ANTIBODY FOR DETECTING ACETYLATION OF COX2 PROTEIN, AND USES THEREOF

20230125690 · 2023-04-27

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to an antibody for detecting acetylation of COX2 protein, and uses thereof, and more specifically, to an antibody that specifically recognizes the acetylation of S565 residue of the COX2 protein; and uses thereof for diagnosing neurodegenerative diseases or inflammatory diseases. An antibody or a functional fragment thereof according to the present invention specifically binds to an acetylated residue of COX2 protein, and can thus be very effectively used for diagnosing neurodegenerative diseases, inflammatory diseases, and the like in which the degree of acetylation of S565 residue of the COX2 protein is reduced.

    Claims

    1. An antibody or a functional fragment thereof that specifically recognizes the acetylation of cyclooxygenase 2 (COX2) protein.

    2. The antibody or the functional fragment thereof of claim 1, wherein the acetylation is acetylation in S565 residue of cyclooxygenase 2 (COX2) protein defined by SEQ ID NO: 1.

    3. The antibody or the functional fragment thereof of claim 1, wherein the epitope of the antibody is a peptide including an amino acid sequence represented by SEQ ID NO: 2 and consisting of 9 to 50 amino acids.

    4. The antibody or the functional fragment thereof of claim 3, wherein in the epitope of the antibody, a PELI sequence is additionally included in a C terminus of the amino acid sequence represented by SEQ ID NO: 2 or a GC sequence is additionally included in an N terminus.

    5. The antibody or the functional fragment thereof of claim 1, wherein the epitope of the antibody is a peptide consisting of an amino acid sequence represented by SEQ ID NO: 3 or SEQ ID NO: 4.

    6. The antibody or the functional fragment thereof of claim 1, wherein the antibody or the functional fragment thereof is an antibody or a functional fragment thereof comprising an antibody light chain variable region (VL) having a complementarity determining region (CDR) L1 including an amino acid sequence represented by SEQ ID NO: 5, a complementarity determining region (CDR) L2 including an amino acid sequence represented by SEQ ID NO: 6, and a complementarity determining region (CDR) L3 including an amino acid sequence represented by SEQ ID NO: 7 and an antibody heavy chain variable region (VH) having a complementarity determining region (CDR) H1 including an amino acid sequence represented by SEQ ID NO: 8, a complementarity determining region (CDR) H2 including an amino acid sequence represented by SEQ ID NO: 9, and a complementarity determining region (CDR) H3 including an amino acid sequence represented by SEQ ID NO: 10; or an antibody or a functional fragment thereof comprising an antibody light chain variable region (VL) having a complementarity determining region (CDR) L1 including an amino acid sequence represented by SEQ ID NO: 21, a complementarity determining region (CDR) L2 including an amino acid sequence represented by SEQ ID NO: 22, and a complementarity determining region (CDR) L3 including an amino acid sequence represented by SEQ ID NO: 23 and an antibody heavy chain variable region (VH) having a complementarity determining region (CDR) H1 including an amino acid sequence represented by SEQ ID NO: 24, a complementarity determining region (CDR) H2 including an amino acid sequence represented by SEQ ID NO: 25, and a complementarity determining region (CDR) H3 including an amino acid sequence represented by SEQ ID NO: 26.

    7. The antibody or the functional fragment thereof of claim 1, wherein the antibody or the functional fragment thereof is an antibody or a functional fragment thereof comprising a light chain variable region (VL) including an amino acid sequence represented by SEQ ID NO: 11 and a heavy chain variable region (VH) including an amino acid sequence represented by SEQ ID NO: 12; or an antibody or a functional fragment thereof comprising a light chain variable region (VL) including an amino acid sequence represented by SEQ ID NO: 27 and a heavy chain variable region (VH) including an amino acid sequence represented by SEQ ID NO: 28.

    8. The antibody or the functional fragment thereof of claim 1, wherein the antibody is selected from the group consisting of IgG, IgA, IgM, IgE and IgD.

    9. The antibody or the functional fragment thereof of claim 1, wherein the functional fragment of the antibody is selected from the group consisting of a diabody, Fab, Fab′, F(ab)2, F(ab′)2, Fv and scFv.

    10. A polynucleotide encoding the antibody or the functional fragment thereof of claim 1.

    11. A vector comprising the polynucleotide of claim 10.

    12. A host cell transformed with the vector of claim 11.

    13. A method for preparing an antibody or a functional fragment thereof that specifically recognizes acetylation of cyclooxygenase 2 (COX2) protein, comprising steps of producing a polypeptide including light chain and heavy chain variable regions by culturing the cell of claim 12 under a condition in which the polynucleotide is expressed, and recovering the polypeptide from the cell or a culture medium culturing the cell.

    14. A composition for diagnosing neurodegenerative diseases comprising the antibody or the functional fragment thereof of claim 1.

