-female DPBS 3.56 0.13 HO-female rAAV 106 5E11 4.68 0.17 HO-female rAAV 106 5E10 2.89 0.11 HO-female rAAV 108 5E11 3.35 0.12 HO-female rAAV 108 5E10 3.07 0.11 WT-male DPBS 27.01 1.00 HO-male DPBS 3.21 0.12 HO-male rAAV 106 5E11 8.38 0.31 HO-male rAAV 106 5E10 3.09 0.11 HO-male rAAV 108 5E11 39.44 1.46 HO-male rAAV 108 5E10 3.38 0.13
3.2. Comparison of the Short-Term Efficacy of the Treatments with rAAVs 108, 109 and 110 in GLA KO Mice
[0356] The rAAVs 108, 109 and 110 were diluted in formulation buffer (DPBS) and injected into the tail veins of 3-month-old male WT and GLA KO mice. Male WT and GLA KO mice injected with DPBS were used as controls. The treatments are detailed in Table 10.
TABLE-US-00011 TABLE 10 Dose Number i.v. Mice Dose (vg/20 g of Injection type Treatment (vg/kg) mouse) animals (l/mouse) M-WT DPBS + 0.001% 0 0 5 200 Pluronic F-68 (PF68) M-KO DPBS + 0.001% 0 0 5 200 PF68 M-KO rAAV 108 1.25E+13 2.50E+11 5 Depends on BW M-KO rAAV 109 1.25E+13 2.50E+11 5 Depends on BW M-KO rAAV 110 1.25E+13 2.50E+11 5 Depends on BW
[0357] Plasma was sampled as described in Example 3.1 four weeks after the injection, and mice were sacrificed 1 month after the injection of the rAAVs. The tissues were snap frozen in liquid nitrogen and stored at 80 C. until use.
[0358] The genome copies of the rAAVs were measured by qPCR specific for RGB polyA, and the hGLA mRNA levels were also measured by qPCR. The qPCR was performed using the TaqMan Universal Master Mix II, with UNG (Thermo Scientific) and QuantStudio 5 Real-Time PCR System, following the procedures recommended by the manufacturer.
[0359] For the quantification of the genome copies of rAAVs, total DNA was isolated from tissue samples using Omega E.Z.N.A. DNA/RNA Kit. The qPCR targeting RGB polyA was performed with a pair of primers (SEQ ID NOs: 14 and 15) and a probe (SEQ ID NO: 16, with 5 FAM and 3 BHQ-1 modifications). The mice genomic DNA was quantified in parallel samples using a pair of primers (SEQ ID NOs: 17 and 18) and a probe (SEQ ID NO: 19, with 5 HEX and 3 BHQ-1 modifications) specific for murine beta-actin. The thermal cycling conditions were 95 C. for 10 min, followed by 40 cycles of 95 C. for 15 s and 60 C. for 1 min. The standards were 10-fold serial dilutions of transgene plasmid for AAV vector DNA measurements and 10-fold serial dilutions of mouse beta actin DNA as the endogenous reference.
[0360] For the measurement of hGLA mRNA levels, total RNA was extracted from tissue samples using Omega E.Z.N.A. DNA/RNA Kit and was then reverse-transcribed using Applied Biosystems High-Capacity RNA-to-cDNA Kit. The qPCR was performed with cDNA as the template, a pair of primers (SEQ ID NOs: 20 and 21) and a probe (SEQ ID NO: 22, with 5 FAM and 3 BHQ-1 modifications) specific for hGLA, and a pair of primers (SEQ ID NOs: 23 and 24) and a probe (SEQ ID NO: 25, with 5 HEX and 3 BHQ-1 modifications) specific for the murine GAPDH gene. The thermal cycling conditions were 95 C. for 10 min, followed by 40 cycles of 95 C. for 15 s and 60 C. for 1 min. The standards were 10-fold serial dilutions of transgene plasmid for transgene measurements and 10-fold serial dilutions of mouse GAPDH cDNA as the endogenous reference.
[0361] The GLA activity of in plasma and the tissue samples were analyzed using the BioVision alpha galactosidase (-Gal) activity assay kit according to the manufacturer's instructions. The Gb3 concentrations in plasma and kidney were determined using LC-MS/MAS as described in Example 3.1. The tissues were IHC stained for GLA and Gb3 as described in Example 3.1.
[0362] As shown in
[0363] As shown in
[0364] As shown in
[0365] It can be seen that in liver, heart and plasma, the GLA expressed by rAAVs 109 and 110 may be enough to reduce the Gb3 to low levels; but in kidney, rAAVs 109 and 110 could not provide as much GLA as rAAV 108 to reduce Gb3 to a desired low level.
Example 4. Evaluation of the Long-Term Efficacy of the Treatments with rAAVs 106 and 108 in GLA KO Mice
[0366] The rAAVs 106 and 108 were diluted in formulation buffer and injected into the tail veins of 5-month-old female and male GLA KO mice (HO) at high dose (HD) of 2.5E13 vg/kg or low dose (LD) of 2.5E12 vg/kg. WT male, HE (one of the GLA copies was mutated) female and GLA KO mice injected with DPBS were used as controls. The treatments are detailed in Table 11.
TABLE-US-00012 TABLE 11 Mice Dose Dose Number of i.v. Injection Group type Treatment (vg/kg) (vg/mouse) Animals (l/mouse) G1 F-HE DPBS + 0.001% PF68 0 0 6 200 G2 F-HO DPBS + 0.001% PF68 0 0 6 200 G3 F-HO rAAV 106 2.50E+13 5.00E+11 7 200 G4 F-HO rAAV 106 2.50E+12 5.00E+10 7 200 G5 F-HO rAAV 108 2.50E+13 5.00E+11 7 200 G6 F-HO rAAV 108 2.50E+12 5.00E+10 7 200 G7 M-WT DPBS + 0.001% PF68 0 0 7 200 G8 M-HO DPBS + 0.001% PF68 0 0 6 200 G9 M-HO rAAV 106 2.50E+13 5.00E+11 7 200 G10 M-HO rAAV 106 2.50E+12 5.00E+10 7 200 G11 M-HO rAAV 108 2.50E+13 5.00E+11 7 200 G12 M-HO rAAV 108 2.50E+12 5.00E+10 6 200
[0367] Blood samples were collected in EDTA K2-coated tubes from medial canthus of the eye at 2, 4, 6, 8, 12, and 16 weeks after AAV injection, and plasma was isolated by centrifugation at 2,000 g for 15 min at 4 C. Mice were sacrificed at 24 weeks (for female) or 26 weeks (for male) after the rAAV injection and tissues were snap frozen in liquid nitrogen and stored at 80 C. until use. The GLA activities in tissue samples and plasma were analyzed using the BioVision alpha galactosidase (-Gal) activity assay kit according to the manufacturer's instructions. Gb3 concentrations in tissues and plasma were determined using liquid chromatography with tandem mass spectrometry (LC-MS/MS) at Chempartner as described in Example 3.1.
