MULTISPECIFIC ANTI-CLAUDIN-18.2 CONSTRUCTS AND USES THEREOF
20230125301 · 2023-04-27
Assignee
Inventors
- Zhongdao LI (Nanjing, CN)
- Liusong Yin (Nanjing, CN)
- Tielin Zhou (Singapore, SG)
- Zhuo Fang (Nanjing, CN)
- Yi Jin (Nanjing, CN)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/64
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/732
CHEMISTRY; METALLURGY
International classification
Abstract
The present application provides multispecific constructs that bind to Claudin-18.2 (such as various anti-Claudin-18.2×anti-PD-L1 bispecific antibodies), nucleic acids encoding the multispecific construct or a portion thereof, vectors comprising the nucleic acids, host cells containing the vectors, methods of preparing the multispecific constructs, pharmaceutical compositions comprising any of the multispecific constructs, and methods of using the multispecific constructs or compositions.
Claims
1. A multispecific construct comprising a) a first antibody moiety that specifically binds to claudin-18 isoform 2 (“CLDN18.2”); and b) a second antibody moiety that specifically binds to PD-L1; wherein the first antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains; and wherein the second antibody moiety comprises a single-domain antibody that binds to PD-L1.
2.-3. (canceled)
4. The multispecific construct of claim 1, wherein the second antibody moiety is fused to the one or two heavy chains of the full-length antibody; or the second antibody moiety is fused to the one or two light chains of the full-length antibody.
5. The multispecific construct of claim 4, wherein: (1) the second antibody moiety is fused to the N-terminus of the one or two heavy chains of the full-length antibody; (2) the second antibody moiety is fused to the C-terminus of the one or two heavy chains of the full-length antibody; (3) the second antibody moiety is fused to the N-terminus of the one or two light chains of the full-length antibody: or (4) the second antibody moiety is fused to the C-terminus of the one or two light chains of the full-length antibody.
6.-9. (canceled)
10. The multispecific construct of claim 4, wherein the second antibody moiety is fused to the full-length antibody via a linker.
11. The multispecific construct of claim 10, wherein the linker is a peptide linker.
12.-14. (canceled)
15. The multispecific construct of claim 10, wherein the linker is a GS linker or comprises a modified sequence derived from the hinge region of an IgG.
16. (canceled)
17. The multispecific construct of claim 10, wherein the linker has an amino acid sequence selected from the group consisting of SEQ ID NOs: 72-80.
18.-20. (canceled)
21. The multispecific construct of claim 1, wherein the first antibody moiety comprises a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6.
22. The multispecific construct of claim 21, wherein the V.sub.H comprises the amino acid sequence of SEQ ID NO: 7, or a variant thereof having at least about 80% sequence identity to SEQ ID NO: 7; and/or the V.sub.L comprises the amino acid sequence of SEQ ID NO: 8, or a variant thereof having at least about 80% sequence identity to SEQ ID NO: 8.
23.-24. (canceled)
25. The multispecific construct of claim 1, wherein the second antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15 or 19; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, 18 or 20; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or 21.
26. The multispecific construct of the claim 25, wherein the single domain antibody comprises: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21.
27. The multispecific construct of claim 24, wherein the single domain antibody comprises the amino acid sequence of any one of SEQ ID NOs: 22-24, or a variant thereof having at least about 80% sequence identity to any one of SEQ ID NOs: 22-24.
28. The multispecific construct of claim 1, wherein: 1) the full-length antibody comprising a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6; and 2) the second antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21; wherein the second antibody moiety is fused to the full-length antibody moiety, optionally via a peptide linker having a length of about four to about twenty amino acids.
29. The multispecific construct of claim 28, wherein: 1) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 2) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 3) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 4) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78; 5) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79; 6) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 80; 7) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78; 8) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79; 9) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 80; 10) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 11) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 12) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 13) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72; 14) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78; 15) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79; 16) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78; 17) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79; 18) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 73; 19) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 74; 20) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 75; 21) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 76; or 22) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 77.
30. The multispecific construct of claim 4, wherein the two heavy chains of the full-length antibody fused with the second antibody moiety each comprises an amino acid sequence of any one of SEQ ID NOs: 28-36 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 28-36; and the two light chains of the full-length antibody each comprises an amino acid sequence of SEQ ID NO: 10 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of SEQ ID NO: 10.
31. (canceled)
32. The multispecific construct of claim 4, wherein the two light chains of the full-length antibody fused with the second antibody moiety each comprises an amino acid sequence of any one of SEQ ID NOs: 37-49 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 37-49; and the two heavy chains of the full-length antibody each comprises an amino acid sequence of SEQ ID NO: 9 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of SEQ ID NO: 9.
33.-34. (canceled)
35. The multispecific construct of claim 1, wherein the construct is a bispecific antibody.
36. A pharmaceutical composition comprising the construct of claim 1, and a pharmaceutical acceptable carrier.
37. A nucleic acid encoding the construct of claim 1.
38. (canceled)
39. A vector comprising the nucleic acid of claim 37.
40.-41. (canceled)
42. A method of treating a disease or condition in an individual which has a Claudin-18 aberration, comprising administering to the individual an effective amount of the multispecific construct of claim 1.
43. The method of claim 42, wherein the disease or condition is a cancer.
44. The method of claim 43, wherein the cancer is a gastric cancer or pancreatic cancer.
45.-50. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
DETAILED DESCRIPTION OF THE APPLICATION
[0040] The present application provides multispecific constructs that bind to both CLDN18.2 and PD-L1. In some embodiments, the multispecific construct is a bispecific antibody that comprises an anti-CLDN18.2 antibody moiety comprising a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6. In some embodiments, the anti-CLDN18.2 antibody moiety is a full-length antibody. In some embodiments, the multispecific construct comprises an anti-PD-L1 antibody moiety that comprises a single domain antibody that specifically binds to PD-L1. In some embodiments, the anti-PD-L1 antibody moiety is fused with one or both heavy chains and/or light chains of the anti-CLDN18.2 full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus and/or C-terminus of the one or both heavy chains and/or light chains of the anti-CLDN18.2 full-length antibody, optionally via a linker (such as a linker comprising an amino acid sequence of 72-80).
[0041] The present application provides that multispecific constructs that bind to both CLDN18.2 and PD-L1 (such as various anti-CLDN18.2/anti-PD-L1 bispecific antibodies illustrated in the Examples) exhibit advantageous technical effects such as stronger CDC and ADCC effects compared to various reference antibodies (e.g., an anti-CLDN18.2 monoclonal antibody IMAB362). For example, exemplary bispecific antibodies, CLDN18L-E-PDL1a and PDL1a-E-CLDN18L, exhibit an EC.sub.50 much lower than the ECs, exhibited by the reference antibody IMAB362 in anti-CLDN18.2 induced CDC analysis.
[0042] Also provided are compositions, kits and articles of manufacture comprising the multispecific molecules that bind to Claudin-18 (such as anti-CLDN18.2/anti-PD-L1 bispecific antibodies) described herein and methods of making thereof.
1. Definitions
[0043] The term “antibody” is used in its broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), full-length antibodies and antigen-binding fragments thereof, so long as they exhibit the desired antigen-binding activity. The term “antibody moiety” refers to a full-length antibody or an antigen-binding fragment thereof.
[0044] A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variable domains of the heavy chain and light chain may be referred to as “V.sub.H” and “V.sub.L”, respectively. The variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3). CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997: Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991). The three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of α, δ, ε, γ, and μ heavy chains, respectively. Several of the major antibody classes are divided into subclasses such as IgG1 (γ1 heavy chain), IgG2 (γ2 heavy chain), IgG3 (γ3 heavy chain), IgG4 (γ4 heavy chain), IgA1 (α1 heavy chain), or IgA2 (α2 heavy chain).
[0045] The term “antigen-binding fragment” as used herein refers to an antibody fragment including, for example, a diabody, a Fab, a Fab′, a F(ab′).sub.2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain Fv (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a single domain antibody (e.g., a camelized single domain antibody), a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds. In some embodiments, an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
[0046] “Single-chain Fv,” also abbreviated as “sFv” or “scFv,” are antibody fragments that comprise the V.sub.H and V.sub.L antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Plückthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
[0047] As used herein, the term “CDR” or “complementarity determining region” is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991); Chothia et al., J. Mol. Biol. 196:901-917 (1987); Al-Lazikani B. et al., J. Mol. Biol., 273: 927-948 (1997); MacCallum et al., J. Mol. Biol. 262:732-745 (1996); Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008); Lefranc M. P. et al., Dev. Comp. Immunol., 27: 55-77 (2003); and Honegger and Pluckthun, J. Mol. Biol., 309:657-670 (2001), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison. CDR prediction algorithms and interfaces are known in the art, including, for example, Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008); Ehrenmann F. et al., Nucleic Acids Res., 38: D301-D307 (2010); and Adolf-Bryfogle J. et al., Nucleic Acids Res., 43: D432-D438 (2015). The contents of the references cited in this paragraph are incorporated herein by reference in their entireties for use in the present application and for possible inclusion in one or more claims herein.
TABLE-US-00001 TABLE 1 CDR DEFINITIONS Kabat.sup.1 Chothia.sup.2 MacCallum.sup.3 IMGT.sup.4 AHo.sup.5 V.sub.H CDR.sub.1 31-35 26-32 30-35 27-38 25-40 V.sub.H CDR.sub.2 50-65 53-55 47-58 56-65 58-77 V.sub.H CDR.sub.3 95-102 96-101 93-101 105-117 109-137 V.sub.L CDR.sub.1 24-34 26-32 30-36 27-38 25-40 V.sub.L CDR.sub.2 50-56 50-52 46-55 56-65 58-77 V.sub.L CDR.sub.3 89-97 91-96 89-96 105-117 109-137 .sup.1Residue numbering follows the nomenclature of Kabat et al., supra .sup.2Residue numbering follows the nomenclature of Chothia et al., supra .sup.3Residue numbering follows the nomenclature of MacCallum et al., supra .sup.4Residue numbering follows the nomenclature of Lefranc et al., supra .sup.5Residue numbering follows the nomenclature of Honegger and Plückthun, supra
[0048] The expression “variable-domain residue-numbering as in Kabat” or “amino-acid-position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or hypervariable region (HVR) of the variable domain. For example, a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
[0049] Unless indicated otherwise herein, the numbering of the residues in an immunoglobulin heavy chain is that of the EU index as in Kabat et al., supra with minor modification. Briefly, we added 5 more residues in super variable loop before the heavy chain CDR1. The “EU index as in Kabat” refers to the residue numbering of the human IgG1 EU antibody.
[0050] “Framework” or “FR” residues are those variable-domain residues other than the CDR residues as herein defined.
[0051] “Humanized” forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature 321:522-525 (1986); Riechmann et at, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
[0052] A “human antibody” is an antibody that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147(1):86-95 (1991). See also van Dijk and van de Winkel, Curr. Opin. Pharmacol., 5: 368-74 (2001). Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSE™ technology). See also, for example, Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
[0053] “Percent (%) amino acid sequence identity” or “homology” with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, RC., Nucleic Acids Research 32(5):1792-1797, 2004; Edgar, RC., BMC Bioinformatics 5(1):113, 2004).
[0054] “Homologous” refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the DNA sequences ATTGCC and TATGGC share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
[0055] The term “constant domain” refers to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable domain, which contains the antigen-binding site. The constant domain contains the C.sub.H1, C.sub.H2 and C.sub.H3 domains (collectively, C.sub.H) of the heavy chain and the CHL (or C.sub.L) domain of the light chain.
[0056] The “light chains” of antibodies (immunoglobulins) from any mammalian species can be assigned to one of two clearly distinct types, called kappa (“κ”) and lambda (“λ”), based on the amino acid sequences of their constant domains.
[0057] The “CH1 domain” (also referred to as “C1” of “H1” domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
[0058] “Hinge region” is generally defined as a region in IgG corresponding to Glu216 to Pro230 of human IgG1 (Burton, Molec. Immunol. 22:161-206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgG1 sequence by placing the first and last cysteine residues forming inter-heavy chain S—S bonds in the same positions.
[0059] The “CH2 domain” of a human IgG Fc region (also referred to as “C2” domain) usually extends from about amino acid 231 to about amino acid 340. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain-domain pairing and help stabilize the CH2 domain. Burton, Molec Immunol. 22:161-206 (1985).
[0060] The “CH3 domain” (also referred to as “C2” domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).
[0061] The term “Fc region” or “fragment crystallizable region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies described herein include human IgG1, IgG2 (IgG2A, IgG2B), IgG3 and IgG4.
[0062] “Fc receptor” or “FcR” describes a receptor that binds the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcγRII receptors include FcγRIIA (an “activating receptor”) and FcγRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcγRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor FcγRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain. (See M. Daëron, Annu. Rev. Immunol. 15:203-234 (1997). FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991); Capel et al., Immunomethods 4: 25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126: 330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term “FcR” herein.
[0063] The term “epitope” as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
[0064] As used herein, a first antibody or fragment thereof “competes” for binding to a target antigen with a second antibody or fragment thereof when the first antibody or fragment thereof inhibits the target antigen binding of the second antibody of fragment thereof by at least about 50% (such as at least about any one of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody or fragment thereof, or vice versa. A high throughput process for “binning” antibodies based upon their cross-competition is described in PCT Publication No. WO 03/48731.
[0065] As use herein, the terms “specifically binds,” “specifically recognizing,” and “is specific for” refer to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules. For example, an antibody or antibody moiety that specifically recognizes a target (which can be an epitope) is an antibody or antibody moiety that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets. In some embodiments, the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA). In some embodiments, an antibody that specifically binds a target has a dissociation constant (K.sub.D) of ≤10.sup.−5 M, 10.sup.−6 M, ≤10.sup.−7 M, ≤10.sup.−8 M, ≤10.sup.−9 M, ≤10.sup.−10 M, ≤10.sup.−11 M, or ≤10.sup.−12 M. In some embodiments, an antibody specifically binds an epitope on a protein that is conserved among the protein from different species. In some embodiments, specific binding can include, but does not require exclusive binding. Binding specificity of the antibody or antigen-binding domain can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORE™-tests and peptide scans.
[0066] An “isolated” antibody (or construct) is one that has been identified, separated and/or recovered from a component of its production environment (e.g., natural or recombinant). Preferably, the isolated polypeptide is free of association with all other components from its production environment.
[0067] An “isolated” nucleic acid molecule encoding a construct, antibody, or antigen-binding fragment thereof described herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment. The isolated nucleic acid molecules encoding the polypeptides and antibodies described herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies described herein existing naturally in cells. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0068] Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
[0069] The term “vector,” as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors.”
[0070] The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
[0071] The terms “host cell,” “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, and may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
[0072] As used herein, “treatment” or “treating” is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this application, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by “treatment” is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods of the application contemplate any one or more of these aspects of treatment.
[0073] In the context of cancer, the term “treating” includes any or all of; inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden and ameliorating one or more symptoms associated with the disease.
[0074] The terms “inhibition” or “inhibit” refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To “reduce” or “inhibit” is to decrease, reduce or arrest an activity, function, and/or amount as compared to that of a reference. In certain embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 20% or greater. In another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 50% or greater. In yet another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater.
[0075] A “reference” as used herein, refers to any sample, standard, or level that is used for comparison purposes. A reference may be obtained from a healthy and/or non-diseased sample.
[0076] In some examples, a reference may be obtained from an untreated sample. In some examples, a reference is obtained from a non-diseased or non-treated sample of an individual. In some examples, a reference is obtained from one or more healthy individuals who are not the individual or patient.
[0077] As used herein, “delaying development of a disease” means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
[0078] “Preventing” as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in an individual that may be predisposed to the disease but has not yet been diagnosed with the disease.
[0079] As used herein, to “suppress” a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition. For example, an antibody which suppresses tumor growth reduces the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the antibody.
[0080] As used herein, “based upon” includes assessing, determining, or measuring the individual's characteristics as described herein (and preferably selecting an individual suitable for receiving treatment). When the status of a claudin-18 aberration is “used as a basis” for selection, assessing, measuring, or determining method of treatment as described herein, the claudin-18 aberration determined before and/or during treatment, and the status (including presence, absence, expression level, activity level and/or phosphorylation level of CLDN18.2) obtained is used by a clinician in assessing any of the following: (a) probable or likely suitability of an individual to initially receive treatment(s); (b) probable or likely unsuitability of an individual to initially receive treatment(s); (c) responsiveness to treatment; (d) probable or likely suitability of an individual to continue to receive treatment(s); (e) probable or likely unsuitability of an individual to continue to receive treatment(s); (f) adjusting dosage; or (g) predicting likelihood of clinical benefits.