    15. The composition of claim 14, wherein the neurodegenerative diseases are one or more selected from the group consisting of Alzheimer's disease, Parkinson's disease, progressive supranuclear palsy, multiple system atrophy, olivine-pony-cerebellar atrophy (OPCA), Shay-Drager syndrome, striatal-nigular degeneration, Huntington's disease, amyotrophic lateral sclerosis (ALS), essential tremor, cortical-basal nucleus degeneration, diffuse Lewy body disease, Parkinson's-ALS-dementia complex, Nieman-Pick's disease, Pick's disease, cerebral ischemia and cerebral infarction.

    16. A kit for diagnosing neurodegenerative diseases comprising the antibody or the functional fragment thereof of claim 1.

    17. A composition for diagnosing inflammatory diseases comprising the antibody or the functional fragment thereof of claim 1.

    18. The composition of claim 17, wherein the inflammatory diseases are one or more selected from the group consisting of dermatitis, allergy, atopic dermatitis, asthma, conjunctivitis, rhinitis, otitis media, sore throat, tonsillitis, pneumonia, gastric ulcer, gastritis, Crohn's disease, inflammatory bowel disease, lupus, hepatitis, cystitis, nephritis, sjogren's syndrome, uveitis, ankylosing spondylitis, endometritis, multiple sclerosis, sepsis, septic shock, chronic obstructive pulmonary disease and arthritis.

    19. (canceled)

    20. A method for diagnosing neurodegenerative diseases comprising steps of: a) obtaining a sample from a subject; b) measuring an acetylation level of COX2 protein by adding the antibody or the functional fragment thereof of claim 1 to the sample; and c) comparing the acetylation level of the COX2 protein with that of a normal subject, and determining that a subject having a reduced acetylation level of the COX2 protein compared to the normal subject suffers from neurodegenerative diseases.

    21. (canceled)

    22. A method for diagnosing inflammatory diseases comprising steps of: a) obtaining a sample from a subject; b) measuring an acetylation level of COX2 protein by adding the antibody or the functional fragment thereof of claim 1 to the sample; and c) comparing the acetylation level of the COX2 protein with that of a normal subject, and determining that a subject having a reduced acetylation level of the COX2 protein compared to the normal subject suffers from inflammatory diseases.

    Description

    DESCRIPTION OF DRAWINGS

    [0165] FIGS. 1A and 1B illustrate an absorbance result of analyzing whether to detect separately an acetylated peptide (PFTSacFSVPDPELI (SEQ ID NO: 3)) and a non-acetylated peptide (PFTSFSVPDPELI (SEQ ID NO: 45)) by ELISA assay after preparing a monoclonal antibody (9F7-2) that recognizes a peptide (PFTSacFSVPDPELI) including acetylated S565 residue in COX2 as an epitope (FIG. 1A), and a result of detecting and then quantifying an expression level of COX2 including acetylated S565 residue in wild-type human microglia and S565A-mutated human microglia by ELISA assay (FIG. 1B).

    [0166] FIGS. 2A and 2B illustrate a result of confirming and quantifying an expression level of COX2 including acetylated S565 residue by ELISA assay using a monoclonal antibody (9F7-2) according to the present invention after extracting a protein in peripheral blood mononuclear cells (PBMCs) obtained from a normal mouse (WT) and an Alzheimer's animal model (APP/PS1) (FIG. 2A), and a graph showing a ratio of COX2 including acetylated S565 residue to total COX2 protein by observing total COX2 protein (COX2, red) and COX2 including acetylated S565 residue (9F7-2, blue) by immunofluorescence staining in microglia (Iba1, microglia marker, green) in brain tissue of a normal mouse (WT) and an Alzheimer's animal model (APP/PS1) and quantifying the total COX2 protein and the COX2 (FIG. 2B).

    [0167] FIGS. 3A and 3B illustrate a result of confirming an expression level of COX2 including acetylated S565 residue by ELISA assay using a monoclonal antibody (9F7-2) according to the present invention after extracting a protein in peripheral blood mononuclear cells (PBMCs) obtained from a normal person (Control) and an Alzheimer's patient (AD) (FIG. 3A), and a graph showing a ratio of COX2 including acetylated S565 residue to total COX2 protein by observing total COX2 protein (COX2, red) and COX2 including acetylated S565 residue (9F7-2, blue) by immunofluorescence staining in microglia (Iba1, microglia marker, green) in brain tissue of a normal person (Control) and an Alzheimer's patient (AD) and quantifying the total COX2 protein and the COX2 (FIG. 3B).

    [0168] FIGS. 4A and 4B illustrate an absorbance result of analyzing whether to detect separately an acetylated peptide (GCPFTSacFSVPD (SEQ ID NO: 4)) and a non-acetylated peptide (GCPFTSacFSVPD (SEQ ID NO: 46)) by ELISA assay after preparing a monoclonal antibody (44C7C8) that recognizes a peptide (GCPFTSacFSVPD) including S565 residue acetylated in COX2 as an epitope (FIG. 4A), and a result of detecting and then quantifying an expression level of COX2 including acetylated S565 residue in wild-type human microglia and S565A-mutated human microglia by ELISA assay (FIG. 4B).