[0368] The nociceptive response to heat stimulus was measured using a hot-plate test at 22 weeks after the rAAV injection. The mice were individually placed on a 55 C. surface, and the time taken to respond with a characteristic shake or flick of the hind paw was recorded as the latency period. If no response was evident by 60 seconds, the mice were removed from the hot plate to prevent thermal injury. As shown in
[0369] Body weights were measured bi-weekly from day 0 through 24 weeks post-injection (p.i.). Body weight gain was calculated as the difference between each of the time points and day 0. As shown in
[0370] The tissues were assayed by qPCR at 24 weeks (female) or 26 weeks (male) p.i. for vector genome to determine the biodistribution of the rAAVs in GLA KO mice following a systemic delivery. Further, RNA was extracted from different tissues at 24 weeks (female) or 26 weeks (male) p.i., and mRNA levels for the hGLA transgene were determined. The qPCR was performed as described in Example 3.2. As shown in
[0371] The GLA activities in tissue samples were detected as described previously. As shown in
[0372] The GLA activities in plasma were shown in
[0373] As shown in
[0374] The mice were also tested by ALT (Alanine aminotransferase) and AST (Aspartate aminotransferase) analysis for detecting liver toxicity. The blood ALT and AST levels were measured at 6, 12 and 24 weeks p.i. by the kits from Nanjing Jiancheng (#C009-2-1 for ALT and #C010-2-1 for AST) according to the manufacturer's instructions. The results were shown in
[0375] The tissue samples were further subjected to microscopy. In particular, formalin-fixed tissues were subjected to routine histology processing, including embedded in paraffin, sectioned at 5 m, and stained with hematoxylin and eosin (H&E). Histopathology evaluation was performed by a board-certified veterinary pathologist at WuXi AppTec. The morphologic results were shown in Table 12.
TABLE-US-00013 TABLE 12 The morphologic results of the Pathologist's review. Group Slide ID* Description of the image Group Slide ID Description of the image F_HO_DPBS G2-1 No significant abnormality M_HO_DPBS G8-1 No significant abnormality G2-2 Lymphocyte infiltration G8-2 No significant abnormality was high in the portal area G2-3 No significant abnormality G8-3 No significant abnormality G2-4 No significant abnormality G8-4 No significant abnormality G2-5 No significant abnormality G8-5 Lymphocyte infiltration can be observed in part of the portal area F_HO_106_HD G3-1 Lymphocyte infiltration M_HO_106_HD G9-1 No significant abnormality can be observed in the portal area G3-2 No significant abnormality G9-2 No significant abnormality G3-3 No significant abnormality G9-3 No significant abnormality G3-4 No significant abnormality G9-4 No significant abnormality G3-5 Lymphocyte infiltration G9-5 A number of mature red can be observed locally in blood cells are seen the portal area locally in the vessels and sinusoids G3-6 No significant abnormality G9-6 No significant abnormality G3-7 No significant abnormality G9-7 No significant abnormality F_HO_108_HD G5-1 No significant abnormality M_HO_108_HD G11-1 No significant abnormality G5-2 Lymphocyte infiltration G11-2 A number of mature red can be observed locally in blood cells are seen the portal area locally in the vessels and sinusoids G5-3 No significant abnormality G11-3 No significant abnormality G5-4 No significant abnormality G11-4 No significant abnormality G5-5 No significant abnormality G11-5 Lymphocyte infiltration was high in the portal area G5-6 No significant abnormality G11-6 No significant abnormality G5-7 No significant abnormality G11-7 A number of fatty vacuoles were observed locally F_HO_DPBS G2-1 No significant abnormality M_HO_DPBS G8-1 No significant abnormality G2-2 No significant abnormality G8-2 No significant abnormality G2-3 No significant abnormality G8-3 No significant abnormality G2-4 No significant abnormality G8-4 Slight inflammatory cell infiltration were observed locally G2-5 No significant abnormality G8-5 Slight steatosis was observed in a small number of cardiomyocytes F_HO_106_HD G3-1 No significant abnormality M_HO_106_HD G9-1 No significant abnormality G3-2 No significant abnormality G9-2 No significant abnormality G3-3 No significant abnormality G9-3 No significant abnormality G3-4 A small amount of G9-4 No significant abnormality inflammatory cell infiltration was observed locally G3-5 No significant abnormality G9-5 No significant abnormality G3-6 No significant abnormality G9-6 No significant abnormality G3-7 No significant abnormality G9-7 No significant abnormality F_HO_108_HD G5-1 No significant abnormality M_HO_108_HD G11-1 Slight steatosis was observed in a small number of cardiomyocytes G5-2 No significant abnormality G11-2 No significant abnormality G5-3 No significant abnormality G11-3 No significant abnormality G5-4 No significant abnormality G11-4 No significant abnormality G5-5 No significant abnormality G11-5 No significant abnormality G5-6 Mild hyperplasia and G11-6 No significant abnormality slight infiltration of inflammatory cell were observed in cardiomyocytes G5-7 No significant abnormality G11-7 No significant abnormality F_HO_DPBS G2-1 Infiltration of M_HO_DPBS G8-1 No significant abnormality inflammatory cell was observed in part of the surrounding vessels G2-2 Infiltration of G8-2 No significant abnormality inflammatory cell was observed around vessels and part of the renal tubules G2-3 Mild edema was observed G8-3 Infiltration of in a small amount of renal inflammatory cell was tubular epithelia observed around part of the renal tubules G2-4 Infiltration of G8-4 Infiltration of inflammatory cell was inflammatory cell was observed around part of observed around part of the vessels the vessels G2-5 Infiltration of G8-5 No significant abnormality inflammatory cell was observed around part of the vessels F_HO_106_HD G3-1 Infiltration of M_HO_106_HD G9-1 No significant abnormality inflammatory cell was observed around the vessels and glomerulus G3-2 No significant abnormality G9-2 Infiltration of inflammatory cell was observed around part of the vessels G3-3 Infiltration of a small G9-3 Infiltration of amount of inflammatory inflammatory cell was cells was observed around observed around part of part of the vessels and the vessels glomerulus G3-4 No significant abnormality G9-4 Infiltration of inflammatory cell was observed around part of the vessels and glomerulus G3-5 Infiltration of a small G9-5 Infiltration of amount of inflammatory inflammatory cell was cells was observed around observed around part of part of the vessels and the vessels and glomerulus glomerulus G3-6 Infiltration of a small G9-6 No significant abnormality amount of inflammatory cells was observed around part of the vessels and glomerulus G3-7 Infiltration of a small G9-7 Infiltration of amount of inflammatory inflammatory cell was cells and edema were observed around part of observed around part of the vessels and renal tube glomerulus F_HO_108_HD G5-1 No significant abnormality M_HO_108_HD G11-1 Infiltration of a small amount of inflammatory cells was observed around part of renal tube G5-2 No significant abnormality G11-2 Infiltration of inflammatory cell was observed around part of the vessels, and slight steatosis was observed in part of renal tubular epithelia G5-3 Infiltration of a great G11-3 No significant abnormality number of inflammatory cells was observed around the vessels and glomerulus G5-4 Infiltration of a small G11-4 Infiltration of amount of inflammatory inflammatory cell was cells was observed around observed around part of part of the vessels and renal tube and the vessels glomerulus G5-5 Slight edema was G11-5 Infiltration of observed in part of renal inflammatory cell was tubular epithelia observed around part of the vessels G5-6 No significant abnormality G11-6 Infiltration of inflammatory cell was observed around part of the vessels G5-7 Infiltration of a great G11-7 Infiltration of number of inflammatory inflammatory cell was cells was observed around observed around part of part of renal tube the vessels *Indicating the animal, from which the sample was derived, e.g., Slide ID G2-n referred to samples derived from G2.