[0081] The terms “subject,” “individual,” and “patient” are used interchangeably herein to refer to a mammal, including, but not limited to, human, bovine, horse, feline, canine, rodent, or primate. In some embodiments, the individual is a human.
[0082] An “effective amount” of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.
[0083] A “therapeutically effective amount” of a substance/molecule of the application, agonist or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects. A therapeutically effective amount may be delivered in one or more administrations.
[0084] The terms “pharmaceutical formulation” and “pharmaceutical composition” refer to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components which are unacceptably toxic to an individual to which the formulation would be administered. Such formulations may be sterile.
[0085] A “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to an individual. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed.
[0086] A “sterile” formulation is aseptic or essentially free from living microorganisms and their spores.
[0087] Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive or sequential administration in any order.
[0088] The term “concurrently” is used herein to refer to administration of two or more therapeutic agents, where at least part of the administration overlaps in time or where the administration of one therapeutic agent falls within a short period of time relative to administration of the other therapeutic agent. For example, the two or more therapeutic agents are administered with a time separation of no more than about 60 minutes, such as no more than about any of 30, 15, 10, 5, or 1 minutes.
[0089] The term “sequentially” is used herein to refer to administration of two or more therapeutic agents where the administration of one or more agent(s) continues after discontinuing the administration of one or more other agent(s). For example, administration of the two or more therapeutic agents are administered with a time separation of more than about 15 minutes, such as about any of 20, 30, 40, 50, or 60 minutes, 1 day, 2 days, 3 days, 1 week, 2 weeks, or 1 month, or longer.
[0090] As used herein, “in conjunction with” refers to administration of one treatment modality in addition to another treatment modality. As such, “in conjunction with” refers to administration of one treatment modality before, during or after administration of the other treatment modality to the individual.
[0091] The term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
[0092] An “article of manufacture” is any manufacture (e.g., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or disorder (e.g., cancer), or a probe for specifically detecting a biomarker described herein. In certain embodiments, the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.
[0093] It is understood that embodiments of the application described herein include “consisting” and/or “consisting essentially of” embodiments.
[0094] Reference to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X”.
[0095] As used herein, reference to “not” a value or parameter generally means and describes “other than” a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
[0096] The term “about X-Y” used herein has the same meaning as “about X to about Y.”
[0097] As used herein and in the appended claims, the singular forms “a,” “or,” and “the” include plural referents unless the context clearly dictates otherwise.
II. Multispecific Constructs
[0098] The present application provides multispecific constructs that bind to both CLDN18.2 and PD-L1. In some embodiments, the multispecific construct described herein is a bispecific antibody comprising an anti-CLDN18.2 antibody moiety and an anti-PD-L1 antibody moiety. Anti-CLDN18.2 antibody moieties and anti-PD-L1 antibody moieties can be any of those described herein.
[0099] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) that comprises an anti-CLDN18.2 antibody moiety comprising a full-length antibody specifically binds to CLDN18.2 (e.g., human CLDN18.2) and an anti-PD-L1 antibody moiety comprising a single domain antibody that binds to PD-L1 (e.g., human PD-L1), wherein the single domain antibody is fused to the N-terminus of the one or both heavy chains of the full-length antibody. In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) that comprises an anti-CLDN18.2 antibody moiety comprising a full-length antibody specifically binds to CLDN18.2 and an anti-PD-L1 antibody moiety comprising a single domain antibody that binds to PD-L1, wherein the single domain antibody is fused to the C-terminus of the one or both heavy chains of the full-length antibody. In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) that comprises an anti-CLDN18.2 antibody moiety comprising a full-length antibody specifically binds to CLDN18.2 and an anti-PD-L1 antibody moiety comprising a single domain antibody that binds to PD-L1, wherein the single domain antibody is fused to the N-terminus of the one or both light chains of the full-length antibody. In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) that comprises an anti-CLDN18.2 antibody moiety comprising a full-length antibody specifically binds to CLDN18.2 and an anti-PD-L1 antibody moiety comprising a single domain antibody that binds to PD-L1, wherein the single domain antibody is fused to the C-terminus of the one or both light chains of the full-length antibody.
[0100] In some embodiments, there is provided a multispecific construct (e.g., a bispecific antibody comprising an anti-CLDN18.2 antibody moiety and an anti-PD-L1 antibody moiety, wherein the anti-CLDN18.2 antibody moiety competes for binding to CLDN18.2 with an antibody moiety comprising a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6. In some embodiments, the anti-PD-L1 antibody moiety competes for binding to PD-L1 with a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21. In some embodiments, the anti-CLDN18.2 antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the anti-PD-L1 antibody moiety is fused to the one or two light chains (e.g., the N- and/or C-terminus of the one or two light chains) of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the one or two heavy chains (e.g., the N- and/or C-terminus of the one or two heavy chains) of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77.
[0101] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety that specifically binds to CLDN18.2 (e.g., a human CLDN18.2) and an anti-PD-L1 antibody moiety that specifically binds to PD-L1 (e.g., a human PD-L1), wherein the anti-CLDN18.2 antibody moiety comprises a full-length antibody comprising a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions; wherein the anti-PD-L1 antibody moiety is fused to two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to N-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to C-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77.
[0102] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety that specifically binds to CLDN18.2 (e.g., a human CLDN18.2) and an anti-PD-L1 antibody moiety that specifically binds to PD-L1 (e.g., a human PD-L1), wherein the anti-CLDN18.2 antibody moiety comprises a full-length antibody comprising a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions; wherein the anti-PD-L1 antibody moiety is fused to two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to N-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to C-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77. In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody.
[0103] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety that specifically binds to CLDN18.2 (e.g., a human CLDN18.2) and an anti-PD-L1 antibody moiety that specifically binds to PD-L1 (e.g., a human PD-L1), wherein the anti-CLDN18.2 antibody moiety comprises a full-length antibody, and wherein the anti-PD-L1 antibody moiety comprises a single domain antibody comprising a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions. In some embodiments, the anti-PD-L1 antibody moiety is fused to two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77.
[0104] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety that specifically binds to CLDN18.2 (e.g., a human CLDN18.2) and an anti-PD-L1 antibody moiety that specifically binds to PD-L1 (e.g., a human PD-L1), wherein the anti-CLDN18.2 antibody moiety comprises a full-length antibody, and wherein the anti-PD-L1 antibody moiety comprises a single domain antibody comprising a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions. In some embodiments, the anti-PD-L1 antibody moiety is fused to two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77.
[0105] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety that specifically binds to CLDN18.2 (e.g., a human CLDN18.2) and an anti-PD-L1 antibody moiety that specifically binds to PD-L1 (e.g., a human PD-L1), wherein the anti-CLDN18.2 antibody moiety comprises a full-length antibody, and wherein the anti-PD-L1 antibody moiety comprises a single domain antibody comprising a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions. In some embodiments, the anti-PD-L1 antibody moiety is fused to two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77.
[0106] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety and an anti-PD-L1 antibody moiety, wherein the anti-CLDN18.2 antibody moiety comprises a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions; and wherein the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions. In some embodiments, the anti-PD-L1 antibody moiety is fused to two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the full-length antibody via a linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker has a length of about four to about twenty amino acids. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of selected from the group consisting of SEQ ID NOs: 72-77.
[0107] In some embodiments, there is provided a multispecific construct (e.g., bispecific antibody) comprising an anti-CLDN18.2 antibody moiety comprising a full-length antibody comprising two heavy chains and two light chains, wherein the antibody comprises a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6. In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21. In some embodiments, the anti-PD-L1 antibody moiety is fused to the anti-CLDN18.2 full-length antibody moiety, optionally via a peptide linker having a length of about four to about twenty amino acids. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 78. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 79. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 80. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 78. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 79. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 80. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 72. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 78. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 79. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 78. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 79. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 73. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 74. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 75. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 76. In some embodiments, the anti-PD-L1 antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 77.
[0108] In some embodiments, the amino acid substitutions described above are limited to “exemplary substitutions” shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to “preferred substitutions” shown in Table 2 of this application.
Anti-CLDN18.2 Antibody Moiety
[0109] The anti-CLDN18.2 antibody moieties described in the present application include any antibody moieties that specifically bind to claudin-18 isoform 2 (“CLDN18.2”). Claudin 18.2 (CLDN18.2)
[0110] Claudins area family of tight junction membrane proteins that are expressed in epithelia and endothelia and form paracellular barriers and pores that determine tight junction permeability. The term “Claudin 18” or “CLDN18” preferably refers to human CLDN18 and includes any splice variants such as CLDN 18.1 and CLDN18.2 of CLDN 18. CLDN 18.1 and CLDN18.2 differ in the N-terminal portion which comprises the first transmembrane (TM) region and loop 1, whereas the primary protein sequence of the C-terminus is identical.
[0111] Claudin 18 isoform 2 (CLDN 18.2), a splice variant of the Claudin 18 protein, is a gastric lineage antigen that is expressed on short-lived differentiated gastric epithelial cells. The expression of CLDN18.2 is typically not detectable in other healthy human tissues. However, CLDN18.2 is ectopically expressed at significant levels in a variety of human cancers, including gastroesophageal and pancreatic cancer (Sahin et al. (2008) Clin Cancer Res, 14(23): 7624-34). CLDN18.2 is also frequently detected in metastases of gastric cancer.
[0112] In some embodiments, the CLDN18.2 is a human CLDN18.2.
[0113] In some embodiments, the CLDN18.2 comprises an amino acid sequence set forth in SEQ ID NO: 99 or a variant thereof.
Exemplary Anti-CLDN18.2 Antibody Moieties
[0114] In some embodiments, the anti-CLDN18.2 antibody moiety competes for binding to CLDN18.2 with an antibody moiety comprising a) a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6.
[0115] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a heavy variable region (V.sub.H) having the sequence set forth in SEQ ID No: 7, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the sequence set forth in SEQ ID NO: 7; and b) a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a light chain variable region (V.sub.L) having the sequence set forth in SEQ ID NO: 8, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the sequence set forth in SEQ ID NO: 8.
[0116] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a heavy variable region (VH) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to a total of about 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to a total of about 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs.
[0117] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the HC-CDR1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the HC-CDR2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the HC-CDR3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the LC-CDR1, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the LC-CDR2, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the LC-CDR3.
[0118] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6.
[0119] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: the V.sub.H comprises the amino acid sequence of SEQ ID NO: 7, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 7; and/or the V.sub.L comprises the amino acid sequence of SEQ ID NO: 8, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 8.
[0120] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the full-length antibody has an Fc fragment selected from the group consisting of Fc fragments from IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the Fc fragment is selected from the group consisting of Fc fragments from IgG1, IgG2, IgG3, IgG4, and combinations and hybrids thereof. In some embodiments, the Fc fragment is an IgG1 or IgG4 Fc fragment.
[0121] In some embodiments, the Fc fragment has a reduced FcγR binding affinity as compared to a wildtype. In some embodiments, the full length antibody has an IgG4 isotype and comprises a S228P mutation and/or a L235E mutation. In some embodiment, the Fc fragment comprises an amino sequence set forth in SEQ ID NO: 97.
Anti-PD-L1 Antibody Moiety
[0122] The anti-PD-L1 antibody moieties described in the present application include any antibody moieties that specifically bind to PD-L1.
[0123] In some embodiments, the anti-PD-L1 antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the full-length antibody has an Fc fragment selected from the group consisting of Fc fragments from IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the Fc fragment is selected from the group consisting of Fc fragments from IgG1, IgG2, IgG3, IgG4, and combinations and hybrids thereof. In some embodiments, the Fc fragment is an IgG1 or IgG4 Fc fragment. In some embodiments, the Fc fragment has a reduced FcγR binding affinity as compared to a wildtype. In some embodiments, the full length antibody has an IgG4 isotype and comprises a S228P mutation and/or a L235E mutation.
[0124] In some embodiments, the anti-PD-L1 antibody moiety comprises a single-domain antibody that binds to PD-L1. In some embodiments, the PD-L1 is a human PD-L1.
Exemplary Anti-PD-L1 Antibody Moieties
[0125] In some embodiments, the anti-PD-L1 antibody moiety competes for binding to PD-L1 with an antibody moiety comprising a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15 or 19; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, 18 or 20; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or 21. In some embodiments, the single domain antibody comprises a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21.
[0126] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising a sdAb-CDR1, a sdAb-CDR2, and a sdAb-CDR3, respectively comprising the amino acid sequence of a CDR1, a CDR2, and a CDR3 within a single monomeric variable antibody domain having the amino acid sequence set forth in any of SEQ ID NOs: 22-24, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90°/c, 95%, 96%, 97%, 98%, or 99%) sequence identity to the sequence set forth in any one of SEQ ID NO: 22-24.
[0127] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15 or 19, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, 18 or 20, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or 21, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3.
[0128] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3.
[0129] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3.
[0130] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR1; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR2; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 3 (such as any of about 1, 2, 3) amino acid substitutions in the sdAb-CDR3.
[0131] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21.
[0132] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising the amino acid sequence of any one of SEQ ID NOs: 22-24, or a variant thereof having at least about 80% (including for example at least about any of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 22-24.
Antibody Moieties (e.g., Anti-CLDN18.2 or Anti-PD-L1 Antibody Moiety) in the Construct
[0133] The antibody moieties described herein (such as anti-CLDN18.2 antibody moiety or anti-PD-L1 antibody moiety) can have any one or more of the features described below.
[0134] In some embodiments, the antibody moiety comprises an Fc fragment. In some embodiments, the antibody moiety comprises a scFv. In some embodiments the antibody moiety comprises a scFv fused to an Fc fragment. In some embodiments, the antibody moiety comprises a scFv fused to an Fc fragment via a peptide linker. In some embodiments, the Fc fragment is a human IgG1 Fc fragment. In some embodiments, the Fc fragment comprises one or more mutations to increase clearance or decrease half-life.
[0135] In some embodiments, the Fc fragment comprises an immunoglobulin IgG heavy chain constant region comprising a hinge region (starting at Cys226), an IgG CH2 domain and CH3 domain. The term “hinge region” or “hinge sequence” as used herein refers to the amino acid sequence located between the linker and the CH2 domain. In some embodiments, the fusion protein comprises an Fc fragment comprising a hinge region. In some embodiments, the Fc fragment of the fusion protein starts at the hinge region and extends to the C-terminus of the IgG heavy chain. In some embodiments, the fusion protein comprises an Fc fragment that does not comprise the hinge region.
[0136] In some embodiments, the antibody moiety comprises an Fc fragment selected from the group consisting of Fc fragments from IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the Fc fragment is derived from a human IgG. In some embodiments, the Fc fragment comprises the Fc region of human IgG1, IgG2, IgG3, IgG4, or a combination or hybrid IgG. In some embodiments, the Fc fragment is an IgG1 Fc fragment. In some embodiments, the Fc fragment comprises the CH2 and CH3 domains of IgG1. In some embodiments, the Fc fragment is an IgG4 Fc fragment. In some embodiments, the Fc fragment comprises the CH2 and CH3 domains of IgG4. IgG4 Fc is known to exhibit less effector activity than IgG1 Fc, and thus may be desirable for some applications. In some embodiments, the Fc fragment is derived from of a mouse immunoglobulin.
[0137] In some embodiments, the IgG CH2 domain starts at Ala231. In some embodiments, the CH3 domain starts at Gly341. It is understood that the C-terminus Lys residue of human IgG can be optionally absent. It is also understood that conservative amino acid substitutions of the Fc region without affecting the desired structure and/or stability of Fc is contemplated within the scope of the invention.
[0138] Heterodimerization of non-identical polypeptides in the Fc fragments of the antibody moieties can be facilitated by methods known in the art, including without limitation, heterodimerization by the knob-into-hole technology. The structure and assembly method of the knob-into-hole technology can be found in, e.g., U.S. Pat. Nos. 5,821,333, 7,642,228, US 2011/0287009 and PCT/US2012/059810, hereby incorporated by reference in their entireties. This technology was developed by introducing a “knob” (or a protuberance) by replacing a small amino acid residue with a large one in the CH3 domain of one Fc and introducing a “hole” (or a cavity) in the CH3 domain of the other Fc by replacing one or more large amino acid residues with smaller ones. In some embodiments, one chain of the Fc fragment in the fusion protein comprises a knob, and the second chain of the Fc fragment comprises a hole.
[0139] The preferred residues for the formation of a knob are generally naturally occurring amino acid residues and are preferably selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W). Most preferred are tryptophan and tyrosine. In one embodiment, the original residue for the formation of the knob has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine. Exemplary amino acid substitutions in the CH3 domain for forming the knob include without limitation the T366W, T366Y or F405W substitution.