    [0169] FIGS. 5A and 5B illustrate a result of confirming and quantifying an expression level of COX2 including acetylated S565 residue by ELISA assay using a monoclonal antibody (44C7C8) according to the present invention after extracting a protein in peripheral blood mononuclear cells (PBMCs) obtained from a normal mouse (WT) and an Alzheimer's animal model (APP/PS1) (FIG. 5A), and a graph showing a ratio of COX2 including acetylated S565 residue to total COX2 protein by observing total COX2 protein (COX2, red) and COX2 including acetylated S565 residue (44C7C8, blue) by immunofluorescence staining in microglia (Iba1, microglia marker, green) in brain tissue of a normal mouse (WT) and an Alzheimer's animal model (APP/PS1) and quantifying the total COX2 protein and the COX2 (FIG. 5B).

    [0170] FIGS. 6A and 6B illustrate a result of confirming an expression level of COX2 including acetylated S565 residue by ELISA assay using a monoclonal antibody (44C7C8) according to the present invention after extracting a protein in peripheral blood mononuclear cells (PBMCs) obtained from a normal person (Control) and an Alzheimer's patient (AD) (FIG. 6A), and a graph showing a ratio of COX2 including acetylated S565 residue to total COX2 protein by observing total COX2 protein (COX2, red) and COX2 including acetylated S565 residue (44C7C8, blue) by immunofluorescence staining in microglia (Iba1, microglia marker, green) in brain tissue of a normal person (Control) and an Alzheimer's patient (AD) and quantifying the total COX2 protein and the COX2 (FIG. 6B).

    [0171] FIG. 7 illustrates a light chain variable region DNA sequence and a peptide amino acid sequence of a monoclonal antibody (9F7-2) that recognizes a peptide (PFTSacFSVPDPELI) of SEQ ID NO: 3 as an epitope.

    [0172] FIG. 8 illustrates a heavy chain variable region DNA sequence and a peptide amino acid sequence of a monoclonal antibody (9F7-2) that recognizes a peptide (PFTSacFSVPDPELI) of SEQ ID NO: 3 as an epitope.

    [0173] FIG. 9 illustrates a light chain variable region DNA sequence and a peptide amino acid sequence of a monoclonal antibody (44C7C8) that recognizes a peptide (GCPFTSacFSVPD) of SEQ ID NO: 4 as an epitope.

    [0174] FIG. 10 illustrates a heavy chain variable region DNA sequence and a peptide amino acid sequence of a monoclonal antibody (44C7C8) that recognizes a peptide (GCPFTSacFSVPD) of SEQ ID NO: 4 as an epitope.

    MODES FOR THE INVENTION

    [0175] Hereinafter, the present invention will be described in detail by the following Examples. However, the following Examples are just illustrative of the present invention, and the contents of the present invention are not limited to the following Examples.

    [0176] Experiment Method

    [0177] 1. Preparation of Antibody

    [0178] 1-1: Preparation of Hybridoma Cell for Fabricating S565 Acetylated Monoclonal Antibody of COX2

    [0179] Peptides of (i) SEQ ID NO: 3 (PFTSacFSVPDPELI) and (ii) SEQ ID NO: 4 (GCPFTSacFSVPD) including S565 residue acetylated in COX-2 protein of SEQ ID NO: 1 were prepared, and then the corresponding peptides were immunized in wild-type BALB/c mice, and monoclonal antibodies thereto were established by a cell fusion method. 5 to 7×10.sup.6 splenocytes obtained from the immunized mice were fused with SP2/O myeloma cells to prepare a hybridoma cell line.

    [0180] 1-2: Screening Method for Selecting Clones

    [0181] First, IgG expression was screened twice using a 96-well plate. Then, positive expression clones were transferred to a 24-well plate, and a cell supernatant (=clones) of the growing cells was screened by ELISA using the prepared epitope peptide of SEQ ID NO: 3 or SEQ ID NO: 4.

    [0182] 1-3: Screening Method Using Epitope Peptide

    [0183] 50 μl/well of a hybridoma supernatant (1:500) in a coating buffer was added to a 96-well plate, and then coated at 4° C. for 16 hours. After the plate was washed with PBS/Tween, 300 μl/well of a blocking solution was applied at RT for 1 hour. 50 μl (500 μg/ml) of the peptide of SEQ ID NO: 3 or SEQ ID NO: 4 was incubated at room temperature for 2 hours. After the washing step, a COX2 antibody (abcam, ab15191) attached with biotin using a Biotin conjugation kit (abcam, ab201796) was applied to the plate at a concentration of 0.5 μg/ml at RT for 1 hour. Next, a peroxidase (HRP) solution (1:1000) was applied onto the plate for 1 hour at RT. After the final washing, the detection was performed with TMB (3-3′,5,5′-tetramethylbenzidine) (phosphatase substrate for HRP) and the plate was read at 405 nm using an ELISA plate reader. The result was expressed by optical density (O.D.). As a negative control, the non-acetylated peptide of SEQ ID NO: 3 or SEQ ID NO: 4 (500 μg/ml) was used.