[0376] It can be seen that the treatment of rAAVs 106 and 108 did not result in significant abnormality in morphology of the tissue samples as compared to the controls.
Example 5. Treatment with rAAV 108 in Fabry Aggravated Model
[0377] TgG3S mice (transgenic mice expressing human Gb3 Synthase, purchased from JCRB Laboratory Animal Resource Bank, National Institutes of Biomedical Innovation, Health and Nutrition in Japan) were crossed with GLA KO mice to obtain Fabry aggravated models (TgG3SGLA KO).
[0378] The rAAV 108 was diluted in formulation buffer and injected into the tail veins of 8-week-old Fabry aggravated models at high dose (HD) of 1.25E13 vg/kg or low dose (LD) of 1.25E12 vg/kg. The overexpression of TgG3S increased the synthesis of Gb3 in vivo. The treatments of the mice were shown in Table 13.
TABLE-US-00014 TABLE 13 Dose Dose (vg/ Number of i.v. injection Group Gender TgG3S GLA Treatment (vg/kg) 20 g mouse) animals (l/mouse) G1 Male + WT DPBS + 0.001% 0 0 7 200 PF68 G2 Male + HO DPBS + 0.001% 0 0 7 200 PF68 G3 Male + HO rAAV 108 1.25E+13 2.50E+11 7 Depends on BW G4 Male + HO rAAV 108 1.25E+12 2.50E+10 7 Depends on BW
[0379] The measurement of body weight gain (as described in Example 4) and the detection of clasping (the mouse tucks its hind limbs to the body when suspended by the tail,
[0380] The results showed that the body weight gain did not significantly vary between groups (
[0381] 6 of 7 non-treated TgG3SGLA KO mice showed clasping at 12 weeks p.i., while all of the mice that were WT for GLA, and that treated with HD rAAV 108 were normal, and 2 of 7 mice in LD group showed clasping at 12 weeks p.i. (
[0382] As shown in
[0383] The mice were grown till 40 weeks p.i, and the blood and urine were collected every 4 weeks, and analyzed as described above.
[0384] At the end of the study, the tissues (kidney, liver, heart, spinal cord, dorsal root ganglia (DRG), lung, spleen quadriceps, etc.) were collected and analyzed as described previously.
REFERENCES
[0385] 1. Zarate Y A, Hopkin R J. Fabry's disease. Lancet. 2008; 372:1427-35. [0386] 2. Lenders M, Brand E. Fabry Disease: The Current Treatment Landscape. Drugs. 2021; 81:635-645. [0387] 3. Eng C M, Fletcher J, Wilcox W R, Waldek S, Scott C R, Sillence D O, et al. Fabry disease: baseline medical characteristics of a cohort of 1765 males and females in the Fabry Registry. J Inherit Metab Dis. 2007; 30:184-92. [0388] 4. Echevarria L, Benistan K, Toussaint A, Dubourg O, Hagege A A, Eladari D, et al.
[0389] X-chromosome inactivation in female patients with Fabry disease. Clin Genet. 2016; 89:44-54. [0390] 5. Waldek S, Patel M R, Banikazemi M, Lemay R, Lee P. Life expectancy and cause of death in males and females with Fabry disease: Findings from the Fabry Registry. Genetics in Medicine. 2009; 11:790-796. [0391] 6. Feriozzi S, Hughes D A. New drugs for the treatment of Anderson-Fabry disease. Journal of Nephrology. 2021; 34:221-230. [0392] 7. Eng C M, Guffon N, Wilcox W R, Germain D P, Lee P, Waldek S, et al. Safety and efficacy of recombinant human a-galactosidase A replacement therapy in Fabry's disease. N Engl J Med. 2001; 345:9-16. [0393] 8. Schiffmann R, Kopp J B, Austin H A 3rd, Sabnis S, Moore D F, Weibel T, et al. Enzyme replacement therapy in Fabry disease: a randomized controlled trial. JAMA. 2001; 285:2743-9. [0394] 9. Rombach S M, Smid B E, Bouwman M G, Linthorst G E, et al. Long term enzyme replacement therapy for Fabry disease: effectiveness on kidney, heart and brain. Orphanet Journal of Rare Diseases, 2013; 8:47. [0395] 10. McCafferty E H, Scott U. Migalastat: A review in Fabry disease. Drugs. 2019; 79:543-54. [0396] 11. Germain D P, Hughes D A, Nicholls K, Bichet D G, Giugliani R, Wilcox W R, et al. Treatment of Fabry's disease with the pharmacologic chaperone migalastat. N Engl J Med. 2016; 375:545-55. [0397] 12. Crosson S M, Dib P, Smith J K, Zolotukhin S. Helper-free Production of Laboratory Grade AAV and Purification by Iodixanol Density Gradient Centrifugation. Mol Ther Methods Clin Dev. 2018; 10:1-7.
