Epcam antibody and Epcam-CAR-T cells

Abstract

The present invention is directed to a humanized monoclonal anti-human EpCAM antibody, such as a single-chain variable fragment (scFv), comprising V.sub.H having the amino acid of SEQ ID NO: 2 and V.sub.L having the amino acid of SEQ ID NO: 4. The present invention is also directed to a chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) of the present invention, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.

Claims

1. A humanized anti-human EpCAM antibody comprising V.sub.H having the amino acid of SEQ ID NO: 2 and V.sub.L having the amino acid of SEQ ID NO: 4.

2. A single-chain variable fragment (scFv) of a humanized anti-human EpCAM antibody comprising VH having the amino acid of SEQ ID NO: 2 and VL having the amino acid of SEQ ID NO: 4.

3. The scFv of claim 2, further comprises a linker in between V.sub.H and V.sub.L.

4. The scFv of claim 2, which has the amino acid sequence of SEQ ID NO: 5.

5. A chimeric antigen receptor fusion protein (CAR) comprising from N-terminus to C-terminus; (i) The scFv of claim 2, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.

6. The CAR according to claim 5, wherein the co-stimulatory domain is CD28 or 4-1BB.

7. The CAR according to claim 5, wherein the activation domain is CD3 zeta.

8. The CAR of claim 5, which has the amino acid sequence of SEQ ID NO: 16 or 19.

9. A nucleic acid encoding the CAR of claim 5.

10. T cells or natural killer cells modified to express the CAR of claim 5.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 illustrates the structures of CAR. The left panel shows the structure of the first generation of CAR (no costimulatory domains). The middle panel shows the structure of the second generation of CAR (one co-stimulation domain). The right panel shows the third generation of CAR (two or several co-stimulation domains) [3].

(2) FIG. 2 shows the structure of EpCAM CAR construct. The second generation CAR is used.

(3) FIG. 3 shows that 25.4% of humanized EpCAM-CAR-T cells (CD28 co-stimulating, Example 2, PMC 306) were positive against anti-human F(ab).sub.2, and 23% of humanized EpCAM-CAR-T cells were positive against anti-mouse F(ab).sub.2.

(4) FIG. 4 shows that 35.2% of humanized EpCAM-CAR-T cells (4-1BB co-stimulating, Example 3, PMC 710) were positive against anti-mouse F(ab).sub.2.

(5) FIG. 5 shows that mouse EpCAM-CAR-T cells had a low expression of EpCAM, and only 2.23% of mouse EpCAM-CAR-T cells were detected by anti-mouse F(ab).sub.2.

(6) FIG. 6A demonstrates high cytotoxic activity of humanized EpCAM-CAR cells against colorectal cancer (HT29 cells).

(7) FIG. 6B demonstrates cytotoxic activity of humanized EpCAM-CAR cells against colon cancer (Lovo cells).

(8) FIG. 6C demonstrates high cytotoxic activity of humanized EpCAM-CAR cells against ovarian cancer (OVCAR-3 cells).

(9) FIG. 6D demonstrates cytotoxic activity of humanized EpCAM-CAR cells against cervical cancer (Hela cells).

(10) FIG. 6E demonstrates cytotoxic activity of humanized EpCAM-CAR cells against breast cancer (SKBR-3 cells).

(11) FIG. 7 compares the cytotoxicity of humanized EpCAM-CAR-T cells (PMC376) and mouse EpCAM-CAR-T cells in Lovo target cells.

(12) FIG. 8 shows that humanized EpCAM-CAR (PMC376) secreted high level of IFN-gamma against HT29, Lovo-1, OVCAR-3, and SKBR3 cells. Three independent experiments were done.

(13) FIGS. 9A-9B show that humanized EpCAM-CAR-T cells (PMC376) significantly decreased Lovo-1 tumor volume (9A) and tumor weight (9B). p<0.05: EpCAM-CAR-T cells (fresh and frozen) versus PBS and T cells in both FIGS. 9A and 9B.

(14) FIG. 10 shows mice treated by humanized EpCAM-CAR-T cells did not decrease body weight.

DETAILED DESCRIPTION OF THE INVENTION

Definitions

(15) As used herein, a chimeric antigen receptor (CAR) is a receptor protein that has been engineered to give T cells the new ability to target a specific protein. The receptor is chimeric because they combine both antigen-binding and T-cell activating functions into a single receptor. CAR is a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain, and at least one intracellular domain. The chimeric antigen receptor (CAR) is sometimes called a chimeric receptor, a T-body, or a chimeric immune receptor (CIR). The extracellular domain capable of binding to an antigen means any oligopeptide or polypeptide that can bind to a certain antigen. The intracellular domain means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.