    [0184] 1-4: Clone Screening Method Using COX2 S565 Mutant Cells

    [0185] In order to prepare an antibody specific for the acetylation of S565 residue in COX2 protein, the hybridoma cell supernatant was used to determine whether COX2 S565 was acetylated in normal microglia and microglia induced by mutation at S565 residue of the COX2 protein. S565 mutant microglia were formed by transfecting a protein (S565A) substituting Serine 565 of COX2 with Alanine into normal microglia (Applied Biologics Materials, T0251). The normal microglia and the S565 mutant microglia were lysed by adding an RIPA solution (Cell signaling, 9806S), and then the cell lysate was centrifuged (13,000×g, 10 minutes) to obtain a supernatant, and then the amount of protein was quantified and ELISA screening was performed using 100 μg/ml of protein.

    [0186] A standard curve was obtained by step-diluting the peptide (500 μg/ml) of SEQ ID NO: 3 or SEQ ID NO: 4, and the value of COX2 protein acetylated in S565 was calculated by substituting an optical density (O.D.) value obtained from the sample into the obtained standard curve.

    [0187] 1-5: Clone Screening

    [0188] Monoclonal antibodies (hereinafter, referred to as 9F7-2 and 9F7-2) that were positive for the peptide of SEQ ID NO: 3 or SEQ ID NO: 4 and detected the COX2 protein with acetylated S565 in normal microglia compared to microglia inducing S565 mutation (S565A) were screened and finally, 9F7-2 and 44C7F5 hybridoma cells of single colonies were secured by a limiting dilution method.

    [0189] 1-6: Amino Acid Sequencing of Prepared Antibody

    [0190] Total RNA was isolated from the selected hybridoma cells according to a technical manual of a TRIzol® reagent (Ambion, 15596-026). Then, total RNA was reverse-transcribed into cDNA using isotype-specific anti-sense primers or universal primers according to a technical manual of a PrimeScript TM 1st Strand cDNA Synthesis kit (Takara, 6110A). Antibody fragments of heavy and light chains were amplified according to a standard operating procedure (SOP) for rapid amplification. The amplified antibody fragments were individually cloned with a standard cloning vector. Colony PCR was performed to screen clones with inserts of a correct size.

    [0191] 2. Mouse

    [0192] A mouse experiment has been approved by the Kyungpook National University Institutional Animal Care and Use Committee (IACUC). A transgenic mouse line overexpressing APPswe (hAPP695swe) or PS1 (presenilin-1M146V) based on C57BL/6 mice (Charles River, UK) was used [Hereinafter, APP mouse: mouse overexpressing APPswe, PS1 mouse: mouse overexpressing presenilin-1M146V; GlaxoSmithKline].

    [0193] 3. ELISA Assay

    [0194] Samples such as acetylated peptides of SEQ ID NO: 3 and SEQ ID NO: 4, a non-acetylated peptide having the same amino acid sequence as the peptides of SEQ ID NO: 3 and SEQ ID NO: 4, but non-acetylated serine, peripheral blood mononuclear cells (PBMCs) of mouse and human, and the like were prepared.

    [0195] The sample preparation was performed according to the following procedure. After collecting mouse and human blood, the blood was transferred to a heparin tube and reacted for 30 minutes. The reacted blood was placed on the same amount of Histopaque (sigma, 10771) and centrifuged (400 g, 30 minutes). After centrifugation, a middle PBMC layer was separated and washed. After washing, the PBMCs were lysed by adding an RIPA solution (Cell signaling, 9806S), and then the cell lysate was centrifuged (13,000×g, 10 minutes) to obtain a supernatant, and then the amount of protein was quantified and ELISA assay was performed using 100 μg/ml of protein.

    [0196] 50 μl/well of the monoclonal antibodies 9F7-2 and 44C7F5 (0.1 μg/ml) prepared in Experiment 1 in the coating buffer were added to each well of a 96-well plate, and coated at 4° C. for 16 hours. After the plate was washed with PBS/Tween, 300 μl/well of a blocking solution was applied at RT for 1 hour. 50 μl of a PBMC sample (100 μg/ml) was treated and incubated at RT for 2 hours. After the washing step, a COX2 antibody (abcam, ab15191) attached with biotin using a Biotin conjugation kit (abcam, ab201796) was applied onto the plate at a concentration of 0.5 μg/ml at RT for 1 hour. Next, a peroxidase (HRP) solution (1:1000) was applied onto the plate for 1 hour at RT. After the final washing, the detection was performed with TMB (3-3′,5,5′-tetramethylbenzidine) (phosphatase substrate for HRP) and the plate was read at 405 nm using an ELISA plate reader. A standard curve was obtained by step-diluting the peptide (500 μg/ml) of SEQ ID NO: 3 or SEQ ID NO: 4, and the amount of COX2 protein acetylated in S565 residue was calculated by substituting an optical density (O.D.) value obtained from the sample to the Standard curve.