[0140] The preferred residues for the formation of a hole are usually naturally occurring amino acid residues and are preferably selected from alanine (A), serine (S), threonine (T) and valine (V). In one embodiment, the original residue for the formation of the hole has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan. Exemplary amino acid substitutions in the CH3 domain for generating the hole include without limitation the T366S, L368A, F405A, Y407A, Y407T and Y407V substitutions. In certain embodiments, the knob comprises T366W substitution, and the hole comprises the T366S/L368A/Y407V substitutions. It is understood that other modifications to the Fc region known in the art that facilitate heterodimerization are also contemplated and encompassed by the instant application.
[0141] Other antibody moiety variants comprises any of the variants described herein (e.g., Fc variants, effector function variants, glycosylation variants, cysteine engineered variants), or combinations thereof, are contemplated.
[0142] a) Antibody Affinity
[0143] Binding specificity of the antibody moieties can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BIACORE™-tests and peptide scans.
[0144] In some embodiments, the K.sub.D of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is about 10.sup.−7 M to about 10.sup.−12 M, about 10.sup.−7 M to about 10.sup.−8 M, about 10.sup.−8 M to about 10.sup.−9 M, about 10.sup.−9 M to about 10.sup.−10 M, about 10.sup.−10 M to about 10.sup.−11 M, about 10.sup.−11 M to about 10.sup.−12 M, about 10.sup.−7 M to about 10.sup.−12 M, about 10.sup.−8 M to about 10.sup.−12 M, about 10.sup.−9 M to about 10.sup.−12 M, about 10.sup.−10 M to about 10.sup.−12 M, about 10.sup.−7 M to about 10.sup.−11 M, about 10.sup.−8 M to about 10.sup.−11 M, about 10.sup.−9 M to about 10.sup.−11 M, about 10.sup.−7 M to about 10.sup.−10 M, about 10.sup.−8 M to about 10.sup.−10 M, or about 10.sup.−7 M to about 10.sup.−9 M. In some embodiments, the K.sub.D of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is stronger than about any one of 10.sup.−7 M, 10.sup.−8 M, 10.sup.−9 M, 10.sup.−10 M, 10.sup.−11 M, or 10.sup.−12 M. In some embodiments, the target antigen (e.g., CLDN18.2 or PD-L1) is a human antigen.
[0145] In some embodiments, the K.sub.on of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is about 10.sup.3 M.sup.−1s.sup.−1 to about 10.sup.8 M.sup.−1s.sup.−1, about 10.sup.3 M.sup.−1s.sup.−1 to about 10.sup.4 M.sup.−1s.sup.−1, about 10.sup.4 M.sup.−1s.sup.−1 to about 10.sup.5 M.sup.−1s.sup.−1, about 10.sup.5 M.sup.−1s.sup.−1 to about 10.sup.6 M.sup.−1s.sup.−1, about 10.sup.6 M.sup.−1s.sup.−1 to about 10.sup.7 M.sup.−1s.sup.−1, or about 10.sup.7 M.sup.−1s.sup.−1 to about 10.sup.8 M.sup.−1s.sup.−1. In some embodiments, the K.sub.on of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is about 10.sup.3 M.sup.−1s.sup.−1 to about 10.sup.5 M.sup.−1s.sup.−1, about 10.sup.4 M.sup.−1s.sup.−1 to about 10.sup.6 M.sup.−1s.sup.−1, about 10.sup.5 M.sup.−1s.sup.−1 to about 10.sup.7 M.sup.−1s.sup.−1, about 10.sup.6 M.sup.−1s.sup.−1 to about 10.sup.8 M.sup.−1s.sup.−1, about 10.sup.4 M.sup.−1s.sup.−1 to about 10.sup.7 M.sup.−1s.sup.−1, or about 10.sup.5 M.sup.−1s.sup.−1 to about 10.sup.8 M.sup.−1s.sup.−1. In some embodiments, the K.sub.on of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is no more than about any one of 10.sup.3 M.sup.−1s.sup.−1, 10.sup.4 M.sup.−1s.sup.−1, 10.sup.5 M.sup.−1s.sup.−1, 10.sup.6 M.sup.−1s.sup.−1, 10.sup.7 M.sup.−1s.sup.−1 or 10.sup.8 M.sup.−1s.sup.−1. In some embodiments, the target antigen (e.g., CLDN18.2 or PD-L1) is human antigen.
[0146] In some embodiments, the K.sub.off of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is about 1 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 1 s.sup.−1 to about 10.sup.−2 s.sup.−1, about 10.sup.−2 s.sup.−1 to about 10.sup.−3 s.sup.−1, about 10.sup.−3 s.sup.−1 to about 10.sup.−4 s.sup.−1, about 10.sup.−4 s.sup.−1 to about 10.sup.−5 s.sup.−1, about 10.sup.−5 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 1 s.sup.−1 to about 10.sup.−5 s.sup.−1, about 10.sup.−2 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 10.sup.−3 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 10.sup.−4 s.sup.−1 to about 10.sup.−6 s.sup.−1, about 10.sup.−2 s.sup.−1 to about 10.sup.−5 s.sup.−1, or about 10.sup.−3 s.sup.−1 to about 10.sup.−5 s.sup.−1. In some embodiments, the K.sub.off of the binding between the antibody moiety and the target antigen (e.g., CLDN18.2 or PD-L1) is at least about any one of 1 s.sup.−1, 10.sup.−2 s.sup.−1, 10.sup.−3 s.sup.−1, 10.sup.−4 s.sup.−1, 10.sup.−5 s.sup.−1 or 10.sup.−6 s.sup.−1. In some embodiments, the target antigen (e.g., CLDN18.2 or PD-L1) is human antigen.
[0147] b) Chimeric or Humanized Antibodies
[0148] In some embodiments, the antibody moiety is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). In some embodiments, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from mouse) and a human constant region. In some embodiments, a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
[0149] In some embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
[0150] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86:10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing “resurfacing”); Dall'Acqua et al., Methods 36:43-60 (2005) (describing “FR shuffling”); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the “guided selection” approach to FR shuffling).
[0151] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); Framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272:10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).
[0152] c) Human Antibodies
[0153] In some embodiments, the antibody moiety is a human antibody (known as human domain antibody, or human DAb). Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001), Lonberg, Curr. Opin. Immunol. 20:450-459 (2008), and Chen, Mol. Immunol. 47(4):912-21 (2010). Transgenic mice or rats capable of producing fully human single-domain antibodies (or DAb) are known in the art. See, e.g., US20090307787A1, U.S. Pat. No. 8,754,287, US20150289489A1, US20100122358A1, and WO2004049794.
[0154] Human antibodies (e.g., human DAbs) may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23:1117-1125 (2005). See also, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE™ technology; U.S. Pat. No. 5,770,429 describing H
[0155] Human antibodies (e.g., human DAbs) can also be made by hybridoma-based methods.
[0156] Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described (See, e.g., Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147: 86 (1991)). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).
[0157] Human antibodies (e.g., human DAbs) may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
[0158] d) Library-Derived Antibodies
[0159] The antibody moieties may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992): Marks and Bradbury, in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N.J., 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004): Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004). Methods for constructing single-domain antibody libraries have been described, for example, see U.S. Pat. No. 7,371,849.
[0160] In certain phage display methods, repertoires of V.sub.H and V.sub.L genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically displays antibody fragments, either as scFv fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
[0161] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
[0162] e) Substitution, Insertion, Deletion and Variants
[0163] In some embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs (or CDRs) and FRs. Conservative substitutions are shown in Table 2 under the heading of “Preferred substitutions.” More substantial changes are provided in Table 2 under the heading of “exemplary substitutions,” and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE-US-00002 TABLE 2 Amino acid substitutions Preferred Original Residue Exemplary Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gin; His; Asp, Lys; Arg Gin Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gin (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu
[0164] Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
[0165] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0166] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
[0167] Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR “hotspots,” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), and/or SDRs (a-CDRs), with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., (2001)). In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
[0168] In some embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may be outside of HVR “hotspots” or CDRs. In some embodiments of the variant V.sub.HH sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
[0169] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
[0170] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
[0171] f) Glycosylation Variants
[0172] In some embodiments, the antibody moiety is altered to increase or decrease the extent to which the construct is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
[0173] Where the antibody moiety comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in the antibody moiety may be made in order to create antibody variants with certain improved properties.
[0174] In some embodiments, the antibody moiety has a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g., complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues); however, Asn297 may also be located about ±3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to “defucosylated” or “fucose-deficient” antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Patent Application No. US 2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Adams et al., especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
[0175] In some embodiments, the antibody moiety has bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al.); U.S. Pat. No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al.). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
[0176] g) Fc Region Variants
[0177] In some embodiments, one or more amino acid modifications may be introduced into the Fc region of the antibody moiety, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
[0178] In some embodiments, the Fc fragment possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody moiety in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcγR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII. FcR expression on hematopoietic cells is summarized in Table 2 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat'l Acad. Sci. USA 82:1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, Wis.). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat'l Acad. Sci. USA 95:652-656 (1998). C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg, M. S. et al., Blood 101:1045-1052 (2003); and Cragg, M. S. and M. J. Glennie, Blood 103:2738-2743 (2004)). FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int'l. Immunol. 18(12):1759-1769 (2006)).
[0179] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
[0180] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312, and Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001).)
[0181] In some embodiments, the Fc fragment is an IgG1 Fc fragment. In some embodiments, the IgG1 Fc fragment comprises a L234A mutation and/or a L235A mutation. In some embodiments, the Fc fragment is an IgG2 or IgG4 Fc fragment. In some embodiments, the Fc fragment is an IgG4 Fc fragment comprising a S228P, F234A, and/or a L235A mutation.
[0182] In some embodiments, the antibody moiety comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
[0183] In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
[0184] In some embodiments, the antibody moiety variant comprising a variant Fc region comprising one or more amino acid substitutions which alters half-life and/or changes binding to the neonatal Fc receptor (FcRn). Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which alters binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
[0185] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Pat. Nos. 5,648,260; 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
[0186] h) Cysteine Engineered Antibody Variants
[0187] In some embodiments, it may be desirable to create cysteine engineered antibody moieties, e.g., “thioMAbs,” in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In some embodiments, any one or more of the following residues may be substituted with cysteine: A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibody moieties may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
[0188] i) Antibody Derivatives
[0189] In some embodiments, the antibody moiety described herein may be further modified to comprise additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in diagnosis under defined conditions, etc.
[0190] In some embodiments, the antibody moiety may be further modified to comprise one or more biologically active protein, polypeptides or fragments thereof. “Bioactive” or “biologically active”, as used herein interchangeably, means showing biological activity in the body to carry out a specific function. For example, it may mean the combination with a particular biomolecule such as protein, DNA, etc., and then promotion or inhibition of the activity of such biomolecule. In some embodiments, the bioactive protein or fragments thereof include proteins and polypeptides that are administered to patients as the active drug substance for prevention of or treatment of a disease or condition, as well as proteins and polypeptides that are used for diagnostic purposes, such as enzymes used in diagnostic tests or in vitro assays, as well as proteins and polypeptides that are administered to a patient to prevent a disease such as a vaccine.
[0191] Form of the Multispecific Constructs
[0192] Multispecific constructs described herein can have any form as far as the construct maintains its function of binding to both CLDN18.2 and PD-L1.
[0193] In some embodiments, the CLDN18.2 antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the anti-PD-L1 antibody moiety is fused to the one or two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to N-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to C-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the one or two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the C-terminus of the one or two light chains of the full-length antibody.
[0194] In some embodiments, the anti-PD-L1 antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to the one or two heavy chains of the full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to N-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to C-terminus of the one or two heavy chains of the full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to the one or two light chains of the full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to the N-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to the C-terminus of the one or two light chains of the full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is a scFv antibody such as a scFv antibody comprising a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6.
[0195] In some embodiments, both anti-PD-L1 antibody moiety and anti-CLDN18.2 antibody moiety comprise a full-length antibody.
[0196] In some embodiments, neither anti-PD-L1 antibody moiety nor anti-CLDN18.2 antibody moiety comprise a full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody or single chain fragment variable (scFv) antibody. In some embodiments, the anti-CLDN18.2 antibody moiety comprises a single domain antibody or single chain fragment variable (scFv) antibody. In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody such as any of those described herein. In some embodiments, the anti-PD-L1 antibody moiety and anti-CLDN18.2 are fused together via a linker described herein.
Linkers
[0197] In some embodiments, the multispecific constructs described herein comprise one or more linkers between two moieties (e.g., the anti-CLDN18.2 antibody moiety and the anti-PD-L1 antibody moiety described above). The length, the degree of flexibility and/or other properties of the linker(s) used in the bispecific antibodies may have some influence on properties, including but not limited to the affinity, specificity or avidity for one or more particular antigens or epitopes. For example, longer linkers may be selected to ensure that two adjacent domains do not sterically interfere with one another. In some embodiment, a linker (such as peptide linker) comprises flexible residues (such as glycine and serine) so that the adjacent domains are free to move relative to each other. For example, a glycine-serine doublet can be a suitable peptide linker. In some embodiments, the linker is a non-peptide linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker is a cleavable linker.
[0198] Other linker considerations include the effect on physical or pharmacokinetic properties of the resulting compound, such as solubility, lipophilicity, hydrophilicity, hydrophobicity, stability (more or less stable as well as planned degradation), rigidity, flexibility, immunogenicity, modulation of antibody binding, the ability to be incorporated into a micelle or liposome, and the like.
[0199] In some embodiments, the anti-CLDN18.2 antibody moiety comprises a full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety (such as a single domain antibody) is fused to the full length antibody via a linker.
[0200] In some embodiments, the anti-PD-L1 antibody moiety comprises a full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety is fused to the full length antibody via a linker.
[0201] In some embodiments, the linker is a peptide linker as described below. In some embodiments, the peptide linker has a length of about one to about fifty, about two to about fourth, about three to about thirty, or about four to about twenty amino acids.
[0202] In some embodiments, the linker is a cleavable linker. In some embodiments, the linker is a non-cleavable linker.
[0203] In some embodiments, the linker is a GS linker.
[0204] In some embodiments, the linker comprises an amino acid sequence of any one of SEQ ID NOs: 72-80 and 90-96. In some embodiments, the linker comprises an amino acid sequence of any one of SEQ ID NOs: 72-80. In some embodiments, the linker comprises an amino acid sequence of any one of SEQ ID NOs: 72-77.
Peptide Linkers
[0205] The peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence. For example, a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker. See, for example, WO1996/34103.
[0206] The peptide linker can be of any suitable length. In some embodiments, the peptide linker is at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 75, 100 or more amino acids long. In some embodiments, the peptide linker is no more than about any of 100, 75, 50, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5 or fewer amino acids long. In some embodiments, the length of the peptide linker is any of about 1 amino acid to about 10 amino acids, about 1 amino acid to about 20 amino acids, about 1 amino acid to about 30 amino acids, about 5 amino acids to about 15 amino acids, about 10 amino acids to about 25 amino acids, about 5 amino acids to about 30 amino acids, about 10 amino acids to about 30 amino acids long, about 30 amino acids to about 50 amino acids, about 50 amino acids to about 100 amino acids, or about 1 amino acid to about 100 amino acids.
[0207] An essential technical feature of such peptide linker is that said peptide linker does not comprise any polymerization activity. The characteristics of a peptide linker, which comprise the absence of the promotion of secondary structures, are known in the art and described, e.g., in Dall'Acqua et al. (Biochem. (1998) 37, 9266-9273), Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9(1), 73-80). A particularly preferred amino acid in context of the “peptide linker” is Gly. Furthermore, peptide linkers that also do not promote any secondary structures are preferred. The linkage of the domains to each other can be provided by, e.g., genetic engineering. Methods for preparing fused and operatively linked bispecific single chain constructs and expressing them in mammalian cells or bacteria are well-known in the art (e.g. WO 99/54440, Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y. 1989 and 1994 or Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y., 2001).
[0208] The peptide linker can be a stable linker, which is not cleavable by proteases, especially by Matrix metalloproteinases (MMPs).
[0209] The linker can also be a flexible linker. Exemplary flexible linkers include glycine polymers (G).sub.n (SEQ ID NO: 93), glycine-serine polymers (including, for example, (GS).sub.n (SEQ ID NO: 94), (GSGGS).sub.n (SEQ ID NO: 95), (GGGGS).sub.n (SEQ ID NO: 90), and (GGGS).sub.n (SEQ ID NO: 96, where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11 173-142 (1992)). The ordinarily skilled artisan will recognize that design of an antibody fusion protein can include linkers that are all or partially flexible, such that the linker can include a flexible linker portion as well as one or more portions that confer less flexible structure to provide a desired antibody fusion protein structure. In some embodiments, the linker is a GS linker. In some embodiments, the linker has an amino acid sequence selected from the group consisting of SEQ ID NOs: 78-80.