(16) As used herein, CDRs are complementary-determining Regions of VH or VL chains of antibody which are critical for binding with antigen.

(17) As used herein, a domain means one region in a polypeptide which is folded into a particular structure independently of other regions.

(18) As used herein, humanized antibodies are antibodies derived from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans. For example, after a mouse antibody is developed, the DNA coding for that antibody can be sequenced. The DNA sequence corresponding to the antibody CDRs can then be determined. The CDR sequences can be inserted into a construct containing the DNA for a human antibody variant to prepare humanized antibodies.

(19) As used herein, a single chain variable fragment (scFv) means a single chain polypeptide derived from an antibody which retains the ability to bind to an antigen. An example of the scFv includes an antibody polypeptide which is formed by a recombinant DNA technique and in which Fv regions of immunoglobulin heavy chain (H chain) and light chain (L chain) fragments are linked via a spacer sequence. Various methods for engineering an scFv are known to a person skilled in the art.

(20) As used herein, a tumor antigen means a biological molecule having antigenecity, expression of which causes cancer.

(21) The inventors have engineered humanized EpCAM scFv starting from heavy and light chain variable regions of mouse monoclonal antibody derived from hybridoma cell line AUA1 Ab [4, 5]. The inventors have produced EpCAM-CAR-T cells based on humanized EpCAM antibody to target cancer cells overexpressing EpCAM tumor antigen. The EpCAM-CAR-T cells of the present invention have high cytotoxic activity against several cancer cell lines

(22) The present invention is directed to a humanized anti-human EpCAM antibody comprising V.sub.H having the amino acid of SEQ ID NO: 2 and V.sub.L having the amino acid of SEQ ID NO: 4.

(23) In one embodiment, the humanized anti-human EpCAM antibody is a single-chain variable fragment (scFv). ScFv can be V.sub.H-linker-V.sub.L or V.sub.L-linker-V.sub.H.

(24) The present invention is also directed to a chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) against EpCAM in which V.sub.H has the amino acid sequence of SEQ ID NO:2, and V.sub.L has the amino acid of SEQ ID NO: 4, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain.

(25) In one embodiment, the CAR structure is shown in FIG. 2.

(26) In one embodiment, the co-stimulatory domain is selected from the group consisting of CD28, 4-1BB, GITR, ICOS-1, CD27, OX-40 and DAP10. A preferred the co-stimulatory domain is CD28 or 4-1BB.

(27) A preferred activating domain is CD3 zeta (CD3 Z or CD3).

(28) The transmembrane domain may be derived from a natural polypeptide, or it may be artificially designed. The transmembrane domain derived from a natural polypeptide can be obtained from any membrane-binding or transmembrane protein. For example, a transmembrane domain of a T cell receptor or chain, a CD3 zeta chain, CD28, CD3., CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, ICOS, CD154, or a GITR can be used. The artificially designed transmembrane domain is a polypeptide mainly comprising hydrophobic residues such as leucine and valine. It is preferable that a triplet of phenylalanine, tryptophan and valine is found at each end of the synthetic transmembrane domain. Optionally, a short oligopeptide linker or a polypeptide linker, for example, a linker having a length of 2 to 10 amino acids can be arranged between the transmembrane domain and the intracellular domain. In one embodiment, a linker sequence having a glycine-serine continuous sequence can be used.

(29) The present invention provides a nucleic acid encoding the EpCAM-CAR. The nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by a conventional method. A base sequence encoding an amino acid sequence can be obtained from the aforementioned NCBI RefSeq IDs or accession numbers of GenBank for an amino acid sequence of each domain, and the nucleic acid of the present invention can be prepared using a standard molecular biological and/or chemical procedure. For example, based on the base sequence, a nucleic acid can be synthesized, and the nucleic acid of the present invention can be prepared by combining DNA fragments which are obtained from a cDNA library using a polymerase chain reaction (PCR).