TABLE-US-00015 SequenceListing SEQIDNO:1hGLA.co1 ATGCAGCTGAGAAATCCTGAGCTGCACCTGGGCTGTGCCCTGGCTCTGAGATTTCTGGCTCTGGTGTCCTG GGACATCCCTGGCGCTAGAGCCCTGGATAACGGCCTGGCCAGAACACCTACAATGGGCTGGCTGCACTGGG AGAGATTCATGTGCAACCTGGACTGCCAAGAGGAACCCGACAGCTGCATCAGCGAGAAGCTGTTCATGGAA ATGGCCGAGCTGATGGTGTCCGAAGGCTGGAAGGACGCCGGCTACGAGTACCTGTGCATCGACGACTGTTG GATGGCCCCTCAGAGAGACTCTGAGGGCAGACTGCAGGCCGATCCTCAGAGATTTCCCCACGGCATTAGAC AGCTGGCCAACTACGTGCACAGCAAGGGCCTGAAGCTGGGCATCTACGCCGACGTGGGCAACAAGACCTGT GCCGGCTTTCCTGGCAGCTTCGGCTACTACGATATCGACGCCCAGACCTTCGCCGATTGGGGAGTCGATCT GCTGAAGTTCGACGGCTGCTACTGCGACAGCCTGGAAAATCTGGCCGACGGCTACAAGCACATGTCTCTGG CCCTGAATCGGACCGGCAGATCCATCGTGTACAGCTGCGAGTGGCCCCTGTACATGTGGCCCTTCCAGAAG CCTAACTACACCGAGATCAGACAGTACTGCAACCACTGGCGGAACTTCGCCGACATCGACGATAGCTGGAA GTCCATCAAGAGCATCCTGGACTGGACCAGCTTCAATCAAGAGCGGATCGTGGACGTGGCAGGACCTGGCG GATGGAACGATCCTGACATGCTGGTCATCGGCAACTTCGGCCTGAGCTGGAACCAGCAAGTGACCCAGATG GCCCTGTGGGCCATTATGGCCGCTCCTCTGTTCATGAGCAACGACCTGAGACACATCAGCCCTCAGGCCAA GGCTCTGCTGCAGGACAAGGATGTGATCGCTATCAACCAGGATCCTCTGGGCAAGCAGGGCTACCAGCTGA GACAGGGCGACAATTTCGAAGTGTGGGAAAGACCCCTGAGCGGACTGGCTTGGGCCGTCGCCATGATCAAC AGACAAGAGATCGGCGGACCCCGGTCCTACACAATTGCCGTGGCTTCTCTCGGCAAAGGCGTGGCCTGTAA TCCCGCCTGCTTTATCACACAGCTGCTGCCCGTGAAGAGAAAGCTGGGCTTTTACGAGTGGACCAGCAGAC TGCGGAGCCACATCAATCCTACCGGCACAGTGCTGCTGCAGCTGGAAAACACAATGCAGATGAGCCTGAAG GACCTGCTGTGATGA SEQIDNO:2hGLA.co2 ATGCAGCTCCGAAACCCGGAATTGCATTTGGGCTGTGCGCTGGCGCTCAGATTTCTGGCACTCGTCTCTTG GGACATTCCTGGGGCGCGGGCGCTCGACAACGGCCTGGCACGAACCCCAACGATGGGCTGGTTGCATTGGG AGCGGTTTATGTGTAACCTTGACTGTCAAGAGGAACCGGATAGCTGTATCAGTGAGAAGCTGTTTATGGAA ATGGCAGAATTGATGGTGTCCGAAGGGTGGAAAGACGCGGGATACGAGTACCTCTGCATCGACGACTGCTG GATGGCACCCCAGCGGGACTCAGAAGGGAGGCTGCAGGCTGACCCTCAACGGTTTCCCCACGGGATAAGAC AACTGGCGAACTACGTTCATTCCAAAGGACTCAAACTGGGTATCTACGCTGACGTCGGAAATAAGACGTGT GCGGGCTTTCCAGGGAGCTTCGGGTACTACGACATCGACGCCCAAACGTTTGCGGACTGGGGCGTTGACTT GCTCAAATTTGACGGCTGCTACTGTGACAGCCTGGAAAATCTGGCAGATGGCTATAAACATATGAGTCTCG CCCTTAACCGGACTGGTAGATCAATTGTATATTCCTGCGAGTGGCCTTTGTACATGTGGCCATTCCAGAAA CCGAACTATACTGAGATACGCCAATATTGCAATCATTGGCGAAATTTCGCCGACATAGATGATAGTTGGAA GTCTATAAAGTCTATTCTTGATTGGACTTCTTTTAACCAGGAGCGCATTGTGGACGTTGCGGGGCCCGGAG GGTGGAACGATCCCGATATGCTTGTGATCGGCAACTTCGGTCTGTCCTGGAACCAACAAGTCACCCAAATG GCATTGTGGGCGATAATGGCTGCGCCCCTGTTCATGTCTAATGATCTCAGGCACATAAGCCCCCAGGCTAA AGCGCTTCTTCAAGATAAGGACGTTATAGCTATCAACCAGGACCCCCTTGGGAAGCAGGGCTACCAGCTTC GACAAGGAGATAATTTCGAGGTGTGGGAGCGCCCCCTGTCCGGGCTTGCGTGGGCGGTCGCCATGATCAAC CGACAGGAAATTGGGGGCCCCAGATCATATACGATCGCAGTTGCTAGCCTCGGAAAAGGCGTTGCTTGCAA TCCCGCTTGCTTCATTACGCAACTCCTCCCCGTTAAGCGGAAACTGGGATTCTACGAGTGGACATCCCGGC TGCGATCACACATAAATCCCACTGGGACAGTCCTCCTCCAGCTGGAGAATACAATGCAAATGAGCCTTAAA GACCTCTTGTGATGA SEQIDNO:3hGLA.co3 ATGCAGCTGAGGAACCCAGAGCTGCACCTGGGCTGCGCACTGGCCCTGAGATTCCTGGCCCTGGTGTCCTG GGACATCCCTGGAGCACGGGCCCTGGATAACGGACTGGCAAGAACCCCAACAATGGGCTGGCTGCACTGGG AGCGGTTCATGTGCAATCTGGACTGTCAGGAGGAGCCAGATAGCTGTATCTCCGAGAAGCTGTTTATGGAG ATGGCCGAGCTGATGGTGTCTGAGGGCTGGAAGGACGCCGGCTACGAGTATCTGTGCATCGACGATTGTTG GATGGCACCACAGAGGGACAGCGAGGGCAGACTGCAGGCCGATCCCCAGAGGTTTCCTCACGGCATCCGCC AGCTGGCCAACTACGTGCACAGCAAGGGCCTGAAGCTGGGCATCTACGCCGACGTGGGCAATAAGACCTGC GCCGGCTTCCCTGGCTCCTTTGGCTACTACGACATCGACGCCCAGACATTCGCCGACTGGGGCGTGGATCT GCTGAAGTTTGACGGCTGCTACTGTGATTCCCTGGAGAACCTGGCCGACGGCTATAAGCACATGTCTCTGG CCCTGAATAGGACCGGCCGCTCTATCGTGTACAGCTGCGAGTGGCCACTGTATATGTGGCCATTCCAGAAG CCCAACTACACAGAGATCCGGCAGTATTGTAACCACTGGAGAAATTTTGCCGACATCGACGATTCTTGGAA GAGCATCAAGTCCATCCTGGACTGGACCTCCTTCAACCAGGAGAGGATCGTGGACGTGGCAGGACCTGGAG GCTGGAACGACCCAGATATGCTGGTCATCGGCAACTTCGGCCTGTCTTGGAATCAGCAGGTGACACAGATG GCACTGTGGGCAATCATGGCAGCACCACTGTTTATGAGCAATGATCTGAGGCACATCTCCCCACAGGCAAA GGCCCTGCTGCAGGACAAGGATGTGATCGCCATCAACCAGGACCCCCTGGGCAAGCAGGGCTACCAGCTGA GGCAGGGCGATAATTTTGAAGTGTGGGAGAGGCCACTGTCCGGACTGGCCTGGGCCGTGGCCATGATCAAC AGGCAGGAGATCGGCGGCCCTCGCTCTTACACCATCGCAGTGGCAAGCCTGGGCAAGGGAGTGGCATGCAA TCCAGCATGTTTCATCACCCAGCTGCTGCCTGTGAAGCGGAAGCTGGGCTTTTATGAGTGGACATCCCGGC TGAGATCTCACATCAACCCTACCGGCACAGTGCTGCTGCAGCTGGAGAATACAATGCAGATGAGCCTGAAG GACCTGCTGTGATGA SEQIDNO:4hGLA.co4 ATGCAGCTGAGAAACCCCGAGCTGCACCTGGGCTGCGCCCTGGCCCTGAGATTCCTGGCCCTGGTGAGCTG GGACATCCCCGGCGCCAGAGCCCTGGACAACGGCCTGGCCAGAACCCCCACCATGGGCTGGCTGCACTGGG AGAGATTCATGTGCAACCTGGACTGCCAGGAGGAGCCCGACAGCTGCATCAGCGAGAAGCTGTTCATGGAG