[0210] In some embodiments, the peptide linker comprises the hinge region of an IgG, such as the hinge region of human IgG1. In some embodiments, the peptide linker comprises a modified sequence derived from the hinge region of an IgG, such as the hinge region of human IgG1. In some embodiments, the linker has an amino acid sequence selected from the group consisting of SEQ ID NOs: 72-77.
[0211] In some embodiments, the anti-CLDN18.2 antibody moiety and the anti-PD-L1 antibody moiety are linked together by a linker of sufficient length to enable the anti-CLDN18.2 and anti-PD-L1 antigen binding domain to fold in such a way as to permit binding to CLDN18.2 and PD-L1. Exemplary linkers include for example, any of the sequences set forth in SEQ ID NOs: 72-80. In some embodiments, the linker has the amino acid sequence of (GGGGS).sub.n (SEQ ID NO: 90), wherein n is an integer between 1 and 8, e.g. (GGGGS).sub.3 (SEQ ID NO: 79; hereinafter referred to as “(G.sub.4S)3” or “GS3”), or (GGGGS).sub.6 (SEQ ID NO: 91; hereinafter referred to as “(G.sub.4S)6” or “GS6”). In some embodiments, the peptide linker comprise the amino acid sequence of (GSTSGSGKPGSGEGS).sub.n (SEQ ID NO: 92), wherein n is an integer between 1 and 3. In some embodiments, the peptide linker comprises the amino acid sequence of ERKSSVESPPSP (SEQ ID NO: 74). In some embodiments, the peptide linker comprises the amino acid sequence of ESKYGPPSPPSP (SEQ ID NO: 76).
Non-Peptide Linkers
[0212] Coupling of two moieties may be accomplished by any chemical reaction that will bind the two molecules so long as both components retain their respective activities, e.g., binding to anti-CLDN18.2 and anti-PD-L1, respectively. This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation. In some embodiments, the binding is covalent binding. Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents may be useful in coupling protein molecules in this context. For example, representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines. This listing is not intended to be exhaustive of the various classes of coupling agents known in the art but, rather, is exemplary of the more common coupling agents (see Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984); Jansen et al., Immunological Reviews 62:185-216 (1982); and Vitetta et al., Science 238:1098 (1987)).
[0213] Linkers the can be applied in the present application are described in the literature (see, for example, Ramakrishnan, S. et al., Cancer Res. 44:201-208 (1984) describing use of MBS (M-maleimidobenzoyl-N-hydroxysuccinimide ester). In some embodiments, non-peptide linkers used herein include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2-pyridyldithio) propionamido] hexanoate (Pierce Chem. Co., Cat #21651G); (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6 [3-(2-pyridyldithio)-propianamide] hexanoate (Pierce Chem. Co. Cat. #2165-G); and (v) sulfo-NHS (N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510) conjugated to EDC.
[0214] The linkers described above contain components that have different attributes, thus may lead to bispecific antibodies with differing physio-chemical properties. For example, sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NHS-ester containing linkers are less soluble than sulfo-NHS esters. Further, the linker SMPT contains a sterically hindered disulfide bond, and can form antibody fusion protein with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less antibody fusion protein available. Sulfo-NHS, in particular, can enhance the stability of carbodimide couplings. Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
Nucleic Acids
[0215] Nucleic acid molecules encoding the multispecific constructs or various antibody moieties described herein are also contemplated. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding one or more polypeptides of the multispecific constructs or various antibody moieties. In some embodiments, there is provided a nucleic acid (or a set of nucleic acids) encoding a multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody), or polypeptide portion thereof.
[0216] Also contemplated here are isolated host cell comprising a multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody), an isolated nucleic acid encoding the polypeptide components of the multispecific construct, or a vector comprising a nucleic acid encoding the polypeptide components of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) described herein.
[0217] The present application also includes variants to these nucleic acid sequences. For example, the variants include nucleotide sequences that hybridize to the nucleic acid sequences encoding the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) or various antibody moieties described herein under at least moderately stringent hybridization conditions.
[0218] The present application also provides vectors in which a nucleic acid of the present application is inserted.
[0219] The nucleic acids of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties. In some embodiments, the invention provides a gene therapy vector.
[0220] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[0221] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
III. Methods of Preparation
[0222] In some embodiments, there is provided a method of preparing a multispecific construct (e.g., multispecific construct that binds to both CLDN18.2 and PD-L1) and a composition such as polynucleotide, nucleic acid construct, vector, host cell, or culture medium that is produced during the preparation of the multispecific construct. The multispecific construct or composition described herein may be prepared by a number of processes as generally described below and more specifically in the Examples.
Antibody Expression and Production
[0223] The antibody moieties (including anti-CLDN18.2 monoclonal antibodies, anti-PD-L1 single domain antibodies, or bispecific antibodies) described herein can be prepared using any known methods in the art, including those described below and in the Examples.
Monoclonal Antibodies
[0224] Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translational modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Thus, the modifier “monoclonal” indicates the character of the antibody as not being a mixture of discrete antibodies. For example, the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), or may be made by recombinant DNA methods (U.S. Pat. No. 4,816,567). In the hybridoma method, a mouse or other appropriate host animal, such as a hamster or a llama, is immunized as hereinabove described to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986). Also see Example 1 for immunization in Camels.
[0225] The immunizing agent will typically include the antigenic protein or a fusion variant thereof. Generally, either peripheral blood lymphocytes (“PBLs”) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. Goding, Monoclonal Antibodies: Principles and Practice, Academic Press (1986), pp. 59-103.
[0226] Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which are substances that prevent the growth of HGPRT-deficient cells.
[0227] Preferred immortalized myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, preferred are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 cells (and derivatives thereof, e.g., X63-Ag8-653) available from the American Type Culture Collection, Manassas, Va. USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
[0228] Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).
[0229] The culture medium in which the hybridoma cells are cultured can be assayed for the presence of monoclonal antibodies directed against the desired antigen. Preferably, the binding affinity and specificity of the monoclonal antibody can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked assay (ELISA). Such techniques and assays are known in the in art. For example, binding affinity may be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
[0230] After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, supra). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as tumors in a mammal.
[0231] The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
[0232] Monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567, and as described above. DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, in order to synthesize monoclonal antibodies in such recombinant host cells. Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr. Opinion in Immunol., 5:256-262 (1993) and Pluckthun, Immunol. Revs. 130:151-188 (1992).
[0233] In a further embodiment, antibodies can be isolated from antibody phage libraries generated using the techniques described in McCafferty et al., Nature, 348:552-554 (1990). Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio/Technology, 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nucl. Acids Res., 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.
[0234] The DNA also may be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison, et al., Proc. Natl Acad. Sci. USA, 81:6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Typically, such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.
[0235] The monoclonal antibodies described herein may by monovalent, the preparation of which is well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and a modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues may be substituted with another amino acid residue or are deleted so as to prevent crosslinking. In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly Fab fragments, can be accomplished using routine techniques known in the art.
[0236] Chimeric or hybrid antibodies also may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins may be constructed using a disulfide-exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
Bispecific Antibodies
[0237] Also provided here are methods of preparing the bispecific antibodies described herein. The bispecific antibodies can be prepared using any methods known in the art or as described herein (such as in Example 1).
[0238] Methods of preparing bispecific antibodies of the present application include those described in WO 2008119353 (Genmab), WO 2011131746 (Genmab) and reported by van der Neut-Kolfschoten et al. (Science. 2007 Sep. 14; 317(5844): 1554-7). Examples of other platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics), Fcab and Mab2 (F-star), Fc-engineered IgG1 (Xencor) or DuoBody (based on Fab arm exchange, Genmab, this application, described below).
[0239] Traditional methods such as the hybrid hybridoma and chemical conjugation methods (Marvin and Zhu (2005) Acta Pharmacol Sin 26: 649) can also be used. Co-expression in a host cell of two components (such as a polypeptides as illustrated in Table 3) leads to a mixture of possible antibody products in addition to the desired bispecific antibody, which can then be isolated by, e.g., affinity chromatography or similar methods.
Nucleic Acid Molecules Encoding Antibody Moieties
[0240] In some embodiments, there is provided a polynucleotide encoding any one of the multispecific constructs or antibody moieties described herein. In some embodiments, there is provided a polynucleotide prepared using any one of the methods as described herein. In some embodiments, a nucleic acid molecule comprises a polynucleotide that encodes a heavy chain or a light chain of an antibody moiety (e.g., anti-CLDN18.2 antibody moiety). In some embodiments, a nucleic acid molecule comprises both a polynucleotide that encodes a heavy chain and a polynucleotide that encodes a light chain, of an antibody moiety (e.g., anti-CLDN18.2 antibody moiety). In some embodiments, a first nucleic acid molecule comprises a first polynucleotide that encodes a heavy chain and a second nucleic acid molecule comprises a second polynucleotide that encodes a light chain.
[0241] In some embodiments, the heavy chain and the light chain are expressed from one nucleic acid molecule, or from two separate nucleic acid molecules, as two separate polypeptides. In some embodiments, a single polynucleotide encodes a single polypeptide comprising both a heavy chain and a light chain linked together.
[0242] In some embodiments, a polynucleotide encoding a heavy chain or light chain of an antibody moiety (e.g., anti-CLDN18.2 antibody moiety) comprises a nucleotide sequence that encodes a leader sequence, which, when translated, is located at the N terminus of the heavy chain or light chain. As discussed above, the leader sequence may be the native heavy or light chain leader sequence, or may be another heterologous leader sequence.
[0243] In some embodiments, the polynucleotide is a DNA. In some embodiments, the polynucleotide is an RNA. In some embodiments, the RNA is an mRNA. In some embodiments, the polynucleotide comprises a nucleic acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to the nucleic acid sequence of any one of SEQ ID Nos: 50-71.
[0244] Nucleic acid molecules may be constructed using recombinant DNA techniques conventional in the art. In some embodiments, a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell.
Nucleic Acid Construct
[0245] In some embodiments, there is provided a nucleic acid construct comprising any one of the polynucleotides described herein. In some embodiments, there is provided a nucleic acid construct prepared using any method described herein.
[0246] In some embodiments, the nucleic acid construct further comprises a promoter operably linked to the polynucleotide. In some embodiments, the polynucleotide corresponds to a gene, wherein the promoter is a wild-type promoter for the gene.
Vectors
[0247] In some embodiments, there is provided a vector comprising any polynucleotides that encode any of the antibody moieties or multispecific constructs described herein or nucleic acid construct described herein. In some embodiments, there is provided a vector prepared using any method described herein. Vectors comprising polynucleotides that encode any of the antibody moieties or multispecific constructs (such as anti-CLDN18.2/anti-PD-L1 bispecific antibodies) described herein are also provided. Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc. In some embodiments, a vector comprises a) a first polynucleotide sequence encoding a heavy chain or a light chain of an anti-CLDN18.2 full-length antibody fused with a single chain antibody that binds to PD-L1, and b) a second polynucleotide sequence encoding a light chain or a heavy chain of an anti-CLDN18.2 full-length antibody that pairs with the first nucleotide. In some embodiments, the first vector and second vector are transfected into host cells in similar amounts (such as similar molar amounts or similar mass amounts). In some embodiments, a mole- or mass-ratio of between 5:1 and 1:5 of the first vector and the second vector is transfected into host cells. In some embodiments, a mass ratio of between 1:1 and 1:5 for the vector encoding the heavy chain and the vector encoding the light chain is used. In some embodiments, a mass ratio of 1:2 for the vector encoding the heavy chain and the vector encoding the light chain is used.
[0248] In some embodiments, a vector is selected that is optimized for expression of polypeptides in CHO or CHO-derived cells (e.g., CHO-3E7 cells), or in NSO cells. Exemplary such vectors are described, e.g., in Running Deer et al., Biotechnol. Prog. 20:880-889 (2004).
Host Cells
[0249] In some embodiments, there is provided a host cell comprising any polypeptide, nucleic acid construct and/or vector described herein. In some embodiments, there is provided a host cell prepared using any method described herein. In some embodiments, the host cell is capable of producing any of antibody moieties or multispecific constructs described herein under a fermentation condition.
[0250] In some embodiments, the antibody moieties and multispecific constructs described herein (e.g., anti-CLDN18.2/anti-PD-L1 bispecific antibodies) may be expressed in prokaryotic cells, such as bacterial cells; or in eukaryotic cells, such as fungal cells (such as yeast), plant cells, insect cells, and mammalian cells. Such expression may be carried out, for example, according to procedures known in the art. Exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293-6E cells; CHO cells, including CHO-S, CHO-3E7, DG44. Lec13 CHO cells, and FUT8 CHO cells; PERC6® cells (Crucell); and NSO cells. In some embodiments, the antibody moieties and multispecific constructs described herein may be expressed in yeast. See, e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments, a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the heavy chains and/or light chains of the antibody moiety. For example, in some embodiments, CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293 cells.
[0251] Introduction of one or more nucleic acids into a desired host cell may be accomplished by any method, including but not limited to, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc. Non-limiting exemplary methods are described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3.sup.rd ed. Cold Spring Harbor Laboratory Press (2001). Nucleic acids may be transiently or stably transfected in the desired host cells, according to any suitable method.
[0252] The invention also provides host cells comprising any of the polynucleotides or vectors described herein. In some embodiments, the invention provides a host cell comprising a multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody). Any host cells capable of over-expressing heterologous DNAs can be used for the purpose of isolating the genes encoding the antibody, polypeptide or protein of interest. Non-limiting examples of mammalian host cells include but not limited to COS, HeLa, and CHO cells. See also PCT Publication No. WO 87/04462. Suitable non-mammalian host cells include prokaryotes (such as E. coli or B. subtillis) and yeast (such as S. cerevisae, S. pombe; or K. lactis).
[0253] In some embodiments, the antibody moiety is produced in a cell-free system. Non-limiting exemplary cell-free systems are described, e.g., in Sitaraman et al., Methods Mol. Biol. 498: 229-44 (2009); Spirin, Trends Biotechnol. 22: 538-45 (2004); Endo et al., Biotechnol. Adv. 21: 695-713 (2003).
Culture Medium
[0254] In some embodiments, there is provided a culture medium comprising any antibody moiety, polynucleotide, multispecific construct, nucleic acid construct, vector, and/or host cell described herein. In some embodiments, there is provided a culture medium prepared using any method described herein.
[0255] In some embodiments, the medium comprises hypoxanthine, aminopterin, and/or thymidine (e.g., HAT medium). In some embodiments, the medium does not comprise serum. In some embodiments, the medium comprises serum. In some embodiments, the medium is a D-MEM or RPMI-1640 medium.
Purification of Antibody Moieties
[0256] The multispecific constructs (e.g., anti-CLDN18.2/anti-PD-L1 bispecific antibodies) may be purified by any suitable method. Such methods include, but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography. Suitable affinity ligands include the ROR1 ECD and ligands that bind antibody constant regions. For example, a Protein A, Protein G, Protein A/G, or an antibody affinity column may be used to bind the constant region and to purify a multispecific construct comprising an Fc fragment. Hydrophobic interactive chromatography, for example, a butyl or phenyl column, may also suitable for purifying some polypeptides such as antibodies. Ion exchange chromatography (e.g. anion exchange chromatography and/or cation exchange chromatography) may also suitable for purifying some polypeptides such as antibodies. Mixed-mode chromatography (e.g. reversed phase/anion exchange, reversed phase/cation exchange, hydrophilic interaction/anion exchange, hydrophilic interaction/cation exchange, etc.) may also suitable for purifying some polypeptides such as antibodies. Many methods of purifying polypeptides are known in the art.
V. Methods of Treatments
[0257] Also provided here are methods of treating a disease or condition in an individual. The methods comprise administering a multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) described herein into individuals (e.g., mammals such as humans).