(30) A nucleic acid encoding the CAR of the present invention can be inserted into a vector, and the vector can be introduced into a cell. For example, a virus vector such as a retrovirus vector (including an oncoretrovirus vector, a lentivirus vector, and a pseudo type vector), an adenovirus vector, an adeno-associated virus (AAV) vector, a simian virus vector, a vaccinia virus vector or a sendai virus vector, an Epstein-Barr virus (EBV) vector, and a HSV vector can be used. A virus vector lacking the replicating ability so as not to self-replicate in an infected cell is preferably used.

(31) For example, when a retrovirus vector is used, a suitable packaging cell based on a LTR sequence and a packaging signal sequence possessed by the vector can be selected for preparing a retrovirus particle using the packaging cell. Examples of the packaging cell include PG13 (ATCC CRL-10686), PA317 (ATCC CRL-9078), GP+E-86 and GP+envAm-12, and Psi-Crip. A retrovirus particle can also be prepared using a 293 cell or a 293T cell having high transfection efficiency. Many kinds of retrovirus vectors produced based on retroviruses and packaging cells that can be used for packaging of the retrovirus vectors are widely commercially available from many companies.

(32) A CAR-T cell binds to a specific antigen via the CAR, thereby a signal is transmitted into the cell, and as a result, the cell is activated. The activation of the cell expressing the CAR is varied depending on the kind of a host cell and an intracellular domain of the CAR, and can be confirmed based on, for example, release of a cytokine, improvement of a cell proliferation rate, change in a cell surface molecule, or the like as an index. For example, release of a cytotoxic cytokine (a tumor necrosis factor, lymphotoxin, etc.) from the activated cell causes destruction of a target cell expressing an antigen. In addition, release of a cytokine or change in a cell surface molecule stimulates other immune cells, for example, a B cell, a dendritic cell, a NK cell, and a macrophage.

(33) The cell expressing the CAR can be used as a therapeutic agent for a disease. The therapeutic agent comprises the cell expressing the CAR as an active ingredient, and it may further comprise a suitable excipient.

(34) The inventors have generated a humanized anti-human EpCAM antibody and characterized it. The present humanized anti-human EpCAM antibody exhibits selective and high-affinity binding to human EpCAM, and it is used to construct a single-chain variable fragment (scFv). The inventors insert the EpCAM scFv into a second-generation CAR to generate CAR-T cells. EpCAM-CAR-T cells express higher cytotoxic activity against EpCAM-positive cancer cells than against non-transduced T cells and Mock-CAR-T cells.

(35) The humanized EpCAM-CAR-T cells of the present invention secret high levels of IFN-gamm against EpCAM-positive cancer cells; they are positive by cytotoxicity assay against target cancer cells with EpCAM overexpression. The inventors demonstrate that humanized EpCAM-CAR-T cells significantly decreased colon tumor growth in a mouse xenograft model, which indicates EpCAM-CAR-T cells can treat patients with EpCAM positive tumors.

(36) The advantages of the humanized EpCAM monoclonal antibody or EpCAM-ScFv of the present invention over mouse EpCAM ScFv (AUA1 antibody) include less immunogenicity to human due to humanized EpCAM scFv. The humanized EpCAM scFv are more cytotoxic against cancer cells than CAR-T cells with mouse ScFv. The EpCAM humanized antibody is highly potent as a therapeutic agent for CAR-T and other uses in many clinical applications.

(37) The present humanized EpCAM ScFv can be used for immunotherapy applications: toxin/drug-conjugated antibody, monoclonal therapeutic antibody, and CAR-T cell immunotherapy.

(38) Humanized EpCAM-CAR-T cells using the present humanized EpCAM ScFv effectively target EpCAM antigen in EpCAM-positive cancer cell lines such as ovarian, colon, pancreatic, melanoma, cervical cancer, and other EpCAM-positive cancers.

(39) Humanized EpCAM-CAR-T cells can be used in combination with different chemotherapy: checkpoint inhibitors, targeted therapies, small molecule inhibitors, and antibodies.

(40) Humanized EpCAM-CAR-T cells can be used clinically for EpCAM-positive cancer cells.

(41) Modifications of co-activation domains such as CD28, 4-1BB and others can be used to increase the efficacy of CAR-T cells. Tag-conjugated humanized EpCAM scFv can be used for CAR generation.

(42) Humanized EpCAM-CAR-T cells can be used with different safety switches such as t-EGFR, RQR (Rituximab-CD34-Rituximab), inducible caspase-9 and other.

(43) Third generation CAR-T or other co-activation signaling domains can be used with humanized EpCAM-scFv to prepare EpCAM-CAR-T.