    [0197] 4. Immunofluorescence Assay

    [0198] In cerebral tissues of wild type (WT) and APP/PS1 9-month-old mice and human (normal group and Alzheimer's patient group) cerebral tissues, the expression level of COX2 protein with acetylated S565 residue was confirmed by immunofluorescence using each monoclonal antibody (9F7-2 or 44C75F) prepared in Experimental Method 1 above.

    [0199] The cerebra of 9-month-old normal control and APP/PS1 mice were extracted and then fixed with 4% paraformaldehyde. The extracted cerebral tissue was sectioned using a floating section. For human (normal group and Alzheimer's patient group) cerebral tissues, Paraffin sections provided by each of 6 persons from the Netherlands brain bank were used.

    [0200] The mouse and human (normal group and Alzheimer's patient group) cerebral tissue sections were treated with each monoclonal antibody (9F7-2 or 44C75F) (mouse, 1:100) prepared in Experimental Method 1, an anti-COX2 antibody (goat, 1:500, Abcam) and an anti-Iba1 antibody (rabbit, 1:500, Wako) and cultured at 4° C. for 16 hours. Thereafter, in the presence of AlexaFluor conjugates rabbit 488, goat 594, and mouse 674 antibodies (1:500; Life Technologies, Waltham, Mass., USA), secondary antibodies were incubated for 2 hours and subjected to glass coverslipping. In the cerebral tissues, a ratio of cells stained with 9F7-2 and 44C75F antibodies among cells stained with anti-COX2 and anti-Iba1 was quantified and analyzed using MetaMorph (Molecular Devices, USA).

    [0201] 5. Statistical Analysis

    [0202] A T-test for students was performed to compare two groups, while for comparison of multiple groups, repeated measurement analysis of a Tukey's HSD test and a variance test was performed according to an SAS statistical package (release 9.1; SAS Institute Inc., Cary, N.C.). *p<0.05, **p<0.01 were considered significant.

    [0203] Experimental Result

    [0204] 1. Preparation of Antibody 9F7-2 Using Region (PFTSacFSVPDPELIC) Including Acetylated S565 Residue in COX2 as Epitope

    [0205] A monoclonal antibody 9F7-2, that recognized 13 amino acids of PFTSacFSVPDPELI including acetylated S565 in COX2, was prepared according to the experimental method. An amino acid sequence of the prepared monoclonal antibody 9F7-2 and a polynucleotide sequence encoding the amino acid sequence were analyzed, and the sequencing results were shown in Table 1 below.

    TABLE-US-00002 Amino acid sequence DNA sequence Light CDR-L1 RSSQSIVHRNGFTYLE AGATCTAGTCAGAGCATTGTACATCGTAATGGA chain (SEQ ID NO: 5) TTCACCTACTTAGAA (SEQ ID NO: 13) variable CDR-L2 QVSNRFS (SEQ ID NO: 6) CAAGTTTCCAACCGATTTTCT (SEQ ID NO: 14) region CDR-L3 FQGSHVPPT (SEQ ID NO: TTTCAGGGTTCACATGTTCCTCCGACA (SEQ ID (VL) 7) NO: 15) Full (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHRNGFTYLEWYLQKPGQSPKLLIYQVSNRFSGVPDR FSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIK (SEQ ID NO: 11) GATGTTTTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCCATCT CTTGCAGATCTAGTCAGAGCATTGTACATCGTAATGGATTCACCTACTTAGAATGGTACCTGCA GAAACCAGGCCAGTCTCCAAAGCTCCTGATCTACCAAGTTTCCAACCGATTTTCTGGGGTCCC AGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGG CTGAGGATCTGGGAGTTTATTACTGCTTTCAGGGTTCACATGTTCCTCCGACATTCGGTGGAGG CACCAAGCTGGAAATCAAA (SEQ ID NO: 19) Heavy CDR-H1 DYLLG (SEQ ID NO: 8) GACTACTTACTAGGT (SEQ ID NO: 16) chain CDR-H2 DIYPGGTYIKYNEKFKG GATATTTACCCTGGAGGTACTTATATTAAGTACA variable (SEQ ID NO: 9) ATGAGAAGTTCAAGGGC (SEQ ID NO: 17) region CDR-H3 GRNDEKGDY GGGAGGAACGACGAGAAGGGGGACTAC (VH) (SEQ ID NO: 10) (SEQ ID NO: 18) Full (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) QVQLQQSGAELVRPGTSVKISCKASGYTFTDYLLGWVKQRPGHGLEWIGDIYPGGTYIKYNEKF KGKATLTADTSSSTAYMQLSSLTSEDSAVYFCARGRNDEKGDYWGQGTSVTVSS (SEQ ID NO: 12) CAGGTCCAGCTGCAGCAGTCTGGAGCTGAGCTGGTAAGACCTGGGACTTCAGTGAAGATATC CTGCAAGGCTTCTGGCTACACCTTCACTGACTACTTACTAGGTTGGGTAAAGCAGAGGCCTGG ACATGGACTTGAGTGGATTGGAGATATTTACCCTGGAGGTACTTATATTAAGTACAATGAGAAG TTCAAGGGCAAGGCCACACTGACTGCAGACACATCCTCCAGCACTGCCTACATGCAACTCAG TAGCCTGACATCTGAGGACTCTGCTGTCTACTTCTGTGCAAGAGGGAGGAACGACGAGAAGG GGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA (SEQ ID NO: 20)