[0258] In some embodiments, there is provided a method of treating a disease or condition (e.g., gastric cancer) in an individual, comprising administering to the individual an effective amount of a multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) comprising a) an antibody moiety that binds to CLDN18.2 and b) an antibody moiety that binds to PD-L1. In some embodiments, the anti-CLDN18.2 antibody moiety is a full length antibody. In some embodiments, the anti-PD-L1 antibody moiety is a single domain antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus and/or C-terminus of the one or both heavy chains of the anti-CLDN18.2 full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus and/or C-terminus of the one or both light chains of the anti-CLDN18.2 full-length antibody. In some embodiments, the anti-CLDN18.2 antibody moiety competes for binding to CLDN18.2 with an antibody moiety comprising a) a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the V.sub.L comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6. In some embodiments, the anti-CLDN18.2 antibody moiety comprises a) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a heavy variable region (VH) having the sequence set forth in SEQ ID NO: 7; and b) a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a light chain variable region (VL) having the sequence set forth in SEQ ID NO: 8.
[0259] In some embodiments, there is provided a method of treating a disease or condition (e.g., gastric cancer) in an individual, comprising administering to the individual an effective amount of a multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) comprising a) an antibody moiety that binds to CLDN18.2 comprising a heavy variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: a) the V.sub.H comprises: i) an HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, ii) an HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and iii) an HC-CDR3 comprising an amino acid sequence of SEQ ID NO:3, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; and b) the VL comprises: i) an LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, ii) an LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and iii) an LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, according to Kabat numbering; and b) an antibody moiety that binds to PD-L1. In some embodiments, the amino acid substitutions are limited to “exemplary substitutions” shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to “preferred substitutions” shown in Table 2 of this application. In some embodiments, the anti-CLDN18.2 antibody moiety is a full length antibody. In some embodiments, the anti-PD-L1 antibody moiety is a single domain antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus and/or C-terminus of the one or both heavy chains of the anti-CLDN18.2 full-length antibody. In some embodiments, the anti-PD-L1 antibody moiety is fused to the N-terminus and/or C-terminus of the one or both light chains of the anti-CLDN18.2 full-length antibody. In some embodiments, the V.sub.H comprises the amino acid sequence of SEQ ID NO: 7, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 7; and/or the VL comprises the amino acid sequence of SEQ ID NO: 8, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to SEQ ID NO: 8.
[0260] In some embodiments, the anti-PD-L1 antibody moiety competes for binding to PD-L1 with an antibody moiety comprising a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21.
[0261] In some embodiments, the anti-PD-L1 antibody moiety comprises a single domain antibody (sdAb) comprising a sdAb-CDR1, a sdAb-CDR2, and a sdAb-CDR3, respectively comprising the amino acid sequence of a CDR1, a CDR2, and a CDR3 within a single monomeric variable antibody domain having the amino acid sequence set forth in any of SEQ ID NOs: 22-24. In some embodiments, the anti-PD-L1 antibody moiety comprises a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, or a variant thereof comprising up to about 3 (such as 3, 2, or 1) amino acid substitutions. In some embodiments, the amino acid substitutions are limited to “exemplary substitutions” shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to “preferred substitutions” shown in Table 2 of this application. In some embodiments, the single domain antibody comprises the amino acid sequence of any one of SEQ ID NOs: 22-24, or a variant thereof having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity to any one of SEQ ID NOs: 22-24.
[0262] In some embodiments, the individual is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc.). In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc. In some embodiments, the individual is younger than about 60 years old (including for example younger than about any of 50, 40, 30, 25, 20, 15, or 10 years old). In some embodiments, the individual is older than about 60 years old (including for example older than about any of 70, 80, 90, or 100 years old). In some embodiments, the individual is diagnosed with or genetically prone to one or more of the diseases or disorders described herein (such as a cancer, an autoimmune disease or transplantation). In some embodiments, the individual has one or more risk factors associated with one or more diseases or disorders described herein.
[0263] In some embodiments, the individual has a claudin-18 aberration prior to initiation of treatment. In some embodiments, the claudin-18 aberration comprises a genetic variation in CLDN18. In some embodiments, the aberration in CLDN18 comprises a mutation in CLDN18, including, but not limited to, deletion, frameshift, insertion, indel, missense mutation, nonsense mutation, point mutation, silent mutation, splice site mutation, splice variant, and translocation. In some embodiments, the claudin-18 aberration comprises a copy number variation of CLDN18.
[0264] In some embodiments, the claudin-18 aberration comprises an aberrant expression level of claudin-18 isoform 2 (CLDN18.2). In some embodiments, the claudin-18 aberration comprises an aberrant activity level or phosphorylation level of CLDN18.2.
[0265] The claudin-18 aberration determined “before or upon initiation of treatment” is the claudin-18 aberration determined in an individual before or upon the individual receives the first administration of a treatment modality described herein. “Claudin-18 aberration” refers to a genetic aberration in CLDN18, an aberrant expression level and/or an aberrant activity level of CLDN18.2. A genetic aberration in CLDN18 is determined in comparison to a control or reference, such as a reference sequence (such as a nucleic acid sequence or a protein sequence). An aberrant expression or activity level refers to an increase in an activity level or expression level of CLDN18.2 to a level that is above a reference activity level or range, such as at least about any of 10%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, 100%, 200%, 500% or more above the reference activity level or the median of the reference activity range. In some embodiments, the reference activity level is a clinically accepted normal activity level in a standardized test, or an activity level in a healthy individual (or tissue or cell isolated from the individual) free of the claudin-18 aberration.
[0266] In some embodiments, the individual is selected for treatment based upon status of a claudin-18 aberration in the individual.
[0267] In some embodiments, the method further comprises assessing claudin-18 aberration in an individual. In some embodiments, the method further comprises identifying or selection an individual for treatment based upon status of a claudin-18 aberration in the individual.
Disease or Condition
[0268] The multispecific constructs described herein can be used for treating any disease or condition. In some embodiments, the disease or condition is a cancer.
[0269] In some embodiments, the multispecific construct is used in a method for treating a cancer. Cancers that may be treated using any of the methods described herein include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. Types of cancers to be treated with the multispecific constructs as described in this application include, but are not limited to, carcinoma, blastoma, sarcoma, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included. In some embodiments, the cancer is a solid tumor.
[0270] In some embodiments, the cancer is a gastric cancer. In some embodiments, the cancer is a gastroesophageal junction (GEJ) cancer. In some embodiments, the gastric cancer is EBV (i.e., Epstein-Barr virus) subtype. In some embodiments, the gastric cancer is MST (i.e., microsatellite instability) subtype. In some embodiments, the gastric cancer is GS (i.e., genomically stable) subtype. In some embodiments, the gastric cancer is CIN (i.e., chromosomal instability) subtype. See Sohn et al. Clin Cancer Res.: 10.1158/1078-0432.CCR-16-2211. In some embodiments, the gastric cancer is diffuse gastric cancer. In some embodiments, the gastric cancer is intestinal gastric cancer.
[0271] In some embodiments, the cancer is a pancreatic cancer.
[0272] In some embodiments, the cancer is Her2-positive cancer. In some embodiments, the cancer is Her2-negative cancer.
[0273] In various embodiments, the cancer is early stage cancer, non-metastatic cancer, primary cancer, advanced cancer, locally advanced cancer, metastatic cancer, cancer in remission, recurrent cancer, cancer in an adjuvant setting, cancer in a neoadjuvant setting, or cancer substantially refractory to a therapy.
Dosing and Method of Administering the Multispecific Construct
[0274] The dose of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) used for treating a disease or disorder as described herein administered into the individual may vary with the particular multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody), the mode of administration, and the type of disease or condition being treated. In some embodiments, the type of disease or condition is a cancer. In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is effective to result in an objective response (such as a partial response or a complete response). In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is sufficient to result in a complete response in the individual. In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is sufficient to result in a partial response in the individual. In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is sufficient to produce an overall response rate of more than about any of 20%%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 64%, 65%, 70%, 75%, 80%, 85%, or 90% among a population of individuals treated with the multispecific construct. Responses of an individual to the treatment of the methods described herein can be determined, for example, based on RECIST levels.
[0275] In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is sufficient to prolong progress-free survival of the individual. In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is sufficient to prolong overall survival of the individual. In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is sufficient to produce clinical benefit of more than about any of 50%, 60%, 70%, or 77% among a population of individuals treated with the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody).
[0276] In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) alone or in combination with a second, third, and/or fourth agent, is an amount sufficient to decrease the size of a tumor, decrease the number of cancer cells, or decrease the growth rate of a tumor by at least about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 100% compared to the corresponding tumor size, number of cancer cells, or tumor growth rate in the same subject prior to treatment or compared to the corresponding activity in other subjects not receiving the treatment (e.g., receiving a placebo treatment). Standard methods can be used to measure the magnitude of this effect, such as in vitro assays with purified enzyme, cell-based assays, animal models, or human testing.
[0277] In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is below the level that induces a toxicological effect (i.e., an effect above a clinically acceptable level of toxicity) or is at a level where a potential side effect can be controlled or tolerated when the composition is administered to the individual.
[0278] In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that is close to a maximum tolerated dose (MTD) of the composition following the same dosing regimen. In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is more than about any of 80%, 90%, 95%, or 98% of the MTD.
[0279] In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that slows or inhibits the progression of the disease or condition (for example, by at least about 5%, 10%, 15%, 20%, 30%, 40%, 50%) as compared to that of the individual not receiving the treatment.
[0280] In some embodiments, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is an amount that reduces the side effects (autoimmune response) of a condition (e.g., transplantation) (for example, by at least about 5%, 10%, 15%, 20%, 30%, 40%, or 50%) as compared to that of the individual not receiving the treatment.
[0281] In some embodiments of any of the above aspects, the effective amount of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) is in the range of about 0.001 μg/kg to about 100 mg/kg of total body weight, for example, about 0.005 μg/kg to about 50 mg/kg, about 0.01 μg/kg to about 10 mg/kg, or about 0.01 μg/kg to about 1 mg/kg.
[0282] In some embodiments, the treatment comprises more than one administration of any one of the multispecific constructs (such as about two, three, four, five, six, seven, eight, night, or ten administrations of the multispecific construct). In some embodiments, two administrations are carried out within about a week. In some embodiments, a second administration is carried out at least about 1, 2, 3, 4, 5, 6, or 7 days after the completion of the first administration.
[0283] The multispecific construct can be administered to an individual (such as human) via various routes, including, for example, intravenous, intra-arterial, intraperitoneal, intrapulmonary, oral, inhalation, intravesicular, intramuscular, intra-tracheal, subcutaneous, intraocular, intrathecal, transmucosal, and transdermal. In some embodiments, the multispecific construct is included in a pharmaceutical composition while administered into the individual. In some embodiments, sustained continuous release formulation of the composition may be used. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intraperitoneally. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intraperitoneally. In some embodiments, the composition is administered intramuscularly. In some embodiments, the composition is administered subcutaneously. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered orally.
Combination Therapy
[0284] This application also provides methods of administering any one of multispecific construct into an individual for treating a disease or condition (such as cancer), wherein the method further comprises administering a second agent or therapy. In some embodiments, the second agent or therapy is a standard or commonly used agent or therapy for treating the disease or condition. In some embodiments, the second agent or therapy comprises a chemotherapeutic agent. In some embodiments, the second agent or therapy comprises a surgery. In some embodiments, the second agent or therapy comprises a radiation therapy. In some embodiments, the second agent or therapy comprises an immunotherapy. In some embodiments, the second agent or therapy comprises a hormonal therapy. In some embodiments, the second agent or therapy comprises a tyrosine kinase inhibitor. In some embodiments, the second agent targets Her2 (e.g., an anti-Her2 antibody).
[0285] In some embodiments, the multispecific construct (e.g., the anti-CLDN18.2/anti-PD-L1 bispecific antibody) is administered simultaneously with the second agent or therapy. In some embodiments, the multispecific construct (e.g., the anti-CLDN18.2/anti-PD-L1 bispecific antibody) is administered concurrently with the second agent or therapy. In some embodiments, the multispecific construct (e.g., the anti-CLDN18.2/anti-PD-L1 bispecific antibody) is administered sequentially with the second agent or therapy. In some embodiments, the multispecific construct (e.g., the anti-CLDN18.2/anti-PD-L1 bispecific antibody) is administered in the same unit dosage form as the second agent or therapy. In some embodiment, the multispecific construct (e.g., the anti-CLDN18.2/anti-PD-L1 bispecific antibody) is administered in a different unit dosage form from the second agent or therapy.
VI. Compositions, Kits and Articles of Manufacture
[0286] Also provided herein are compositions (such as formulations) comprising any one of the multispecific constructs (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) described herein, a nucleic acid encoding any of the multispecific constructs or a portion thereof, a vector comprising the nucleic acid encoding one of the multispecific constructs, or a host cell comprising the nucleic acid or vector.
[0287] Suitable formulations of the multispecific construct (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) described herein can be obtained by mixing the multispecific construct having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed. Lyophilized formulations adapted for subcutaneous administration are described in WO97/04801. Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the individual to be imaged, diagnosed, or treated herein.
[0288] The formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.
[0289] Also provided are kits comprising any one of the multispecific constructs (e.g., an anti-CLDN18.2/anti-PD-L1 bispecific antibody) described herein. The kits may be useful for any of the methods of treatment described herein. In some embodiments, the kit further comprises an agent for assessing claudin-18 aberration (e.g., an anti-CLDN18.2 antibody).
[0290] In some embodiments, the kit further comprises a device capable of delivering the multispecific construct into an individual. One type of device, for applications such as parenteral delivery, is a syringe that is used to inject the composition into the body of a subject. Inhalation devices may also be used for certain applications.
[0291] In some embodiments, the kit further comprises a therapeutic agent for treating a disease or condition, e.g., cancer, infectious disease, autoimmune disease, or transplantation.
[0292] The kits of the present application are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretative information.
[0293] The present application thus also provides articles of manufacture. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include vials (such as sealed vials), bottles, jars, flexible packaging, and the like. Generally, the container holds a composition, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
[0294] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.
Exemplary Embodiments
[0295] Embodiment 1. A multispecific construct comprising a) a first antibody moiety that specifically binds to claudin-18 isoform 2 (“CLDN18.2”); and b) a second antibody moiety that specifically binds to PD-L1.
[0296] Embodiment 2. The multispecific construct of embodiment 1, wherein the first antibody moiety comprises a full-length antibody comprising two heavy chains and two light chains.
[0297] Embodiment 3. The multispecific construct of embodiment 1 or embodiment 2, wherein the second antibody moiety comprises a single-domain antibody that binds to PD-L1.
[0298] Embodiment 4. The multispecific construct of embodiment 2 or embodiment 3, wherein the second antibody moiety is fused to the one or two heavy chains of the full-length antibody.
[0299] Embodiment 5. The multispecific construct of embodiment 4, wherein the second antibody moiety is fused to the N-terminus of the one or two heavy chains of the full-length antibody.
[0300] Embodiment 6. The multispecific construct of embodiment 4, wherein the second antibody moiety if fused to the C-terminus of the one or two heavy chains of the full-length antibody.
[0301] Embodiment 7. The multispecific construct of embodiment 2 or embodiment 3, wherein the second antibody moiety is fused to the one or two light chains of the full-length antibody.
[0302] Embodiment 8. The multispecific construct of embodiment 7, wherein the second antibody moiety is fused to the N-terminus of the one or two light chains of the full-length antibody.
[0303] Embodiment 9. The multispecific construct of embodiment 7, wherein the second antibody moiety is fused to the C-terminus of the one or two light chains of the full-length antibody.
[0304] Embodiment 10. The multispecific construct of any one of embodiments 2-9, wherein the second antibody moiety is fused to the full-length antibody via a linker.
[0305] Embodiment 11. The multispecific construct of embodiment 10, wherein the linker is a peptide linker.
[0306] Embodiment 12. The multispecific construct of embodiment 11, wherein the peptide linker has a length of about four to about twenty amino acids.
[0307] Embodiment 13. The multispecific construct of any one of embodiments 10-12, wherein the linker is a cleavable linker.
[0308] Embodiment 14. The multispecific construct of any one of embodiments 10-12, wherein the linker is a non-cleavable linker.
[0309] Embodiment 15. The multispecific construct of any one of embodiments 10-12, wherein the linker is a GS linker.
[0310] Embodiment 16. The multispecific construct of any one of embodiments 10-12, wherein the linker comprises a modified sequence derived from the hinge region of an IgG.
[0311] Embodiment 17. The multispecific construct of any one of embodiments 10-16, wherein the linker has an amino acid sequence selected from the group consisting of SEQ ID NOs: 72-80.
[0312] Embodiment 18. The multispecific construct of embodiment 17, wherein the linker has an amino acid sequence selected from the group consisting of SEQ ID NOs: 72-77.
[0313] Embodiment 19. The multispecific construct of any one of embodiments 1-18, wherein the CLDN18.2 is a human CLDN18.2.