(44) The humanized EpCAM CAR can be combined with CARs targeting other tumor antigens or tumor microenvironment, e.g., VEGFR-1-3, PDL-1. Bi-specific antibodies with EpCAM and CD3, or other antigens can be generated for therapy.

(45) The humanized EpCAM-CAR can be used for generating other types of cells such as CAR-natural killer (NK) cells, EpCAM-CAR-macrophages, and EpCAM-CAR hematopoietic cells, which can target EpCAM-positive cancers.

(46) The present invention provides T cells, NK cells, macrophages, or hematopoietic cells, modified to express the EpCAM-CAR.

(47) EpCAM-CAR-T cells can be used against cancer stem cells and circulating tumor stem cells that are most resistant against chemotherapy and form aggressive tumors.

(48) EpCAM-NK cells EpCAM-macrophages can be used for targeting different types of cancer

(49) EpCAM-CAR-T cells can be delivered intra-tumorally to patients for increased safety.

(50) The following examples further illustrate the present invention. These examples are intended merely to be illustrative of the present invention and are not to be construed as being limiting.

EXAMPLES

Example 1

Humanized EpCAM VII, VL and scFv Sequences

(51) EpCAM scFv was derived from mouse hybridoma clones (AUA1 [4, 5]). The sequences of heavy and light chain variable regions of mouse clone AUA1 were determined and were used to construct a humanized scFv. The humanization was done as described in Golubovskaya et al (3). The structure of EpCAM scFv is: VH-linker-VL.

(52) The bold highlights the nucleotide sequence of V.sub.H; the underlined highlights the PGP-21,DNA,M nucleotide sequence of V.sub.L; in between (italicized) is the nucleotide sequence encoding a linker.

(53) TABLE-US-00001 (SEQIDNO:1) caggtgcagctggtgcagagcggcagcgaactgaaaaaaccgggcgcgag cgtgaaagtgagctgcaaagcgagcggctatacctttaccaactatggca tgaactgggtgcgccaggcgccgggccagggcctggaatggatgggctgg attaacacctataccggcgaaccgacctatgcggatgattttaaaggccg ctttgtgtttagcctggataccagcgtgagcaccgcgtatctgcagatta gcagcctgaaagcggaagataccgcggtgtattattgcgcgcgctggctg cgcgattttgattattggggcgcgggcaccaccgtgaccgtgagcagc GGTGGCGGAGGTTCTGGAGGCGGTGGTTCAGGTGGC GGTGGTTCC gaaattgtgctgacccagagcccggcgaccctgagcctgagcccgggcga acgcgcgaccctgagctgcagcgcgagcagcagcattagctatatgcatt ggtatcagcagaaaccgggccaggcgccgcgcctgctgatttatgatacc agcaaactggcgaccggcattccggcgcgctttagcggcagcggcagcgg caccgattttaccctgaccattagcagcctggaaccggaagattttgcgg tgtattattgccatcagcgcagcagctatccgtatacattggcggcggca ccaaactggaaattaaa V.sub.Haminoacidsequence (SEQIDNO:2) QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGW INTYTGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARWL RDFDYWGAGTTVTVSS Linkeraminoacidsequence (SEQIDNO:3) GGGGSGGGGSGGGGS V.sub.Laminoacidsequence (SEQIDNO:4) EIVLTQSPATLSLSPGERATLSCSASSSISYMHWYQQKPGQAPRLLIYDT SKLATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQRSSYPYTFGGG TKLEIK HumanizedEpCAMscFvProtein (SEQIDNO:5) QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGW INTYTGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARWL RDFDYWGAGTTVTVSSGGGGSGGGGS

Example 2

Humanized EpCAM-CAR Sequences with CD28 as a Co-Stimulating Domain

(54) The scheme of EpCAM-CAR construct is shown on FIG. 3.

(55) The following nucleotide sequence shows EpCAM ScFv-CD8 hinge-TM28-CD28-CD3 zeta of the present invention. The structure includes Human CD8 signaling peptide, EpCAM scFv (V.sub.H-Linker-V.sub.L), CD8 hinge, CD28 transmembrane domain, CD28 co-stimulating domain CD3 zeta activation domain (FIG. 2).