ATGGCCGAGCTGATGGTGAGCGAGGGCTGGAAGGACGCCGGCTACGAGTACCTGTGCATCGACGACTGCTG GATGGCCCCCCAGAGAGACAGCGAGGGCAGACTGCAGGCCGACCCCCAGAGATTCCCCCACGGCATCAGAC AGCTGGCCAACTACGTGCACAGCAAGGGCCTGAAGCTGGGCATCTACGCCGACGTGGGCAACAAGACCTGC GCCGGCTTCCCCGGCAGCTTCGGCTACTACGACATCGACGCCCAGACCTTCGCCGACTGGGGCGTGGACCT GCTGAAGTTCGACGGCTGCTACTGCGACAGCCTGGAGAACCTGGCCGACGGCTACAAGCACATGAGCCTGG CCCTGAACAGAACCGGCAGAAGCATCGTGTACAGCTGCGAGTGGCCCCTGTACATGTGGCCCTTCCAGAAG CCGAACTACACCGAGATCAGACAGTACTGCAACCACTGGAGAAACTTCGCCGACATCGACGACAGCTGGAA GAGCATCAAGAGCATCCTGGACTGGACCAGCTTCAACCAGGAGAGAATCGTGGACGTGGCCGGCCCCGGCG GCTGGAACGACCCCGACATGCTGGTGATCGGCAACTTCGGCCTGAGCTGGAACCAGCAGGTGACCCAGATG GCCCTGTGGGCCATCATGGCCGCCCCCCTGTTCATGAGCAACGACCTGAGACACATCAGCCCCCAGGCCAA GGCCCTGCTGCAGGACAAGGACGTGATCGCCATCAACCAGGACCCCCTGGGCAAGCAGGGCTACCAGCTGA GACAGGGCGACAACTTCGAGGTGTGGGAGAGACCCCTGAGCGGCCTGGCCTGGGCCGTGGCCATGATCAAC AGACAGGAGATCGGCGGCCCCAGAAGCTACACCATCGCCGTGGCCAGCCTGGGCAAGGGCGTGGCCTGCAA CCCCGCCTGCTTCATCACCCAGCTGCTGCCCGTGAAGAGAAAGCTGGGCTTCTACGAGTGGACCAGCAGAC TGAGAAGTCACATCAACCCCACCGGCACCGTGCTGCTGCAGCTGGAGAACACCATGCAGATGAGCCTGAAG GACCTGCTGTGATGA SEQIDNO:5Chickenbeta-actin(CBA)chimericintron(intron1) GAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGA CTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGT TTAATGACGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCG GGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCGCCGCGTGCGGCTCCGCGCTGCCC GGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCGCTCCGCAGTGTGCGCGAGGGGAGCGCGGC CGGGGGCGGTGCCCCGCGGTGCGGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGTGG GGGGGTGAGCAGGGGGTGTGGGCGCGTCGGTCGGGCTGCAACCCCCCCTGCACCCCCCTCCCCGAGTTGCT GAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGGG GTGGCGGCAGGTGGGGGTGCCGGGGGGGGGGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCG GCGGCCCCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGC GAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCCGCCGCACCCC CTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGAAATGGGGGGGGAGGGCCTTCGTGCGT CGCCGCGCCGCCGTCCCCTTCTCCCTCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGG GGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCA TGCCTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCATTTTGGCAAAG SEQIDNO:6ModifiedCBAchimericintron(intron2) GAGTCGCTGCGCGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGA CTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGT TTAATGACGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCG GGGGGAGCGGCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGG CTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAGC TCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCATTTTGGCAAAG SEQIDNO:7Promegachimericintron(intron3) GTAAGTATCAAGGTTACAAGACAGGTTTAAGGAGACCAATAGAAACTGGGCTTGTCGAGACAGAGAAGACT CTTGCGTTTCTGATAGGCACCTATTGGTCTTACTGACATCCACTTTGCCTTTCTCTCCACAG SEQIDNO:8SV40intron(intron4) AACTGAAAAACCAGAAAGTTAACTGGTAAGTTTAGTCTTTTTGTCTTTTATTTCAGGTCCCGGATCCGGTG GTGGTGCAAATCAAAGAACTGCTCCTCAGTGGATGTTGCCTTTACTTCTAGGCCTGTACGGAAGTGTTACT TCTGCTCTAAAAGCT SEQIDNO:9CMVearlyenhancer CTAGTCGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATAT ATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATT GACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGT ATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTC AATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTA CATCTACGTATTAGTCATCGCTATTAC SEQIDNO:10chickenbeta-actincorepromoter TGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTAT TTATTTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGC GGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCC GAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGCGGGCGG SEQIDNO:11RBGpolyAsignalsequence GATCTTTTTCCCTCTGCCAAAAATTATGGGGACATCATGAAGCCCCTTGAGCATCTGACTTCTGGCTAATA AAGGAAATTTATTTTCATTGCAATAGTGTGTTGGAATTTTTTGTGTCTCTCACTCG SEQIDNO:12human-GalA MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWEREMCNLDCQEEPDSCISEKLFMEMAEL MVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFG YYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNH WRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKG VACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL SEQIDNO:13pGCB108 CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTTT GGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATCACTAGGGGTTCCTG CGGCCGCACGCGTCAATTGCTAGTCGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTC ATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGC CCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCAT TGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAG TACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGG ACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTCGAGGTGAGCCCCACGTTC TGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTG TGCAGCGATGGGGGCGGGGGGGGGGGGGGGGGGGCGCGCCAGGCGGGGGGGGGGGGGCGAGGGGCGGGGCG GGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCCGAAAGTTTCCTTTTATGGCGAGG CGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGCGCGCGGCGGGCGGAAGCTTGAGTCGCTGCGCGCTGCCT TCGCCCCGTGCCCCGCTCCGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCAC AGGTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGTTTCT TTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGAGCGGCTCGGGGCT GTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCGGC GGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGT TATTGTGCTGTCTCATCATTTTGGCAAAGAATTGGCCTCGAGGACGGGGTGAACTACGCCTGAGGATCCGC CACCATGCAGCTGAGAAACCCCGAGCTGCACCTGGGCTGCGCCCTGGCCCTGAGATTCCTGGCCCTGGTGA GCTGGGACATCCCCGGCGCCAGAGCCCTGGACAACGGCCTGGCCAGAACCCCCACCATGGGCTGGCTGCAC TGGGAGAGATTCATGTGCAACCTGGACTGCCAGGAGGAGCCCGACAGCTGCATCAGCGAGAAGCTGTTCAT GGAGATGGCCGAGCTGATGGTGAGCGAGGGCTGGAAGGACGCCGGCTACGAGTACCTGTGCATCGACGACT GCTGGATGGCCCCCCAGAGAGACAGCGAGGGCAGACTGCAGGCCGACCCCCAGAGATTCCCCCACGGCATC AGACAGCTGGCCAACTACGTGCACAGCAAGGGCCTGAAGCTGGGCATCTACGCCGACGTGGGCAACAAGAC CTGCGCCGGCTTCCCCGGCAGCTTCGGCTACTACGACATCGACGCCCAGACCTTCGCCGACTGGGGCGTGG ACCTGCTGAAGTTCGACGGCTGCTACTGCGACAGCCTGGAGAACCTGGCCGACGGCTACAAGCACATGAGC CTGGCCCTGAACAGAACCGGCAGAAGCATCGTGTACAGCTGCGAGTGGCCCCTGTACATGTGGCCCTTCCA GAAGCCGAACTACACCGAGATCAGACAGTACTGCAACCACTGGAGAAACTTCGCCGACATCGACGACAGCT GGAAGAGCATCAAGAGCATCCTGGACTGGACCAGCTTCAACCAGGAGAGAATCGTGGACGTGGCCGGCCCC GGCGGCTGGAACGACCCCGACATGCTGGTGATCGGCAACTTCGGCCTGAGCTGGAACCAGCAGGTGACCCA GATGGCCCTGTGGGCCATCATGGCCGCCCCCCTGTTCATGAGCAACGACCTGAGACACATCAGCCCCCAGG CCAAGGCCCTGCTGCAGGACAAGGACGTGATCGCCATCAACCAGGACCCCCTGGGCAAGCAGGGCTACCAG CTGAGACAGGGCGACAACTTCGAGGTGTGGGAGAGACCCCTGAGCGGCCTGGCCTGGGCCGTGGCCATGAT CAACAGACAGGAGATCGGCGGCCCCAGAAGCTACACCATCGCCGTGGCCAGCCTGGGCAAGGGCGTGGCCT GCAACCCCGCCTGCTTCATCACCCAGCTGCTGCCCGTGAAGAGAAAGCTGGGCTTCTACGAGTGGACCAGC AGACTGAGAAGTCACATCAACCCCACCGGCACCGTGCTGCTGCAGCTGGAGAACACCATGCAGATGAGCCT GAAGGACCTGCTGTGATGATGTACAGGTACCTCGATGGATTTCCAAGGTTAATTCATTGGAATTGAAAATT AACAGAGATCTAGAGCTGAATTCCTGCAGCCAGGGGGATCAGCCTGATCTTTTTCCCTCTGCCAAAAATTA TGGGGACATCATGAAGCCCCTTGAGCATCTGACTTCTGGCTAATAAAGGAAATTTATTTTCATTGCAATAG TGTGTTGGAATTTTTTGTGTCTCTCACTCGCGGACCGAGCGGCCGCAGGAACCCCTAGTGATGGAGTTGGC CACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTG CCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCTGCCTGCAGGGGCAGCTTGAAGGAAATACTAAGGCA AAGGTACTGCAAGTGCTCGCAACATTCGCTTATGCGGATTATTGCCGTAGTGCCGCGACGCCGGGGGCAAG ATGCAGAGATTGCCATGGTACAGGCCGTGCGGTTGATATTGCCAAAACAGAGCTGTGGGGGAGAGTTGTCG AGAAAGAGTGCGGAAGATGCAAAGGCGTCGGCTATTCAAGGATGCCAGCAAGCGCAGCATATCGCGCTGTG ACGATGCTAATCCCAAACCTTACCCAACCCACCTGGTCACGCACTGTTAAGCCGCTGTATGACGCTCTGGT GGTGCAATGCCACAAAGAAGAGTCAATCGCAGACAACATTTTGAATGCGGTCACACGTTAGCAGCATGATT GCCACGGATGGCAACATATTAACGGCATGATATTGACTTATTGAATAAAATTGGGTAAATTTGACTCAACG ATGGGTTAATTCGCTCGTTGTGGTAGTGAGATGAAAAGAGGCGGCGCTTACTACCGATTCCGCCTAGTTGG TCACTTCGACGTATCGTCTGGAACTCCAACCATCGCAGGCAGAGAGGTCTGCAAAATGCAATCCCGAAACA GTTCGCAGGTAATAGTTAGAGCCTGCATAACGGTTTCGGGATTTTTTATATCTGCACAACAGGTAAGAGCA TTGAGTCGATAATCGTGAAGAGTCGGCGAGCCTGGTTAGCCAGTGCTCTTTCCGTTGTGCTGAATTAAGCG AATACCGGAAGCAGAACCGGATCACCAAATGCGTACAGGCGTCATCGCCGCCCAGCAACAGCACAACCCAA ACTGAGCCGTAGCCACTGTCTGTCCTGAATTCATTAGTAATAGTTACGCTGCGGCCTTTTACACATGACCT TCGTGAAAGCGGGTGGCAGGAGGTCGCGCTAACAACCTCCTGCCGTTTTGCCCGTGCATATCGGTCACGAA CAAATCTGATTACTAAACACAGTAGCCTGGATTTGTTCTATCAGTAATCGACCTTATTCCTAATTAAATAG AGCAAATCCCCTTATTGGGGGTAAGACATGAAGATGCCAGAAAAACATGACCTGTTGGCCGCCATTCTCGC GGCAAAGGAACAAGGCATCGGGGCAATCCTTGCGTTTGCAATGGCGTACCTTCGCGGCAGATATAATGGCG GTGCGTTTACAAAAACAGTAATCGACGCAACGATGTGCGCCATTATCGCCTGGTTCATTCGTGACCTTCTC GACTTCGCCGGACTAAGTAGCAATCTCGCTTATATAACGAGCGTGTTTATCGGCTACATCGGTACTGACTC GATTGGTTCGCTTATCAAACGCTTCGCTGCTAAAAAAGCCGGAGTAGAAGATGGTAGAAATCAATAATCAA