[0314] Embodiment 20. The multispecific construct of any one of embodiments 1-19, wherein the first antibody moiety comprises: a) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a heavy variable region (VH) having the sequence set forth in SEQ ID NO: 7; and b) a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a light chain variable region (VL) having the sequence set forth in SEQ ID NO: 8.
[0315] Embodiment 21. The multispecific construct of any one of embodiments 1-20, wherein the first antibody moiety comprises a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6.
[0316] Embodiment 22. The multispecific construct of embodiment 20 or embodiment 21, wherein the VH comprises the amino acid sequence of SEQ ID NO: 7, or a variant thereof having at least about 80% sequence identity to SEQ ID NO: 7; and/or the VL comprises the amino acid sequence of SEQ ID NO: 8, or a variant thereof having at least about 80% sequence identity to SEQ ID NO: 8.
[0317] Embodiment 23. The multispecific construct of any one of embodiments 1-22, wherein the PD-L1 is a human PD-L1.
[0318] Embodiment 24. The multispecific construct of any one of embodiments 1-23, wherein the second antibody moiety comprises a single domain antibody (sdAb) comprising a sdAb-CDR1, a sdAb-CDR2, and a sdAb-CDR3, respectively comprising the amino acid sequence of a CDR1, a CDR2, and a CDR3 within a single monomeric variable antibody domain having the amino acid sequence set forth in any of SEQ ID NOs: 22-24.
[0319] Embodiment 25. The multispecific construct of any one of embodiments 1-24, wherein the second antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15 or 19; b) a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, 18 or 20; and c) a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, or 21.
[0320] Embodiment 26. The multispecific construct of the embodiment 25, wherein the single domain antibody comprises: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21.
[0321] Embodiment 27. The multispecific construct of any one of embodiments 24-26, wherein the single domain antibody comprises the amino acid sequence of any one of SEQ ID NOs: 22-24, or a variant thereof having at least about 80% sequence identity to any one of SEQ ID NOs: 22-24.
[0322] Embodiment 28. The multispecific construct of any one of embodiments 2-27, wherein:
[0323] 1) the full-length antibody comprising a heavy variable region (VH) and a light chain variable region (VL), wherein: a) the VH comprises: i) a HC-CDR1 comprising an amino acid sequence of SEQ ID NO: 1, ii) a HC-CDR2 comprising an amino acid sequence of SEQ ID NO: 2, and iii) a HC-CDR3 comprising an amino acid sequence of SEQ ID NO: 3, and; b) the VL comprises: i) a LC-CDR1 comprising an amino acid sequence of SEQ ID NO: 4, ii) a LC-CDR2 comprising an amino acid sequence of SEQ ID NO: 5, and iii) a LC-CDR3 comprising an amino acid sequence of SEQ ID NO: 6; and
[0324] 2) the second antibody moiety comprises a single domain antibody (sdAb) comprising: a) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; b) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17; or c) a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21; wherein the second antibody moiety is fused to the full-length antibody moiety, optionally via a peptide linker having a length of about four to about twenty amino acids.
[0325] Embodiment 29. The multispecific construct of embodiment 28, wherein:
[0326] 1) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0327] 2) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0328] 3) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 19, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 20, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 21, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0329] 4) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78;
[0330] 5) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79;
[0331] 6) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 80;
[0332] 7) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78;
[0333] 8) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79;
[0334] 9) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 80;
[0335] 10) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0336] 11) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 18, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0337] 12) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0338] 13) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 72;
[0339] 14) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78;
[0340] 15) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two heavy chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79;
[0341] 16) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 78;
[0342] 17) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the N-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 79;
[0343] 18) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 73;
[0344] 19) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequences of SEQ ID NO: 74;
[0345] 20) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 75;
[0346] 21) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 76; or
[0347] 22) the second antibody moiety comprises a sdAb-CDR1 comprising an amino acid sequence of SEQ ID NO: 15, a sdAb-CDR2 comprising an amino acid sequence of SEQ ID NO: 16, and a sdAb-CDR3 comprising an amino acid sequence of SEQ ID NO: 17, wherein the second antibody is fused to the C-terminus of the two light chains of the full-length antibody via a linker comprising a sequence of SEQ ID NO: 77.
[0348] Embodiment 30. The multispecific construct of any one of embodiments 4-6 and 10-29, wherein the two heavy chains of the full-length antibody fused with the second antibody moiety each comprises an amino acid sequence of any one of SEQ ID NOs: 28-36 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 28-36.
[0349] Embodiment 31. The multispecific construct of embodiment 30, wherein the two light chains of the full-length antibody each comprises an amino acid sequence of SEQ ID NO: 10 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of SEQ ID NO: 10.
[0350] Embodiment 32. The multispecific construct of any one of embodiments 7-29, wherein the two light chains of the full-length antibody fused with the second antibody moiety each comprises an amino acid sequence of any one of SEQ ID NOs: 37-49 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 37-49.
[0351] Embodiment 33. The multispecific construct of embodiment 32, wherein the two heavy chains of the full-length antibody each comprises an amino acid sequence of SEQ ID NO: 9 or a variant comprising an amino acid sequence having at least about 80% sequence identity to the amino acid sequence of SEQ ID NO: 9.
[0352] Embodiment 34. The multispecific construct of any one of embodiments 30-33, wherein: a) two heavy chains of the full-length antibody fused with the second antibody moiety each comprises an amino acid sequence selected from any one of SEQ ID NO: 28-36, and two light chains each comprise an amino acid sequence of SEQ ID NO: 10; or b) two light chains of the full-length antibody fused with the second antibody moiety each comprises an amino acid sequence selected from any one of SEQ ID NO: 37-49, and two heavy chains each comprise an amino acid sequence of SEQ ID NO: 9.
[0353] Embodiment 35. The multispecific construct of any one of embodiments 1-34, wherein the construct is a bispecific antibody.
[0354] Embodiment 36. A pharmaceutical composition comprising the construct of any one of embodiments 1-35, and a pharmaceutical acceptable carrier.
[0355] Embodiment 37. A nucleic acid encoding the construct of any one of embodiments 1-35.
[0356] Embodiment 38. A nucleic acid comprising the nucleic acid sequence selected from the group consisting of SEQ ID NOs: 50-71.
[0357] Embodiment 39. A vector comprising the nucleic acid of embodiment 37 or embodiment 38.
[0358] Embodiment 40. A host cell comprising the nucleic acid of embodiment 37 or embodiment 38, or the vector of embodiment 39.
[0359] Embodiment 41. A method of producing the multispecific construct of any one of embodiments 1-35, comprising: a) culturing the host cell of embodiment 40 under conditions effective to express the multispecific construct; and b) obtaining the expressed construct from the host cell.
[0360] Embodiment 42. A method of treating a disease or condition in an individual, comprising administering to the individual an effective amount of the multispecific construct of any one of embodiments 1-35, or the pharmaceutical composition of embodiment 36.
[0361] Embodiment 43. The method of embodiment 42, wherein the disease or condition is a cancer.
[0362] Embodiment 44. The method of embodiment 43, wherein the cancer is a gastric cancer.
[0363] 45. The method of any one of embodiments 42-44, wherein the individual has a Claudin-18 aberration.
[0364] Embodiment 46. The method of any one of embodiments 42-45, wherein the method further comprises administering a second agent.
[0365] Embodiment 47. The method of embodiment 46, wherein the second agent binds to Her-2.
[0366] Embodiment 48. The method of any one of embodiments 4247, wherein the construct or the pharmaceutical composition is administered parenterally into the individual.
[0367] Embodiment 49. The method of any one of embodiments 4248, wherein the individual is a human.
[0368] Embodiment 50. A kit comprising the pharmaceutical composition of embodiment 36 and an instruction for treating a disease or condition.
EXAMPLES
[0369] The examples below are intended to be purely exemplary of the application and should therefore not be considered to limit the application in any way. The following examples and detailed description are offered by way of illustration and not by way of limitation.
Example 1. Construction and Expression of Anti-CLDN18.2/Anti-PD-L1 Bispecific Antibodies
[0370] A series of CLDN18.2/PD-L1 bispecific antibodies using CLDN18.2 monoclonal antibody (mAb) and PD-L1 single domain antibody (sdAb) were designed. PD-L1 sdAb was fused to the light/heavy chain of CLDN18.2 mAb, respectively. PD-L1 sdAb was fused to N- or C-terminus of heavy chain or light chain of CLDN18.2 mAb via several kinds of linkers for fusion. Each construct was composed of one fusion polypeptide chain and one native polypeptide chain, and the DNA sequence expressing each polypeptide chain was inserted into pTT5 vector between EcoRI and HindIII restriction sites. Each plasmid also included secretion signal sequence for proteins secreted into the growth medium. PD-L1 sdAb fused to the N-terminus of IgG4 Fc portion with sites mutation (S228P and L235E) was used as a control for in vitro bioassay. The plasmids expressing the various constructs was shown as below in Table 3.
TABLE-US-00003 TABLE 3 The anti-CLDN18.2/anti-PD-L1 bispecific antibodies and theirs expressing plasmids Protein Component Plasmids anti-CLDN18.2 mAb H0 pTT5-CLDN18H L0 pTT5-CLDN18L CLDN18H-E-pdl1a H1 pTT5-CLDN18H-E-pdl1a L0 pTT5-CLDN18L CLDN18H-E-pdl1b H2 pTT5-CLDN18H-E-pdl1b L0 pTT5-CLDN18L CLDN18H-E-pdl1c H3 pTT5-CLDN18H-E-pdl1c L0 pTT5-CLDN18L CLDN18H-G15-pdl1a H4 pTT5-CLDN18H-G15-pdl1a L0 pTT5-CLDN18L CLDN18H-G12-pdl1a H5 pTT5-CLDN18H-G12-pdl1a L0 pTT5-CLDN18L CLDN18H-G9-pdl1a H6 pTT5-CLDN18H-G9-pdl1a L0 pTT5-CLDN18L CLDN18L-G15-pdl1a L1 pTT5-CLDNl8L-G15-pdl1a H0 pTT5-CLDN18H CLDN18L-G12-pdl1a L2 pTT5-CLDN18L-G12-pdl1a H0 pTT5-CLDN18H CLDN18L-G9-pdl1a L3 pTT5-CLDN18L-G9-pdl1a H0 pTT5-CLDN18H CLDN18L-E-pdl1a L4 pTT5-CLDN18L-E-pdl1a H0 pTT5-CLDN18H CLDN18L-E-pdl1b L5 pTT5-CLDN18L-E-pdl1b H0 pTT5-CLDN18H pdl1a-E-CLDN18H H7 pTT5-pdl1a-E-CLDN18H L0 pTT5-CLDN18L pdl1a-E-CLDN18L L6 pTT5-pdl1a-E-CLDN18L H0 pTT5-CLDN18H pdl1a-G15-CLDN18H H8 pTT5-pdl1a-G15-CLDN18H L0 pTT5-CLDN18L pdl1a-G12-CLDN18H H9 pTT5-pdl1a-G12-CLDN18H L0 pTT5-CLDN18L pdl1a-G15-CLDN18L L7 pTT5-pdl1a-G15-CLDN18L H0 pTT5-CLDN18H pdl1a-G12-CLDN18L L8 pTT5-pdl1a-G12-CLDN18L H0 PTT5-CLDN18H CLDN18L-Ea-pdl1a L9 pTT5-CLDN18L-Ea-pdl1a H0 pTT5-CLDN18H CLDN18L-E2-pdl1a L10 pTT5-CLDN18L-E2-pdl1a H0 pTT5-CLDN18H CLDN18L-E2a-pdl1a L11 pTT5-CLDN18L-E2a-pdl1a H0 pTT5-CLDN18H CLDN18L-E4-pdl1a L12 pTT5-CLDN18L-E4-pdl1a H0 pTT5-CLDN18H CLDN18L-E4a-pdl1a L13 pTT5-CLDN18L-E4a-pdl1a H0 pTT5-CLDN18H
[0371] CHO-3E7 cells transfected with expression plasmids were cultured at 37° C. and 100 rpm for 6 days. The supernatant fraction was collected by centrifugation and the various constructs were purified through Protein A column.
[0372] PD-L1 sdAbs including PDL1a, PDL1b and PDL1c were used for bispecific antibody construction. As shown in Table 3, CLDN18.2 mAb consists of heavy chain called H0 and light chain called L0. A series of bispecific antibodies were designed by fusing different PD-L1 sdAbs to CLDN18.2 mAb, respectively with linker (E-linker: EPKSSDKTHTSPPSP (SEQ ID NO: 72), Ea-linker: EPKSSDKGHGGPPGP (SEQ ID NO: 73), E2-linker: ERKSSVESPPSP (SEQ ID NO: 74), E2a-linker: ERKSGVEGPPGP (SEQ ID NO: 75), E4-linker: ESKYGPPSPPSP (SEQ ID NO: 76), E4a-linker: ESKYGPPGPPGP (SEQ ID NO: 77), G15-linker: (G4S)3 (SEQ ID NO: 78), G12-linker: GGGGSGGGGSGS (SEQ ID NO: 79), or G9-linker: GGGGSGGGS (SEQ ID NO: 80)). PDL1a sdAb was fused to the C-terminus of heavy chain of H0 by E-linker generating new polypeptide called H1. In the same way, new polypeptides called H2 and H3 were generated by using PDL1b and PDL1c sdAb, respectively. PDL1a sdAb was linked to the C-terminus of heavy chain of H0 or light chain of L0 by G15/G12/G9-linker generating six new polypeptides called H4, H5, H6, L1, L2 and L3, respectively. Two sdAbs of PDL1a and PDL1b were fused to the C-terminus of light chain of L0 by E-linker generating two new polypeptides called L4 and L5. PDL1a sdAb was fused to the N-terminus of heavy chain of H0 or light chain of L0 by E-linker leading to new polypeptides called H7 and L6. Meanwhile, PDL1a sdAb was fused to the N-terminus of heavy chain of H0 or light chain of L0 by G15/G12-linker generating new polypeptides called H8, H9, L7 and L8, respectively. In addition, PDL1a sdAb was fused to the C-terminus of light chain of L0 by Ea/E2/E2a/E4/E4a-linker leading to new polypeptides called L9, L10, L11, L12 and L13, respectively.
[0373] As illustrated above, CLDN18H-E-pdl1a, CLDN18H-E-pdl1b, CLDN18H-E-pdl1c, CLDN18H-G15-pdl1a, CLDN18H-G12-pdl1a, CLDN18H-G9-pdl1a, pdl1a-E-CLDN18H, pdl1a-G15-CLDN18H, and pdl1a-G12-CLDN18H, CLDN18L-G15-pdl1a, CLDN18L-G12-pdl1a, CLDN18L-G9-pdl1a, CLDN18L-E-pdl1a, CLDN18L-E-pdl1b, pdl1a-E-CLDN18L, pdl1a-G15-CLDN18L, pdl1a-G12-CLDN18L, CLDN18L-Ea-pdl1a, CLDN18L-E2-pdl1a, CLDN18L-E2a-pdl1a, CLDN18L-E4-pdl1a and CLDN18L-E4a-pdl1a were generated.
[0374] The sdAb-Fc fusion protein were constructed by linking sdAb to the N-terminus of human IgG4 Fc portion with sites mutation (S228P and L235E) called IgG4PE, generating new Fc fusion proteins called sdAb-PDL1a-IgG4PE, sdAb-PDL1b-IgG4PE and sdAb-PDL1c-IgG4PE.
Example 2. Characterization of Bispecific Antibodies
A. FACS Binding Assay
[0375] The binding pattern of bispecific antibodies on CLDN18.2 or PD-L1 expressed on CHO-K1 cells were plotted with antibody in 3× serial dilutions, starting concentration of 300 nM. Antibody-antigen binding curves were generated with geometric mean values. Raw data was plotted with GraphPad Prism v6.02 software with four parameters, best-fit values program to analyze the EC.sub.50.
[0376] For PD-L1 binding, most bispecific constructs showed similar affinity to PD-L1 antigen compared to controls of sdAb-PDL1a-IgG4PE, sdAb-PDL1b-IgG4PE and sdAb-PDL1c-IgG4PE (See
[0377] For CLDN18.2 binding, PD-L1 sdAb fused to the C-terminus of heavy/light chain of CLDN18.2 mAb did not affect CLDN18.2 binding. See
[0378] For CLDN18.1 binding, neither anti-CLDN18.2 mAb nor bispecific antibodies bind to CLDN18.1 overexpressed cells. See
B. In Vitro Bioassay
[0379] CLDN18.2 and PD-L1 target response was performed by PD-1/PD-L1 blockade bioassay and anti-CLDN18.2 antibody mediated ADCC and CDC, separately.