(56) EpCAM scFv (V.sub.H-Linker-V.sub.L)-CD8 Hinge-CD28 TM-CD28-CD3-Zeta:

(57) TABLE-US-00002 <CD8leader> Nucleotide (SEQIDNO:6) ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCA CGCCGCCAGGCCG AminoAcid (SEQIDNO:7) MALPVTALLLPLALLLHAARP
<Nhe I Restriction Site>

(58) TABLE-US-00003 GCTAGC<AS>
<EpCAM scFV>

(59) VH-linker-VL, see Example 1 for nucleic acid sequences and amino acid sequences.

(60) <Xho I Restriction Site>

(61) TABLE-US-00004 CTCGAG<LE> <aagccc><KP>
<CD8 Hinge>

(62) TABLE-US-00005 Nucleotide (SEQIDNO:8) ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTC GCAGCCCCTGTCCCTGCGCCCAGAGGCGAGCCGGCCAGCGGCGGGGGGCG CAGTGCACACGAGGGGGCTGGACTTCGCCAGTGAT AminoAcid (SEQIDNO:9) TTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVHTRGLDFASD
<CD28 Transmembrane >

(63) TABLE-US-00006 Nucleotide (SEQIDNO:10) TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCT AGTAACAGTGGCCTTTATTATTTTCTGGGTG AminoAcid (SEQIDNO:11) FWVLVVVGGVLACYSLLVTVAFIIFWV
<CD28 Co-Stimulatory>

(64) TABLE-US-00007 Nucleotide (SEQIDNO:12) AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCC CCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCAC GCGACTTCGCAGCCTATCGCTCC Aminoacid (SEQIDNO:13) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
<CD3 Zeta>

(65) TABLE-US-00008 Nucleotide (SEQIDNO:14) AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCA GAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATG TTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAG AGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAA GATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGG GCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGAC ACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA Aminoacid (SEQIDNO:15) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQ RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKD TYDALHMQALPPR
<EcoRI Restriction Site>
Gaattc

(66) Translated amino-acid sequence of EpCAM-CAR protein (PMC376, SEQ ID NO: 16) is shown below V.sub.H in bold, linker in italics, V.sub.L is underlined.

(67) TABLE-US-00009 MALPVTALLLPLALLLHAARPASQVQLVQSGSELKKPGASVKVSCKASGY TFTNYGMNWVRQAPGQGLEWMGWINTYTGEPTYADDFKGRFVFSLDTSVS TAYLQISSLKAEDTAVYYCARWLRDFDYWGAGTTVTVSSGGGGSGGGGSG GGGSEIVLTQSPATLSLSPGERATLSCSASSSISYMHWYQQKPGQAPRLL IYDTSKLATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQRSSYPYT FGGGTKLEIKLEKPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVH TRGLDFASDKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDY MNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEA YSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Example 3

Humanized EpCAM-CAR Sequences with 4-1BB as a Co-Stimulating Domain

(68) In this example, the humanized EpCAM-CAR sequences are identical to those described in Example 2, except 4-1BB was used as a costimulatory domain instead of CD28.

(69) <41BB Costimulatory Domain>

(70) TABLE-US-00010 Nucleotide (SEQIDNO:17) Aaacggggcagaaagaaactcctgtatatattcaaacaaccatttatgag accagtacaaactactcaagaggaagatggctgtagctgccgatttccag aagaagaagaaggaggatgtgaactg Aminoacid (SEQIDNO:18) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CARAminoAcidSequence (PMC710,SEQIDNO:19) MALPVTALLLPLALLLHAARPASQVQLVQSGSELKKPGASVKVSCKASGY TFTNYGMNWVRQAPGQGLEWMGWINTYTGEPTYADDFKGRFVFSLDTSVS TAYLQISSLKAEDTAVYYCARWLRDFDYWGAGTTVTVSSGGGGSGGGGSG GGGSEIVLTQSPATLSLSPGERATLSCSASSSISYMHWYQQKPGQAPRLL IYDTSKLATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQRSSYPYT FGGGTKLEIKLEKPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVH TRGLDFASDKPFWVLVVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFK QPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQL YNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Example 4

CAR Lentivirus Production

(71) The inventors generated humanized EpCAM-ScFv-CAR constructs and cloned them inside lentiviral vectors either with promoter EF1 and CD28 costimulatory domain for PMC376 or with MNDU3 promoter and 41BB costimulatory domain for PMC710.

(72) Lentiviruses were generated in 293T cells by the standard procedure as described in [6]; the titers were established by real time PCR.