CGTAAGGCGTTCCTCGATATGCTGGCGTGGTCGGAGGGAACTGATAACGGACGTCAGAAAACCAGAAATCA TGGTTATGACGTCATTGTAGGCGGAGAGCTATTTACTGATTACTCCGATCACCCTCGCAAACTTGTCACGC TAAACCCAAAACTCAAATCAACAGGCGCCGGACGCTACCAGCTTCTTTCCCGTTGGTGGGATGCCTACCGC AAGCAGCTTGGCCTGAAAGACTTCTCTCCGAAAAGTCAGGACGCTGTGGCATTGCAGCAGATTAAGGAGCG TGGCGCTTTACCTATGATTGATCGTGGTGATATCCGTCAGGCAATCGACCGTTGCAGCAATATCTGGGCTT CACTGCCGGGCGCTGGTTATGGTCAGTTCGAGCATAAGGCTGACAGCCTGATTGCAAAATTCAAAGAAGCG GGCGGAACGGTCAGAGAGATTGATGTATGAGCAGAGTCACCGCGATTATCTCCGCTCTGGTTATCTGCATC ATCGTCTGCCTGTCATGGGCTGTTAATCATTACCGTGATAACGCCATTACCTACAAAGCCCAGCGCGACAA AAATGCCAGAGAACTGAAGCTGGCGAACGCGGCAATTACTGACATGCAGATGCGTCAGCGTGATGTTGCTG CGCTCGATGCAAAATACACGAAGGAGTTAGCTGATGCTAAAGCTGAAAATGATGCTCTGCGTGATGATGTT GCCGCTGGTCGTCGTCGGTTGCACATCAAAGCAGTCTGTCAGTCAGTGCGTGAAGCCACCACCGCCTCCGG CGTGGATAATGCAGCCTCCCCCCGACTGGCAGACACCGCTGAACGGGATTATTTCACCCTCAGAGAGAGGC TGATCACTATGCAAAAACAACTGGAAGGAACCCAGAAGTATATTAATGAGCAGTGCAGATAGAGTTGCCCA TATCGATGGGCAACTCATGCAATTATTGTGAGCAATACACACGCGCTTCCAGCGGAGTATAAATGCCTAAA GTAATAAAACCGAGCAATCCATTTACGAATGTTTGCTGGGTTTCTGTTTTAACAACATTTTCTGCGCCGCC ACAAATTTTGGCTGCATCGACAGTTTTCTTCTGCCCAATTCCAGAAACGAAGAAATGATGGGTGATGGTTT CCTTTGGTGCTACTGCTGCCGGTTTGTTTTGAACAGTAAACGTCTGTTGAGCACATCCTGTAATAAGCAGG GCCAGCGCAGTAGCGAGTAGCATTTTTTTCATGGTGTTATTCCCGATGCTTTTTGAAGTTCGCAGAATCGT ATGTGTAGAAAATTAAACAAACCCTAAACAATGAGTTGAAATTTCATATTGTTAATATTTATTAATGTATG TCAGGTGCGATGAATCGTCATTGTATTCCCGGATTAACTATGTCCACAGCCCTGACGGGGAACTTCTCTGC GGGAGTGTCCGGGAATAATTAAAACGATGCACACAGGGTTTAGCGCGTACACGTATTGCATTATGCCAACG CCCCGGTGCTGACACGGAAGAAACCGGACGTTATGATTTAGCGTGGAAAGATTTGTGTAGTGTTCTGAATG CTCTCAGTAAATAGTAATGAATTATCAAAGGTATAGTAATATCTTTTATGTTCATGGATATTTGTAACCCA TCGGAAAACTCCTGCTTTAGCAAGATTTTCCCTGTATTGCTGAAATGTGATTTCTCTTGATTTCAACCTAT CATAGGACGTTTCTATAAGATGCGTGTTTCTTGAGAATTTAACATTTACAACCTTTTTAAGTCCTTTTATT AACACGGTGTTATCGTTTTCTAACACGATGTGAATATTATCTGTGGCTAGATAGTAAATATAATGTGAGAC GTTGTGACGTTTTAGTTCAGAATAAAACAATTCACAGTCTAAATCTTTTCGCACTTGATCGAATATTTCTT TAAAAATGGCAACCTGAGCCATTGGTAAAACCTTCCATGTGATACGAGGGCGCGTAGTTTGCATTATCGTT TTTATCGTTTCAATCTGGTCTGACCTCCTTGTGTTTTGTTGATGATTTATGTCAAATATTAGGAATGTTTT CACTTAATAGTATTGGTTGCGTAACAAAGTGCGGTCCTGCTGGCATTCTGGAGGGAAATACAACCGACAGA TGTATGTAAGGCCAACGTGCTCAAATCTTCATACAGAAAGATTTGAAGTAATATTTTAACCGCTAGATGAA GAGCAAGCGCATGGAGCGACAAAATGAATAAAGAACAATCTGCTGATGATCCCTCCGTGGATCTGATTCGT GTAAAAAATATGCTTAATAGCACCATTTCTATGAGTTACCCTGATGTTGTAATTGCATGTATAGAACATAA GGTGTCTCTGGAAGCATTCAGAGCAATTGAGGCAGCGTTGGTGAAGCACGATAATAATATGAAGGATTATT CCCTGGTGGTTGACTGATCACCATAACTGCTAATCATTCAAACTATTTAGTCTGTGACAGAGCCAACACGC AGTCTGTCACTGTCAGGAAAGTGGTAAAACTGCAACTCAATTACTGCAATGCCCTCGTAATTAAGTGAATT TACAATATCGTCCTGTTCGGAGGGAAGAACGCGGGATGTTCATTCTTCATCACTTTTAATTGATGTATATG CTCTCTTTTCTGACGTTAGTCTCCGACGGCAGGCTTCAATGACCCAGGCTGAGAAATTCCCGGACCCTTTT TGCTCAAGAGCGATGTTAATTTGTTCAATCATTTGGTTAGGAAAGCGGATGTTGCGGGTTGTTGTTCTGCG GGTTCTGTTCTTCGTTGACATGAGGTTGCCCCGTATTCAGTGTCGCTGATTTGTATTGTCTGAAGTTGTTT TTACGTTAAGTTGATGCAGATCAATTAATACGATACCTGCGTCATAATTGATTATTTGACGTGGTTTGATG GCCTCCACGCACGTTGTGATATGTAGATGATAATCATTATCACTTTACGGGTCCTTTCCGGTGATCCGACA GGTTACGGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATACGTCAAAGCAA CCATAGTACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTAC ACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTC CCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAA AAACTTGATTTGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTT GGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGGCTATT CTTTTGATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTT AACGCGAATTTTAACAAAATATTAACGTTTACAATTTTATGGTGCACTCTCAGTACAATCTGCTCTGATGC CGCATAGTTAAGCCAGCCCCGACACCCGCCAACACCCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGG CATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCACCGTCATCACCG AAACGCGCGAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTC TTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATT CAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATG AGCCATATTCAACGGGAAACGTCGAGGCCGCGATTAAATTCCAACATGGATGCTGATTTATATGGGTATAA ATGGGCTCGCGATAATGTCGGGCAATCAGGTGCGACAATCTATCGCTTGTATGGGAAGCCCGATGCGCCAG AGTTGTTTCTGAAACATGGCAAAGGTAGCGTTGCCAATGATGTTACAGATGAGATGGTCAGACTAAACTGG CTGACGGAATTTATGCCTCTTCCGACCATCAAGCATTTTATCCGTACTCCTGATGATGCATGGTTACTCAC CACTGCGATCCCCGGAAAAACAGCATTCCAGGTATTAGAAGAATATCCTGATTCAGGTGAAAATATTGTTG