1) PD-1/PD-L1 Blockade Bioassay
[0380] The PD-1/PD-L1 blockade bioassay system from Promega was used to measure the potency and stability of antibodies and other biologics designed to block the PD-1/PD-L1 interaction. The assay consists of two genetically engineered cell lines: PD-1 Effector Cells, which are Jurkat T cells expressing human PD-1 and a luciferase reporter driven by an NFAT response element (NFAT-RE), and PD-L1 aAPC/CHO-K1 Cells, which are CHO-K1 cells expressing human PD-L1 and an engineered cell surface protein designed to activate cognate TCRs in an antigen-independent manner. When the two cell types are co-cultured, the PD-1/PD-L1 interaction inhibits TCR signaling and NFAT-RE-mediated luminescence. Addition of either an anti-PD-1 or anti-PD-L1 antibody that blocks the PD-1/PD-L1 interaction releases the inhibitory signal and results in TCR activation and NFAT-RE-mediated luminescence.
[0381] Tecentriq biosimilar was utilized as a reference antibody. All of bispecific antibodies showed similar PD-L1 blockade activity compared with sdAb-Fc control, although they showed a little lower activity than reference antibody Tecentriq biosimilar. See
2) CDC Analysis
[0382] CDC assay was conducted for the bispecific antibodies. The target cell line, CHO-K1-overexpressing human Claudin18.2, was cultured and harvested, and it was seeded in 96-well plate at a specific cell density. Antibody samples were added to the plate accordingly and the plate was incubated at 37° C./5% CO.sub.2 for 30 min. Purified normal human serum was then added to the plate and the plate was incubated further for 4 hours. The plate was taken out of the incubator and the supernatant was collected and analyzed with Cell Titer-Glo® assay kit (Cat. No. G7570, Promega). The luminescence data were captured by PheraStar (BMG Labtech) for cell viability analysis. The CDC assay results were plotted in terms of percent target cell lysis versus the candidate antibody concentration.
[0383] For bispecific antibodies induced CDC analysis, IMAB362 biosimilar was used as a reference antibody. As showed in
3) ADCC Assay
[0384] The effect of the bispecific antibodies on antibody-dependent cellular cytotoxicity (ADCC) was compared. The ADCC assay results were plotted in terms of percent target cell lysis versus bispecific antibody concentration. For the assay procedure, the target cell line, CHO-K1-overexpressing human Claudin18.2, was cultured, harvested and seeded into 96 well plates at a specific cell density. The bispecific antibody samples or positive control, which was in-house synthesized with the identical amino acid sequence of IMAB362 (Zolbetuximab), were added to the plate and the plate was incubated at 37° C./5% CO.sub.2 for 30 min. Freshly isolated human PBMCs (Peripheral Blood Mononuclear Cells) were used as the effector cells and added to the plates and incubated at the same condition for 6 hours. The assay plate was taken out and briefly centrifuged. The supernatant was collected and transferred to a new plate for an LDH activity assay as per manufacturer's instruction (Roche). The absorbance data were captured by FlexStation 3 and analyzed by GraphPad Prism 6.0.
[0385] For the bispecific antibodies induced ADCC assay, IMAB362 biosimilar was used as a reference antibody. As showed in
TABLE-US-00004 SEQUENCE TABLE SEQ Nucleotide or Amino acid sequence (CDR sequences are ID NO Description underlined and bold) Exemplary Anti-CLDN18.2 antibody moiety 1 VH-CDR1 GFSLTTYGVH 2 VH-CDR2 VIWAGGSTNYNSALMS 3 VH-CDR3 AAYYGNGLDY 4 VL-CDR1 KSSQTLLNSGNQKNYLT 5 VL-CDR2 WASTGES 6 VL-CDR3 QNAYFYPFT 7 VH QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSS 8 VL DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYL QKPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAE DVGVYYCQNAYFYPFTFGGGTKVEIK 9 Amino acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS heavy chain of LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS anti-CLDN18.2 VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV mAb (H0) HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFIYSKLTVDKSRWQQGNVISCSVM HEALHNHYTQKSLSLSPGK 10 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYL sequence of QKPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAE light chain of DVGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQL anti-CLDN18.2 KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD mAb (L0) SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GEC 11 DNA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of heavy chain gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc of anti- ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt CLDN18.2 tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg mAb acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaa 12 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of light chain of aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac anti-CLDN18.2 ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt mAb ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgc Exemplary secretary signal peptide 13 Amino acid MGWSCIILFLVATATGVHS sequence of secretory signal peptide 14 DNA sequence atgggctggtcctgcatcatcctgttcctggtggctaccgccaccggcgtgcactcc of secretory signal peptide Exemplary anti-PDL1 sdAb 15 CDR1 (PDL1a GRTFVTYGMG sdAb & PDL1b sdAb) 16 CDR2 (PDL1a AISWSGSMTSYGDSVKG sdAb) 17 CDR3 (PDL1a ALGAVVYTTREPYTY sdAb & PDL1b sdAb) 18 CDR2 (PDL1b AISWSGSSTSYGDSVKG sdAb) 19 CDR1 (PDL1c GRTFITYAIG sdAb) 20 CDR2 (PDL1c AISWSGSMTSYADSVKG sdAb) 21 CDR3 (PDL1c HRGAIAPIAQSVYTN sdAb) 22 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAP sequence of GKGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQM PDL1a sdAb NSLRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSS 23 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAP sequence of GKGREFVSAISWSGSSTSYGDSVKGRFTISRDNAKNTLYLQMN PDL1b sdAb SLRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSS 24 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTYTTYAIGWFRQAPGK sequence of GREFVSAISWSGSMTSYADSVKGRFTISRDNAKNTLYLQMNSL PDL1c sdAb RPEDTAVYYCAAHRGAIAPIAQSVYTNWGQGTLVTVSS 25 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of PDL1a sdAb gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggc agattcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcct gaggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaaccc tatacctactggggacagggcaccctggtgaccgtgtcctct 26 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of PDL1b sdAb gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccagcacctcttacggcgactctgtgaagggc agattcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcct gaggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaaccc tatacctactggggacagggcaccctggtgaccgtgtcctct 27 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtgcagcctggcggctctctgagactgtcctgc of PDL1c sdAb gccgcttctggccggaccttcatcacctacgccatcggctggttcagacaggcccctggcaagggc agagagttcgtgtccgccatctcctggtccggctctatgaccagctacgccgactctgtgaagggca gattcaccatctcccgggataacgccaagaacaccctgtacctgcagatgaattccctgagacctga ggacacagctgtgtattactgcgccgctcaccggggcgccatcgctcccatcgctcagagcgtgtac accaactggggccagggaaccctggtcaccgtgtccagc Exemplary bispecific antibodies 28 Amino acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of H1 KGLEWVAVTWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGKEPKSSDKTHTSPPSPEVQLVESGGG LVQPGGSLRLSCAASGRTFVTYGMGWFRQAPGKGREFVSAISW SGSMTSYGDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYC AAALGAVVYTTREPYTYWGQGTLVTVSS 29 Amino acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of H2 KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGKEPKSSDKTHTSPPSPEVQLVESGGG LVQPGGSLRLSCAASGRTFVTYGMGWFRQAPGKGREFVSAISW SGSSTSYGDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYC AAALGAVVYTTREPYTYWGQGTLVTVSS 30 Amino acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of H3 KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGKEPKSSDKTHTSPPSPEVQLVESGGG LVQPGGSLRLSCAASGRTFITYAIGWFRQAPGKGREFVSAISWS GSMTSYADSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYC AAHRGAIAPIAQSVYTNWGQGTLVTVSS 31 Ammo acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of H4 KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNEKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSEVQLVESG GGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPGKGREFVSAI SWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVY YCAAALGAVVYTTREPYTYWGQGTLVTVSS 32 Amino acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of H5 KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGKGGGGSGGGGSGSEVQLVESGGGL VQPGGSLRLSCAASGRTFVTYGMGWFRQAPGKGREFVSAISWS GSMTSYGDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYC AAALGAVVYTTREPYTYWGQGTLVTVSS 33 Ammo acid QVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGVHWVRQAPG sequence of H6 KGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKNTLYLQMNS LRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGKGGGGSGGGSEVQLVESGGGLVQP GGSLRLSCAASGRTFVTYGMGWFRQAPGKGREFVSAISWSGS MTSYGDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCAA ALGAVVYTTREPYTYWGQGTLVTVSS 34 Ammo acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPG sequence of H7 KGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNS LRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSSEPK SSDKTHTSPPSPQVQLVESGGGVVQPGRSLRLSCAASGFSLTTY GVHWVRQAPGKGLEWVAVIWAGGSTNYNSALMSRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARAAYYGNGLDYWGQGTMV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK 35 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPG sequence of H8 KGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNS LRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSSGGG GSGGGGSGGGGSQVQLVESGGGVVQPGRSLRLSCAASGFSLTT YGVHWVRQAPGKGLEWVAVIWAGGSTNYNSALMSRFTISRDN SKNTLYLQMNSLRAEDTAVYYCARAAYYGNGLDYWGQGTM VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV1LFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 36 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPG sequence of H9 KGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNS LRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSSGGG GSGGGGSGSQVQLVESGGGVVQPGRSLRLSCAASGFSLTTYGV HWVRQAPGKGLEWVAVIWAGGSTNYNSALMSRFTISRDNSKN TLYLQMNSLRAEDTAVYYCARAAYYGNGLDYWGQGTMVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK 37 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L1 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAA SGRTFVTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKG RFTISRDNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTRE PYTYWGQGTLVTVSS 38 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L2 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECGGGGSGGGGSGSEVQLVESGGGLVQPGGSLRLSCAASGRT FVTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRFTIS RDNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREPYTY WGQGTLVTVSS 39 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L3 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGRTFVT YGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRFTISRDN AKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREPYTYWG QGTLVTVSS 40 Ammo acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L4 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECEPKSSDKTHTSPPSPEVQLVESGGGLVQPGGSLRLSCAASG RTFVTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRF TISRDNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREP YTYWGQGTLVTVSS 41 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L5 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSISSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECEPKSSDKTHTSPPSPEVQLVESGGGLVQPGGSLRLSCAASG RTFVTYGMGWFRQAPGKGREFVSAISWSGSSTSYGDSVKGRFT ISRDNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREPY TYWGQGTLVTVSS 42 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPG sequence of L6 KGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNS LRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSSEPK SSDKTHTSPPSPDIVMTQSPLSLPVTPGEPASISCKSSQTLLNS GNQKNYLTWYLQKPGQSPQLLIYWASTGESGVPDRFSGSGSGTDF TIKISRVEAIDVGVYYCQNAYFYPETFGGGTKVEIKRTVAAPS VHIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC 43 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPG sequence of L7 KGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNS LRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSSGGG GSGGGGSGGGGSDIVMTQSPLSLPVTPGEPASISCKSSQTLLNSG NQKNYLTWYLQKPGQSPQLLIYWASTGESGVPDRFSGSGSGTD FTLKISRVEAEDVGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPS VFlPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC 44 Amino acid EVQLVESGGGLVQPGGSLRLSCAASGRTFVTYGMGWFRQAPG sequence of L8 KGREFVSAISWSGSMTSYGDSVKGRFTISRDNAKNTLYLQMNS LRPEDTAVYYCAAALGAVVYTTREPYTYWGQGTLVTVSSGGG GSGGGGSGSDIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQK NYLTWYLQKPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTL KISRVEAEDVGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGEC 45 Ammo acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L9 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEnCRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECEPKSSDKGHGGPPGPEVQLVESGGGLVQPGGSLRLSCAAS GRTFVTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGR FTISRDNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREP YTYWGQGTLVTVSS 46 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L10 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEnCRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECERKSSVESPPSPEVQLVESGGGLVQPGGSLRLSCAASGRTF VTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRFTISR DNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREPYTY WGQGTLVTVSS 47 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L11 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVE1KRTVAAPSVF1FPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSISSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECERKSGVEGPPGPEVQLVESGGGLVQPGGSLRLSCAASGRT FVTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRFnS RDNAKNTIYLQMNSLRPEDTAVYYCAAAIGAVVYTTREPYTY WGQGTLVTVSS 48 Amino acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L12 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECESKYGPPSPPSPEVQLVESGGGLVQPGGSLRLSCAASGRTF VTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRFTISR DNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREPYTY WGQGTLVTVSS 49 Ammo acid DIVMTQSPLSLPVTPGEPASISCKSSQTLLNSGNQKNYLTWYLQ sequence of L13 KPGQSPQLLIYWASTGESGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCQNAYFYPFTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GECESKYGPPGPPGPEVQLVESGGGLVQPGGSLRLSCAASGRTF VTYGMGWFRQAPGKGREFVSAISWSGSMTSYGDSVKGRFTISR DNAKNTLYLQMNSLRPEDTAVYYCAAALGAVVYTTREPYTY WGQGTLVTVSS 50 DNA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of H1 gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaagaacctaagtctagcgacaaaactcataccagcccccctagtccagaggtgcagctggt ggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcag aaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggcagagagttcgtgtc cgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcagattcaccatcagcc gggataacgccaagaacacactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgt actactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaaccctatacctactggggac agggcaccctggtgaccgtgtcctct 51 DNA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of H2 gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaagaacctaagtctagcgacaaaactcataccagcccccctagtccagaggtgcagctggt ggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcag aaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggcagagagttcgtgtc cgccatctcctggtccggctccagcacctcttacggcgactctgtgaagggcagattcaccatcagc cgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctgaggacaccgccgt gtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaaccctatacctactgggga cagggcaccctggtgaccgtgtcctct 52 DNA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of H3 gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaagaacctaagtctagcgacaaaactcataccagcccccctagtccagaggtgcagctggt ggaatccggcggaggcctggtgcagcctggcggctctctgagactgtcctgcgccgcttctggccg gaccttcatcacctacgccatcggctggttcagacaggcccctggcaagggcagagagttcgtgtcc gccatctcctggtccggctctatgaccagctacgccgactctgtgaagggcagattcaccatctcccg ggataacgccaagaacaccctgtacctgcagatgaattccctgagacctgaggacacagctgtgtat tactgcgccgctcaccggggcgccatcgctcccatcgctcagagcgtgtacaccaactggggcca gggaaccctggtcaccgtgtccagc 53 DNA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of H4 gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaaggtggaggcggtagtggaggcggtggttcaggcggaggcggatctgaggtgcagctg gtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgcgccgcttctggc agaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggcagagagttcgtg tccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcagattcaccatcag ccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctgaggacaccgccg tgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaaccctatacctactgggg acagggcaccctggtgaccgtgtcctct 54 DNA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of H5 gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaaggtggaggcggtagtggaggcggtggttcaggatctgaggtgcagctggtggaatccg gcggaggcctggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgt gacctacggcatgggctggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctc ctggtccggctccatgacctcttacggcgactctgtgaagggcagattcaccatcagccgggataac gccaagaacacactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgc gccgctgccctgggcgctgtcgtgtacaccaccagagaaccctatacctactggggacagggcac cctggtgaccgtgtcctct 55 DINA sequence caagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctgcggctgtcttgt of H6 gctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccctggcaagggc ctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccctgatgtcccggt tcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctgagagccgagg acacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactactggggccagg gcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctggccccttcttcc aagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttccccgagcctgtg accgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtgctgcagtcctct ggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccagacctacatctgc aacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaagtcctgcgacaa gacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgttcctgtttcctcc aaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtcgtggacgtgtcc cacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcacaacgctaagac caagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgacagtgctgcaccag gattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgctcctatcgag aagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctgcctccttctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacccctctgacatcg ctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctccagtcctggact ccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcagcagggcaatgt gttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctctgtccctgtctcc cggcaaaggtggaggcggtagtggaggcggttcagaggtgcagctggtggaatccggcggagg cctggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacg gcatgggctggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccg gctccatgacctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaaga acacactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctg ccctgggcgctgtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtga ccgtgtcctct 56 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of H7 gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcag attcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctga ggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaacccta tacctactggggacagggcaccctggtgaccgtgtcctctgaacctaagtctagcgacaaaactcat accagcccccctagtccacaagtgcagctggtggaaagcggaggaggagtggtgcagcccggca gatctctgcggctgtcttgtgctgcttctggcttctccctgaccacctacggcgtccactgggtccggc aggcccctggcaagggcctcgagtgggtggccgtgatctgggctggcggctctaccaactacaact ccgccctgatgtcccggttcaccatctccagagataattccaagaacaccctgtacctgcagatgaac agcctgagagccgaggacacagctgtgtactactgcgccagagctgcctactatggcaacggcctg gactactggggccagggcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttc cctctggccccttcttccaagagcacctccggcggcaccgccgctctgggctgcctggtcaaggact acttccccgagcctgtgaccgtgtcttggaactccggcgccctgacatctggagtgcacaccttccct gctgtgctgcagtcctctggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggca cccagacctacatctgcaacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaa cccaagtcctgcgacaagacccacacctgtcctccttgccctgcccctgagctgctgggcggcccct ctgtgttcctgtttcctccaaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtg tggtcgtggacgtgtcccacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaag tgcacaacgctaagaccaagcctcgggaggagcagtacaattccacctacagagtggtctctgtact gacagtgctgcaccaggattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccc tgcctgctcctatcgagaagaccatctccaaggccaagggccagcctagagaacctcaggtgtaca ccctgcctccttctcgggacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggctt ctacccctctgacatcgctgtggaatgggagtctaacggccagcctgagaacaactacaagaccac acctccagtcctggactccgatggatctttcttgtgtactccaagctgaccgtggacaagagcagat ggcagcagggcaatgtgttctcctgctccgtgatgcacgaggccctgcataaccactacacccaga agtctctgtccctgtctcccggcaaa 57 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of H8 gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcag attcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctga ggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaacccta tacctactggggacagggcaccctggtgaccgtgtcctctggtggaggcggtagtggaggcggtg gttcaggcggaggcggatctcaagtgcagctggtggaaagcggaggaggagtggtgcagcccgg cagatctctgcggctgtcttgtgctgcttctggcttctccctgaccacctacggcgtccactgggtccg gcaggcccctggcaagggcctcgagtgggtggccgtgatctgggctggcggctctaccaactaca actccgccctgatgtcccggttcaccatctccagagataattccaagaacaccctgtacctgcagatg aacagcctgagagccgaggacacagctgtgtactactgcgccagagctgcctactatggcaacgg cctggactactggggccagggcaccatggtgaccgtgtccagcgcttccaccaagggccccagcg tgttccctctggccccttcttccaagagcacctccggcggcaccgccgctctgggctgcctggtcaa ggactacttccccgagcctgtgaccgtgtcttggaactccggcgccctgacatctggagtgcacacc ttccctgctgtgctgcagtcctctggcctgtactccctgtcctccgtggtgaccgtgccttctagctctct gggcacccagacctacatctgcaacgtgaaccacaagccttccaacaccaaggtggacaagaaag tggaacccaagtcctgcgacaagacccacacctgtcctccttgccctgcccctgagctgctgggcg gcccctctgtgttcctgtttcctccaaagcctaaggatacactgatgatcagcagaacccctgaggtga cctgtgtggtcgtggacgtgtcccacgaggaccctgaagtgaagttcaactggtacgtggacggcgt ggaagtgcacaacgctaagaccaagcctcgggaggagcagtacaattccacctacagagtggtctc tgtactgacagtgctgcaccaggattggctgaacggcaaagagtacaagtgcaaggtgtccaacaa ggccctgcctgctcctatcgagaagaccatctccaaggccaagggccagcctagagaacctcaggt gtacaccctgcctccttctcgggacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaa ggcttctacccctctgacatcgctgtggaatgggagtctaacggccagcctgagaacaactacaaga ccacacctccagtcctggactccgatggatctttcttcctgtactccaagctgaccgtggacaagagc agatggcagcagggcaatgtgttctcctgctccgtgatgcacgaggccctgcataaccactacaccc agaagtctctgtccctgtctcccggcaaa 58 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of H9 gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcag attcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctga ggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaacccta tacctactggggacagggcaccctggtgaccgtgtcctctggtggaggcggtagtggaggcggtg gttcaggatctcaagtgcagctggtggaaagcggaggaggagtggtgcagcccggcagatctctg cggctgtcttgtgctgcttctggcttctccctgaccacctacggcgtccactgggtccggcaggcccc tggcaagggcctcgagtgggtggccgtgatctgggctggcggctctaccaactacaactccgccct gatgtcccggttcaccatctccagagataattccaagaacaccctgtacctgcagatgaacagcctga gagccgaggacacagctgtgtactactgcgccagagctgcctactatggcaacggcctggactact ggggccagggcaccatggtgaccgtgtccagcgcttccaccaagggccccagcgtgttccctctg gccccttcttccaagagcacctccggcggcaccgccgctctgggctgcctggtcaaggactacttcc ccgagcctgtgaccgtgtcttggaactccggcgccctgacatctggagtgcacaccttccctgctgtg ctgcagtcctctggcctgtactccctgtcctccgtggtgaccgtgccttctagctctctgggcacccag acctacatctgcaacgtgaaccacaagccttccaacaccaaggtggacaagaaagtggaacccaa gtcctgcgacaagacccacacctgtcctccttgccctgcccctgagctgctgggcggcccctctgtgt tcctgtttcctccaaagcctaaggatacactgatgatcagcagaacccctgaggtgacctgtgtggtc gtggacgtgtcccacgaggaccctgaagtgaagttcaactggtacgtggacggcgtggaagtgcac aacgctaagaccaagcctcgggaggagcagtacaattccacctacagagtggtctctgtactgaca gtgctgcaccaggattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcct gctcctatcgagaagaccatctccaaggccaagggccagcctagagaacctcaggtgtacaccctg cctccttctcgggacgagctgaccaagaaccaggtgtccctgacctgcctggtgaaaggcttctacc cctctgacatcgctgtggaatgggagtctaacggccagcctgagaacaactacaagaccacacctc cagtcctggactccgatggatctttcttcctgtactccaagctgaccgtggacaagagcagatggcag cagggcaatgtgttctcctgctccgtgatgcacgaggccctgcataaccactacacccagaagtctct gtccctgtctcccggcaaa 59 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of LI aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcggtggaggcg gtagtggaggcggtggttcaggcggaggcggatctgaggtgcagctggtggaatccggcggagg cctggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacg gcatgggctggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccg gctccatgacctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaaga acacactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctg ccctgggcgctgtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtga ccgtgtcctct 60 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L2 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcggtggaggcg gtagtggaggcggtggttcaggatctgaggtgcagctggtggaatccggcggaggcctggtccag cctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggcatgggct ggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggctccatgac ctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaacacactgtac ctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccctgggcgct gtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgtgtcctct 61 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L3 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactcaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcggtggaggcg gtagtggaggcggttcagaggtgcagctggtggaatccggcggaggcctggtccagcctggcgg ctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggcatgggctggttccggc aggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggctccatgacctcttacgg cgactctgtgaagggcagattcaccatcagccgggataacgccaagaacacactgtacctgcagat gaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgta caccaccagagaaccctatacctactggggacagggcaccctggtgaccgtgtcctct 62 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L4 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaacctaagtct agcgacaaaactcataccagcccccctagtccagaggtgcagctggtggaatccggcggaggcct ggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggc atgggctggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggct ccatgacctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaaca cactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccct gggcgctgtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgt gtcctct 63 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L5 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaacctaagtct agcgacaaaactcataccagcccccctagtccagaggtgcagctggtggaatccggcggaggcct ggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggc atgggctggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggct ccagcacctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaaca cactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccct gggcgctgtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgt gtcctct 64 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of L6 gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcag attcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctga ggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaacccta tacctactggggacagggcaccctggtgaccgtgtcctctgaacctaagtctagcgacaaaactcat accagcccccctagtccagacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcga acctgcttccatctcctgcaagtcctctcagaccctgctgaactccggcaaccagaagaactacctga cctggtatctgcagaaacccggccagagcccacaactcctgatctactgggcctctaccggcgagtc cggcgtgcctgatagattctccggcagcggctctggcaccgacttcacactgaagatcagccgggt cgaggccgaggacgtgggcgtgtactactgtcagaacgcctacttctacccctttaccttcggcgga ggtacaaaggtggaaatcaagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacga gcagctgaaatctggcaccgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaag gtgcagtggaaagtggacaacgccctgcagtctggcaactcccaagaaagcgtgaccgagcagg actccaaggactctacatacagcctgtcctccaccctgaccctgtccaaggccgattacgagaagca caaggtctacgcttgtgaagtgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggg gcgagtgc 65 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of L7 gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcag attcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctga ggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaacccta tacctactggggacagggcaccctggtgaccgtgtcctctggtggaggcggtagtggaggcggtg gttcaggcggaggcggatctgacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggc gaacctgcttccatctcctgcaagtcctctcagaccctgctgaactccggcaaccagaagaactacct gacctggtatctgcagaaacccggccagagcccacaactcctgatctactgggcctctaccggcga gtccggcgtgcctgatagattctccggcagcggctctggcaccgacttcacactgaagatcagccg ggtcgaggccgaggacgtgggcgtgtactactgtcagaacgcctacttctacccctttaccttcggcg gaggtacaaaggtggaaatcaagagaaccgtggccgcccctagcgtgttcatctttcctccctctgac gagcagctgaaatctggcaccgcttccgtggtctgcctgctgaacaacttctaccccagagaggcta .sup.aggtgcagtggaaagtggacaacgccctgcagtctggcaactcccaagaaagcgtgaccgagca ggactccaaggactctacatacagcctgtcctccaccctgaccctgtccaaggccgattacgagaag cacaaggtctacgcttgtgaagtgacccaccagggactgtcctcccctgtgaccaagtctttcaatcg gggcgagtgc 66 DNA sequence gaggtgcagctggtggaatccggcggaggcctggtccagcctggcggctctctgcggctgtcctgc of L8 gccgcttctggcagaaccttcgtgacctacggcatgggctggttccggcaggctcctggcaagggc agagagttcgtgtccgccatctcctggtccggctccatgacctcttacggcgactctgtgaagggcag attcaccatcagccgggataacgccaagaacacactgtacctgcagatgaactccctgcggcctga ggacaccgccgtgtactactgcgccgctgccctgggcgctgtcgtgtacaccaccagagaacccta tacctactggggacagggcaccctggtgaccgtgtcctctggtggaggcggtagtggaggcggtg gttcaggatctgacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttc catctcctgcaagtcctctcagaccctgctgaactccggcaaccagaagaactacctgavctggtatc tgcagaaacccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgc ctgatagattctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccg aggacgtgggcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaag gtggaaatcaagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaa atctggcaccgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtgg aaagtggacaacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaagg actctacatacagcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtcta cgcttgtgaagtgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgc 67 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L9 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaacctaagtct agcgacaaaggccatggaggtccccctggaccagaggtgcagctggtggaatccggcggaggcc tggtccagcctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacgg catgggctggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccgg ctccatgacctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaac acactgtacctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgcc ctgggcgctgtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgacc gtgtcctct 68 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L10 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaaaggaagtc tagcgtggaatctccacctagtccagaggtgcagctggtggaatccggcggaggcctggtccagcc tggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggcatgggctggt tccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggctccatgacctc ttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaacacactgtacct gcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccctgggcgctgt cgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgtgtcctct 69 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of LH aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaaaggaagtc tggagtggaaggtccacctggaccagaggtgcagctggtggaatccggcggaggcctggtccag cctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggcatgggct ggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggctccatgac ctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaacacactgtac ctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccctgggcgct gtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgtgtcctct 70 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L12 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaatcgaagta cggacctccatctccacctagtccagaggtgcagctggtggaatccggcggaggcctggtccagcc tggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggcatgggctggt tccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggctccatgacctc ttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaacacactgtacct gcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccctgggcgctgt cgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgtgtcctct 71 DNA sequence gacatcgtgatgacccagtctcctctgtctctgcctgtgacccctggcgaacctgcttccatctcctgc of L13 aagtcctctcagaccctgctgaactccggcaaccagaagaactacctgacctggtatctgcagaaac ccggccagagcccacaactcctgatctactgggcctctaccggcgagtccggcgtgcctgatagatt ctccggcagcggctctggcaccgacttcacactgaagatcagccgggtcgaggccgaggacgtgg gcgtgtactactgtcagaacgcctacttctacccctttaccttcggcggaggtacaaaggtggaaatc aagagaaccgtggccgcccctagcgtgttcatctttcctccctctgacgagcagctgaaatctggcac cgcttccgtggtctgcctgctgaacaacttctaccccagagaggctaaggtgcagtggaaagtggac aacgccctgcagtctggcaactcccaagaaagcgtgaccgagcaggactccaaggactctacatac agcctgtcctccaccctgaccctgtccaaggccgattacgagaagcacaaggtctacgcttgtgaag tgacccaccagggactgtcctcccctgtgaccaagtctttcaatcggggcgagtgcgaatcgaagta cggacctccaggtccacctggaccagaggtgcagctggtggaatccggcggaggcctggtccag cctggcggctctctgcggctgtcctgcgccgcttctggcagaaccttcgtgacctacggcatgggct ggttccggcaggctcctggcaagggcagagagttcgtgtccgccatctcctggtccggctccatgac ctcttacggcgactctgtgaagggcagattcaccatcagccgggataacgccaagaacacactgtac ctgcagatgaactccctgcggcctgaggacaccgccgtgtactactgcgccgctgccctgggcgct gtcgtgtacaccaccagagaaccctatacctactggggacagggcaccctggtgaccgtgtcctct Linkers 72 Amino acid EPKSSDKTHTSPPSP sequence of E- linker 73 Amino acid EPKSSDKGHGGPPGP sequence of Ea- linker 74 Amino acid ERKSSVESPPSP sequence of E2- 1 inker 75 Amino acid ERKSGVEGPPGP sequence of E2a-linker 76 Amino acid ESKYGPPSPPSP sequence of E4- linker 77 Amino acid ESKYGPPGPPGP sequence of E4a-linker 78 Amino acid GGGGSGGGGSGGGGS sequence of G15-linker 79 Amino acid GGGGSGGGGSGS sequence of G12-linker 80 Ammo acid GGGGSGGGS sequence of G9- linker 81 DNA sequence gaacctaagtctagcgacaaaactcataccagcccccctagtcca of E-linker 82 DNA sequence gaacctaagtctagcgacaaaggccatggaggtccccctggacca of Ea-linker 83 DNA sequence gaaaggaagtctagegtggaatctecacctagtcca of E2-linker 84 DNA sequence gaaaggaagtctggagtggaaggtccacctggacca of E2a-linker 85 DNA sequence gaatcgaagtacggacctccatctccacctagtcca of E4-linker 86 DNA sequence gaatcgaagtacggacctccaggtccacctggacca of E4a-linker 87 DNA sequence ggtggaggcggtagtggaggcggtggttcaggcggaggcggatct of G15-linker 88 DNA sequence ggtggaggeggtagtggaggeggtggttcaggatct of G12-linker 89 DNA sequence ggtggaggcggtagtggaggcggttca of G9-linker 90 Exemplary (GGGGS).sub.n, n is between 1 and 8. linker 91 Exemplary (GGGGS).sub.6 linker 92 Exemplary (GSTSGSGKPGSGEGS).sub.n, n is between 1 and 3. linker 93 Exemplary (G).sub.n linker 94 Exemplary (GS).sub.n linker 95 Exemplary (GSGGS) linker 96 Exemplary (GGGS).sub.n linker Fc fragment sequence 97 Amino acid ESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVV sequence of VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSV modified human LTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQV IgG4 Fc YTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY (IgG4PE) KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHN HYTQKSLSLSLGK 98 DNA sequence gagagcaagtacggaccaccttgcccaccatgtccagctcctgagtttgagggaggaccatccgtgt of modified tcctgtttcctccaaagcctaaggacaccctgatgatcagccggacacctgaggtgacctgcgtggt human IgG4 Fc ggtggacgtgtctcaggaggatccagaggtgcagttcaactggtacgtggatggcgtggaggtgca (IgG4PE) caatgctaagaccaagccaagagaggagcagtttaattccacataccgcgtggtgagcgtgctgac cgtgctgcatcaggattggctgaacggcaaggagtataagtgcaaggtgtccaataagggcctgcc cagctctatcgagaagacaatcagcaaggctaagggacagcctagggagccacaggtgtacaccct gcccccttctcaggaggagatgacaaagaaccaggtgtccctgacctgtctggtgaagggcttcta tccaagcgacatcgctgtggagtgggagtctaatggccagcccgagaacaattacaagaccacacc acccgtgctggactctgatggctccttctttctgtattctaggctgacagtggataagtcccggtg gcaggagggcaacgtgtttagctgctctgtgatgcacgaggccctgcacaatcattatacccagaa gtccctgagectgtctctgggcaag CLDN18.2 99 Human MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAV CLDN18.2 FNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVRALMIVG IVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCA IAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGA ALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASG HSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKH DYV