    [0206] To determine whether the prepared monoclonal antibody 9F7-2 may separately target the acetylated peptide (PFTSacFSVPDPELI (SEQ ID NO: 3)) and the non-acetylated control peptide (PFTSFSVPDPELI (SEQ ID NO: 45)), ELISA assay was performed in a 96-well plate coated with the antibody 9F7-2.

    [0207] As a result, as illustrated in FIG. 1A, it was confirmed that the acetylated peptide (PFTSacFSVPDPELI (SEQ ID NO: 3)) exhibited higher absorbance than that of the non-acetylated control peptide (PFTSFSVPDPELI (SEQ ID NO: 45)).

    [0208] In addition, in order to confirm whether the prepared antibody may specifically target the S565 acetylated COX2 protein even in human-derived microglia, the present inventors treated an extract from a control cell (control) and a cell inducing a mutant (S565A) substituting S565 residue of COX2 with alanine with the antibody 9F7-2.

    [0209] As a result, as illustrated in FIG. 1B, it was confirmed that the detection amount of acetylated COX2 protein was decreased in microglia (S565A COX2) mutated in S565 compared to normal human-derived microglia (control).

    [0210] Based on these results, it was confirmed that the prepared monoclonal antibody 9F7-2 specifically targeted the acetylated S565 residue in the COX2 protein, and the epitope of the antibody was a sequence of PFTSacFSVPDPELI (SEQ ID NO: 3) including the acetylated S565 residue in the COX2 protein.

    [0211] 2. Confirmation of Reduction of S565 Acetylation of COX2 in Blood Cells and Brain Tissue of Alzheimer's Animal Model Using Antibody 9F7-2

    [0212] The present inventors confirmed the degree of S565 acetylation of COX2 protein in blood cells (PBMC) obtained from an Alzheimer's animal model using the prepared monoclonal antibody 9F7-2.

    [0213] As a result, as illustrated in FIG. 2A, as compared with a wild-type mouse (WT), it was confirmed that the degree of S565 acetylation of COX2 protein detected by the monoclonal antibody 9F7-2 was reduced in blood cells (PBMC) of an Alzheimer's animal (APP/PS1).

    [0214] In addition, the present inventors reconfirmed the expression level of COX2 protein with acetylated S565 residue in microglia in the brain tissue of a wild-type animal (WT) and an Alzheimer's animal model (APP/PS1) using the monoclonal antibody 9F7-2.

    [0215] As a result, as illustrated in FIG. 2B, as compared with a wild-type animal (WT), it was confirmed that the degree of S565 acetylation of COX2 protein detected by the monoclonal antibody 9F7-2 was reduced in microglia of an Alzheimer's animal (APP/PS1). In particular, although the expression level of COX2 protein (both COX2 proteins with or without acetylated S565) increased in microglia of the Alzheimer's animal compared to the wild-type animal, it was confirmed that the degree of S565 acetylation of COX2 protein was rather decreased. Therefore, a ratio of the expression level of the S565 acetylated COX2 protein to the expression level of the total COX2 protein (ac-S565+COX2+microglia/COX2+microglia) was significantly low in the Alzheimer's animal model (bottom graph of FIG. 2B).

    [0216] Through the results, it was confirmed that the degree of S565 acetylation of the COX2 protein detected by the monoclonal antibody 9F7-2 in blood cells and microglia of the Alzheimer's animal model was significantly reduced, which coincided with the result of a previous study (Korean Patent Application No. 10-2018-0127656).

    [0217] Furthermore, through the results of the example, it was confirmed that the ratio of the S565 acetylated COX2 protein to the total COX2 protein in the microglia of the brain tissue of the Alzheimer's animal model was significantly low as compared with a normal animal, and these results suggested the applicability of the ratio of the S565 acetylated COX2 protein to the total COX2 protein as a diagnostic marker for neurodegenerative diseases.

    [0218] 3. Confirmation of Reduction of S565 Acetylation of COX2 Detected by Antibody 9F7-2 in Blood Cells and Brain Tissue of Alzheimer's Patient

    [0219] The present inventors confirmed the degree of S565 acetylation of COX2 protein in blood cells (PBMC) obtained from an Alzheimer's patient using the prepared monoclonal antibody 9F7-2.

    [0220] As a result, as illustrated in FIG. 3A, as compared with a control, it was confirmed that the degree of S565 acetylation of COX2 protein detected by the monoclonal antibody 9F7-2 was reduced in blood cells (PBMC) of the Alzheimer's patient.