Example 5

Peripheral Blood Mononuclear Cell (PBMC) Isolation from Whole Blood

(73) Whole blood (Stanford Hospital Blood Center, Stanford, CA) was collected from individual or mixed donors (depending on the amount of blood required) in 10 mL Heparin vacutainers (Becton Dickinson). Approximately 10 ml of whole anti-coagulated blood was mixed with sterile phosphate buffered saline (PBS) buffer for a total volume of 20 ml in a 50 ml centrifuge tube (PBS, pH 7.4, without Ca.sup.+2 and Mg.sup.+2). The blood/PBS (20 ml) was layered on top of 15 mL of Ficoll-Paque PLUS (GE Healthcare) in a conical centrifuge tube gently, and the sample was centrifuged at 400g for 30-40 min at room temperature. The layer of cells containing peripheral blood mononuclear cells (PBMC) at the diluted plasma/Ficoll interface was removed, washed, and centrifuged at 200g for 10 min at room temperature. Cells were counted with a hemocytomter. The PBMC were washed once with CAR-T media (AIM V-AlbuMAX(BSA) (Life Technologies), with 5% AB serum and 1.25 g/mL amphotericin B (Gemini Bioproducts, Woodland, CA), 100 U/mL penicillin, and 100 g/mL streptomycin) and used for experiments or were frozen at 80 C.

Example 6

T-Cell Activation from PBMC

(74) The isolated PBMC cells are resuspended in CAR-T medium with 300 U/mL huIL2 (from a 1000 stock; Invitrogen) and mixed with CD3-CD28 beads at a 1:1 bead-to-cell ratio. The cells are incubated at 37 C. in the presence of CO.sub.2 for 24 hours before viral transduction.

Example 7

T-Cell Transduction and Expansion

(75) Following activation of PBMC, cells were incubated for 24 hours at 37 C., 5% CO.sub.2. To each well of 110.sup.6 cells, 510.sup.6 lentivirus and 2 L/mL of media of Transplus (Alstem, Richmond, CA) (a final dilution of 1:500) were added. Cells were incubated for an additional 24 hours before repeating the addition of virus. Cells were then grown in the continued presence of 300 U/ML of IL-2 fresh medium with IL-2 for a period of 12-14 days (total incubation time was dependent on the final umber of CAR-T cells required). Cells concentrations were analyzed every 2-3 days, with media being added at that time to dilute the cell suspension to 110.sup.6 cells/mL.

Example 8

Transduction Verification by FACS Staining

(76) Cells were washed and suspended in FACS buffer (phosphate-buffered saline (PBS) plus 0.1% sodium azide and 0.4% BSA), and then divided to 110.sup.6 aliquots.

(77) Fc receptors were blocked with normal goat IgG (LifeTechnologies). 1.0 ml FACS buffer was added to each tube, mixed well and spun down at 300 g for 5 min.

(78) Biotin-labeled polyclonal goat anti-mouse F(ab).sub.2 antibody or anti-human F(ab).sub.2 antibody (Life Technologies) was to detect EpCAM scFv; biotin-labeled normal polyclonal goat IgG antibodies (Life Technologies) was added to serve as an isotype control.

(79) Cells were suspended in FACS buffer and blocked with normal mouse IgG (Invitrogen) by adding 100 l 1:1000 diluted normal mouse IgG to each tube, and incubated on ice for 10 min. Cells were washed and re-suspended in 100 l FACS buffer, and then stained with phycoerythrin (PE)-labeled streptavidin (BD Pharmingen, San Diego, CA) and allophycocyanin (APC)-labeled CD3 (eBiocience, San Diego, CA). Flow cytometry acquisition was performed with a BD FacsCalibur (BD Biosciences), and analysis was performed with FlowJo (Treestar, Inc. Ashland, OR).

(80) FIG. 3 shows that transduced T cells with humanized EpCAM-CAR lentivirus (humanized EpCAM-CAR-T cells) had a detectable level of humanized anti-EpCAM scFv, which were detected by anti-mouse F(ab).sub.2 antibody or anti-human F(ab).sub.2 antibody (Jackson Immunoresearch; 109-066-097) [1:50]. 23% of humanized EpCAM-CAR-T cells (CD28 co-stimulating, Example 2, PMC 376 were positive against anti-mouse F(ab).sub.2, and 25.4% were positive against anti-human F(ab).sub.2.

(81) FIG. 4 shows that 35.2% of humanized EpCAM-CAR-T cells (4-1BB co-stimulating, Example 3 PMC 710) were positive against anti-mouse Fab.