ATGCGCTGGCAGTGTTCCTGCGCCGGTTGCATTCGATTCCTGTTTGTAATTGTCCTTTTAACAGCGATCGC GTATTTCGTCTCGCTCAGGCGCAATCACGAATGAATAACGGTTTGGTTGATGCGAGTGATTTTGATGACGA GCGTAATGGCTGGCCTGTTGAACAAGTCTGGAAAGAAATGCATAAACTTTTGCCATTCTCACCGGATTCAG TCGTCACTCATGGTGATTTCTCACTTGATAACCTTATTTTTGACGAGGGGAAATTAATAGGTTGTATTGAT GTTGGACGAGTCGGAATCGCAGACCGATACCAGGATCTTGCCATCCTATGGAACTGCCTCGGTGAGTTTTC TCCTTCATTACAGAAACGGCTTTTTCAAAAATATGGTATTGATAATCCTGATATGAATAAATTGCAGTTTC ATTTGATGCTCGATGAGTTTTTCTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAA CTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACG TGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTC TGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAG CTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTTCTTCTAGTGTA GCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTAC CAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAG GCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACT GAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGG TAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGT CCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATG GAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGT SEQIDNO:14ForwardprimerfortheqPCRtargetingRBGpolyA GCCAAAAATTATGGGGACAT SEQIDNO:15ReverseprimerfortheqPCRtargetingRBGpolyA ATTCCAACACACTATTGCAATG SEQIDNO:16ProbefortheqPCRtargetingRBGpolyA ATGAAGCCCCTTGAGCATCTGACTTCT SEQIDNO:17Forwardprimerspecificforthemurinebeta-actin CCTCTATGCCAACACAGTGC SEQIDNO:18Reverseprimerspecificforthemurinebeta-actin GCTAGGAGCCAGAGCAGTAA SEQIDNO:19Probespecificforthemurinebeta-actin ACCCAGGCATTGCTGACAGGATGCA SEQIDNO:20ForwardprimerspecificforthehGLAgene ACAGTACTGCAACCACTGGA SEQIDNO:21ReverseprimerspecificforthehGLAgene GTCCAGTCCAGGATGCTCTT SEQIDNO:22ProbespecificforthemurinehGLAgene CGCCGACATCGACGACAGCTGG SEQIDNO:23ForwardprimerspecificforthemurineGAPDHgene AGTGTTTCCTCGTCCCGTAG SEQIDNO:24ReverseprimerspecificforthemurineGAPDHgene AATCTCCACTTTGCCACTGC SEQIDNO:25ProbespecificforthemurineGAPDHgene TGGGCGCCTGGTCACCAGGG SEQIDNO:26stuffersequence CTGAATTATATACTCGGTGGATCGTATCTTGAAAATTCTTACTTTTATGTAACGTATAAAGATTAGTGAGA AACAGTTCTTTCTATCCTCTCCTCTCTATTTTATCAACTACCCCACCTCTCCAGATATAAACTTACATCAG ATTTTTAACAAGAGAATTCTAACCTTCATACATCCGACCCTCCCATTTATGGTTTAGAACCATATAGTCTT GACTCGTACAGGGAACTTCCAATTCTTTATCAATTACCCGTTTATCTCGTACCGTTATAAAACATCTCGTC GTTCATCATCCGGAACTTATCTACAGCGAGTTTTTCATTATACATTCGACTTGTGTTTTTACATTGTTTAC TTAAATCTATGTATAAACTTATAATTTAAGTCCAACAAACCCTCTACGTGGATCAGAAACTACCAATTTGG AAAGGGAGGTATCTTCTCTGTCTCTGTCTTACCGAACGACCTGATTACAGGGTTAAGTTATCTCAGAATAG ATACTTCCAATTTTTGTTCTTCTCTGTATCACTCCTCATAAAGTAATGACGTACACAAACATCAGAACTAT CGTTCTTGACAGTTAAGTTCGATCGTTGAAAAAGGACTTCATCACTAATATAAAGAATCTCCTTTCATAAC CTCACAACGGGAATAATACGACTATTCTCATGGGTCTTATTTTACCTTTTTCTACTTGTTAATTGACTATT TAAACACGTGTACCGTTTAATCAATTACCCTTGGTATCCTCTTAAATAAAGATCTACATTTATTAATAAAA TTCAAACGGGATACCACCGGGGTGTGTACTCTGTTTGGGGGTTCTACACTGAAAACTCTTACTCTGAACCT ATTTTTTGTACATCTTTACGTTCGGGACTTCGAGTTGAGGGATAACGATAGTGTCCCCAATATTAACGTAT TTTAAATCGATATCTTTCAACGACAGTAGAGAACACCCGACATTAGTAGCAGATCCGAATTCTCATTATAA CGTTTTGGACAGTACGGGTGTGTTTAGAGAGGGACCGTAACAACAGAAACGTCTACAGTCACTTTCTCTTG GTCGTCGAGGGTACTCAAAC SEQIDNO:27stuffersequence ATCTCGTCTCTTTCTTCCTCTATTTCTATGTCTGATGTCGGATAAGTCTCACTGAATGTTTACGTGGCAAG ACCTATCCTACGGCACCCCGTCGGAGAGTCGTGTGTATAGTCGATCCGATTAATATACAATTAACATCAAT AAATAGGACCAAAATATTATATTAAAGAGACCTTCAACAATCTTAAAAATAAGATTGAAATTACAAGACTT TAAAGTATATGTATACCTTATTTAACGAAACCTAAAAATAAACAAAATAAAAGGTAAACTAAATTAAACCA AAACATTTAGGACGAGTTGTGACTCATCCCAGAAAAAAGATTAGAGGATTGAAATAAAGAGATATTTCCTT ATAAGAGACAATAGAGAATTTTATAACCGTCGAGGCATAATGCTGATTAGAAAACTTTGAGATAAATCTAC TAAAAACCCTTGAAGACCCAGACAAGAGGTTAAGAGAAGGGAAAATAATAAAGAGACAGAAATCAAAGTCG AAATATTAATTAAGATGACGGTGTATGTAAAACGTGAAACCGGATATTTAAAGTGTTAAACACAAAAAAAT AAAAATATCAAGATCAACCAAGAAGAAATATAGGTGGATCAGTACAAACGGATGTGTGTTCAGTGTTTCTA AAAGAGGATATAAAAAATAGATTTTCGAAATATCAAAACAAAAATATAAAGTCAGATATTATGTAGAGTTT AATTAAAAACACAAAACACACTTCATCCCAGATCCATATAACGAAAGGGTTTCCTGTCGATCAAAAGGATT GTGCTAAACAATTCTAATAAGTAAAAGGATTACTTAAAAACTGGTTTGTTTAGTTTACCTGTAGATTCACA CAGAGATCAAAAATCGGGAAATAAGATAATGAAATTAGATAAATAACCAAGACACGGTCATTTTATTATTA AACTAATGTCGTATAATATCAATTAGAACTCCAATACATCACATACAGAGGGTTCAAACAAGTAGAAAGAG TTCAAACGAAACCTATCAGATCCAGGAATTCCATGGAAATGAGTCCTCGAAAACTTGTGTCATCGTAAGAT CGTCTTTACTCGGAACTGTT