    [0221] In addition, the present inventors reconfirmed the expression level of COX2 protein with acetylated S565 residue in microglia in the brain tissue of the control and the Alzheimer's patient using the monoclonal antibody 9F7-2.

    [0222] As a result, as illustrated in FIG. 3B, as compared with a control, it was confirmed that the degree of COX2 S565 acetylation detected by the monoclonal antibody 9F7-2 was reduced in microglia of the Alzheimer's patient. In particular, although the expression level of COX2 protein (both COX2 proteins with or without acetylated S565) increased in microglia of the Alzheimer's patient compared to the control, it was confirmed that the degree of S565 acetylation of COX2 protein was rather decreased. Therefore, a ratio of the expression level of the S565 acetylated COX2 protein to the expression level of the total COX2 protein (ac-S565+COX2+microglia/COX2+microglia) was significantly low in the Alzheimer's patient (bottom graph of FIG. 3B).

    [0223] Through the results, it was confirmed that the degree of S565 acetylation of COX2 protein detected by the monoclonal antibody 9F7-2 in blood cells and microglia of the Alzheimer's patient was significantly reduced, and it was confirmed that the ratio of the S565 acetylated COX2 protein to the total COX2 protein in the microglia of the brain tissue of the Alzheimer's patient was significantly low as compared with the control. The result coincided with the Alzheimer's animal result of FIG. 2 and suggested the applicability of the ratio of the S565 acetylated COX2 protein to the total COX2 protein as a diagnostic marker for neurodegenerative diseases.

    [0224] 4. Preparation of Antibody 44C7C8 Using Region (GCPFTSacFSVPD) Including Acetylated S565 Residue in COX2 as Epitope

    [0225] The present inventors prepared a monoclonal antibody 44C7C8 having GCPFTSacFSVPD (SEQ ID NO: 4) as an epitope, which consisted of 11 amino acids shorter than 14 amino acids of PFTSacFSVPDPELIC (SEQ ID NO: 3) sequence including acetylated S565 in COX2 illustrated in FIG. 1. An amino acid sequence of the prepared monoclonal antibody 44C7C8 and a polynucleotide sequence encoding the amino acid sequence were analyzed, and the sequencing results were shown in Table 2 below.

    TABLE-US-00003 TABLE 2 Amino acid sequence DNA sequence Light CDR-L1 KSSQSLLYSRNQKNYLA AAGTCCAGTCAGAGCCTTTTATATAGTAGAA chain (SEQ ID NO: 21) ATCAAAAGAACTACTTGGCC (SEQ ID NO: 29) variable CDR-L2 WASTRES (SEQ ID NO: 22) TGGGCATCCACTAGGGAATCT (SEQ ID NO: region 30) (VL) CDR-L3 QQYYTYPFT (SEQ ID NO: CAGCAATATTATACCTATCCATTCACG (SEQ 23) ID NO: 31) Full (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) DIVMSQSPSSLAVSVEEKVNMSCKSSQSLLYSRNQKNYLAWYQQKPGQSPKLLIYWASTRES GVPDRFTGSGAGTDFTLTISSVKAEDLAVYYCQQYYTYPFTFGSGTKLEIK (SEQ ID NO: 27) GACATTGTGATGTCACAGTCTCCATCCTCCCTAGCTGTGTCAGTTGAAGAGAAGGTTAATA TGAGCTGCAAGTCCAGTCAGAGCCTTTTATATAGTAGAAATCAAAAGAACTACTTGGCCT GGTACCAGCAGAAACCAGGGCAGTCTCCTAAACTACTGATTTACTGGGCATCCACTAGGG AATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGAGCTGGGACAGATTTCACTCTCACCA TCAGCAGTGTGAAGGCTGAAGACCTGGCAGTTTATTACTGTCAGCAATATTATACCTATCC ATTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAA (SEQ ID NO: 35) Heavy CDR-H1 SGYYWN (SEQ ID NO: 24) GACTACTTACTAGGT (SEQ ID NO: 32) chain CDR-H2 YISYDGSNNYNPSLKN GATATTTACCCTGGAGGTACTTATATTAAGTA variable (SEQ ID NO: 25) CAATGAGAAGTTCAAGGGC (SEQ ID NO: 33) region CDR-H3 GADYYGNTYFYFDV GGGAGGAACGACGAGAAGGGGGACTAC (VH) (SEQ ID NO: 26) (SEQ ID NO: 34) Full (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) DVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNP SLKNRISITRDTYKKQFFLKLNSVTTEDTATYYCARGADYYGNTYFYFDVWGAGTTVTVSS (SEQ ID NO: 28) GATGTACAGCTTCAGGAGTCAGGACCTGGCCTCGTGAAACCTTCTCAGTCTCTGTCTCTC ACCTGCTCTGTCACTGGCTACTCCATCACCAGTGGTTATTACTGGAACTGGATCCGGCAGT TTCCAGGAAACAAACTGGAATGGATGGGCTACATAAGCTACGACGGTAGCAATAACTACA ACCCATCTCTCAAAAATCGAATCTCCATCACTCGTGACACATATAAGAAGCAGTTTTTCCT GAAGTTGAATTCTGTGACTACTGAGGACACAGCCACATATTACTGTGCAAGGGGGGCTGA TTACTACGGTAATACCTACTTCTACTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTC TCCTCA (SEQ ID NO: 36)

    [0226] The prepared monoclonal antibody 44C7C8 exhibited higher absorbance in the acetylated peptide of GCPFTSacFSVPD (SEQ ID NO: 4) compared to a non-acetylated control peptide used as an epitope sequence (FIG. 4A).

    [0227] In addition, the present inventors induced a mutation to replace serine 565 residue of COX2 with alanine in human-derived microglia, and confirmed whether the prepared monoclonal antibody 44C7C8 specifically detected acetylated S565 in COX2. As a result, as illustrated in FIG. 4B, it was confirmed that the absorbance detected by the monoclonal antibody 44C7C8 prepared in S565-mutated microglia (S565A) was reduced compared to normal human-derived microglia. These results indicated that the prepared monoclonal antibody 44C7C8 specifically detected a region of GCPFTSacFSVPD including S565 residue acetylated in COX2. It was confirmed that the prepared monoclonal antibody 44C7C8 specifically detected S565 residue acetylated in COX2 using an epitope consisting of a shorter amino acid sequence than the monoclonal antibody 9F7-2 prepared in FIG. 1.

    [0228] 5. Confirmation of Reduction of S565 Acetylation of COX2 Detected by Antibody 44C7C8 in Blood Cells and Brain Tissue of Alzheimer's Animal Model

    [0229] The present inventors confirmed the degree of COX2 S565 acetylation in blood cells of an Alzheimer's animal model using the prepared monoclonal antibody 44C7C8. As a result, it was confirmed that the COX2 S565 acetylation detected by the prepared monoclonal antibody 44C7C8 in the blood cells of 1, 3, and 6-month-old Alzheimer's animals was reduced compared to a control (FIG. 5A).

    [0230] The present inventors reconfirmed the degree of COX2 S565 acetylation in microglia of the brain tissue of an Alzheimer's animal model using the prepared monoclonal antibody 44C7C8. As a result, it was confirmed that the COX2 S565 acetylation detected by the prepared monoclonal antibody 44C7C8 was reduced in the microglia of Alzheimer's animals compared to the control, like the blood cell results of FIG. 5A (FIG. 5B).

    [0231] Therefore, these results confirmed that S565 acetylation was reduced in a region of GCPFTSacFSVPD (SEQ ID NO: 4) of COX2, which was detected by the prepared monoclonal antibody 44C7C8 in blood cells and microglia of the Alzheimer's animal model.

    [0232] 6. Confirmation of Reduction of S565 Acetylation of COX2 Detected by Antibody 44C7C8 in Blood Cells and Brain Tissue of Alzheimer's Patient

    [0233] The present inventors confirmed the degree of COX2 S565 acetylation in blood cells of an Alzheimer's patient using the prepared monoclonal antibody 44C7C8. As a result, it was confirmed that the COX2 S565 acetylation detected by the prepared monoclonal antibody 44C7C8 in the blood cells of the Alzheimer's patient was reduced compared to a control (FIG. 6A).

    [0234] In addition, the present inventors reconfirmed the degree of COX2 S565 acetylation in microglia of the brain tissue of the Alzheimer's patient using the prepared monoclonal antibody 44C7C8. As a result, it was confirmed that the COX2 S565 acetylation detected by the prepared monoclonal antibody 44C7C8 was reduced in the microglia of the Alzheimer's patient compared to the control, like the blood cell results of FIG. 6A (FIG. 6B).

    [0235] Therefore, these results confirmed that S565 acetylation was reduced in a region of GCPFTSacFSVPD (SEQ ID NO: 4) of COX2, which was detected by the prepared monoclonal antibody 44C7C8 in blood cells and microglia of the Alzheimer's patient.

    [0236] Through the results, it was confirmed that the degree of S565 acetylation of COX2 protein detected by the monoclonal antibody 44C7F5 in blood cells and microglia of the Alzheimer's patient was significantly reduced, and it was confirmed that the ratio of the S565 acetylated COX2 protein to the total COX2 protein in the microglia of the brain tissue of the Alzheimer's patient was significantly low as compared with the control. The result coincided with the Alzheimer's animal result of FIG. 5 and suggested the applicability of the ratio of the S565 acetylated COX2 protein to the total COX2 protein as a diagnostic marker for neurodegenerative diseases.

    INDUSTRIAL APPLICABILITY

    [0237] According to the present invention, an antibody or a functional fragment thereof specifically binds to an acetylated residue of COX2 protein and thus can be very effectively used for diagnosing neurodegenerative diseases, inflammatory diseases, and the like in which the degree of acetylation of S565 residue of the COX2 protein is reduced.