(82) Mouse EpCAM-CAR-T cells were prepared according to Examples 2, and 4-7, except that mouse scFv sequences were generated from AUA1 mouse antibody. FIG. 5 shows that mouse EpCAM-CAR-T cells had a low expression of EpCAM, and only 2.23% of mouse EpCAM-CAR-T cells were detected by anti-mouse F(ab).sub.2.

Example 9

Cytotoxicity Assay of Humanized EpCAM-CAR-T Cells

(83) The real-time cytotoxicity was performed using ACEA machine according to manufacturer's protocol. The cytotoxic activity of EpCAM-CAR-T cells (Example 2, CD28 cos-stimulating domain, PMC376) was tested against EpCAM-positive cancer cells of HT29 (colorectal adenocarcinoma, FIG. 6A), Lovo (colon cancer, FIG. 6B), OVCAR-3 (ovarian cancer, FIG. 6C), Hela (cervical cancer, FIG. 6D), and SKBR-3 (breast cancer, FIG. 6E).

(84) The real-time cytotoxicity assay demonstrates high cytotoxic activity of EpCAM-CAR cells against colorectal cancer, colon cancer, and ovarian cancer (FIGS. 6A-6C). The cytotoxicities with EpCAM-CAR-T cells were lower in cervical and breast cancer cell line (FIG. 6D-6E). Hela and SKBR3 cells were reported to express less EpCAM.

(85) The cytotoxic activity of EpCAM-CAR cells (Example 3, 4-1BB co-stimulating domain, PMC710) was also tested against Lovo cells (colon cancer). The results were similar to that of PMC376 in Lovo cells (data not shown).

Example 10

Cytotoxicity Assay (Comparison)

(86) The cytotoxicity of humanized EpCAM-CAR-T cells (PMC376) and mouse EpCAM-CAR-T cells were compared in Lovo target cells. The results are shown in FIG. 7. Due to low expression of mouse EpCAM CAR in CAR-T cells, mouse-CAR-T cells did not show cytotoxicity against Lovo cells, whereas humanized EpCAM-CAR-T cells had high cytotoxicity against Lovo cells.

Example 11

EpCAM-CAR Secreted High Level of IFN-Gamma Against EpCAM Positive Cancer Cells

(87) We collected supernatant of EpCAM-CAR-T incubated with cancer cells in RTCA assay and performed ELISA with kit from Fisher according to manufacturer's protocol. Humanized EpCAM-CAR-T (PMC376) secreted high level of IFN-gamma against tested target cancer cells (FIG. 8). Humanized EpCAM-CAR-T (PMC710) also secreted high level of IFN-gamma against Lovo target cancer cells (data not shown).

Example 12

EpCAM-CAR-T Cells Significantly Decreased LOVO-1 Colon Cancer Xenograft Tumor Growth

(88) We injected Lovo-1 (colon) cancer cells subcutaneously, and next day we injected humanized EpCAM-CAR-T cells fresh or frozen intravenously. A second injection of CAR-T cells was made intravenously in a week after. Humanized EpCAM CAR-T cells completely blocked Lovo-1 tumor growth; no tumors were detected at the end of experiment (FIGS. 9A and 9B).

(89) Mice from Ep-CAM-CAR-T cell-treated group did not decrease weight (FIG. 10). Thus, humanized CAR-T cells are safe and can be used as a therapeutic agent against solid tumors.

REFERENCES

(90) 1. Maus, M. V., Haas, A. R., Beatty, G. L., Albelda, S. M., Levine, B. L., Liu, X., Zhao, Y., Kalos, M., and June, C. H. (2013). T cells expressing chimeric antigen receptors can cause anaphylaxis in humans. Cancer Immunol Res 1, 26-31. 2. Maus, M. V., Grupp, S. A., Porter, D. L., and June, C. H. (2014). Antibody-modified T cells: CARs take the front seat for hematologic malignancies. Blood 123, 2625-2635. 3. Golubovskaya, Wu. Different Subsets of T Cells, Memory, Effector Functions, and CAR-T Immunotherapy. Cancers (Basel). 2016; 8(3). pii: E36. doi: 10.3390/cancers8030036 4. Epenetos, A., et al, (1982). Lancet, 2: 1004-1006 5. Durbin, G et al., Further Characterization, Isolation and Identification of the Epithelial Cell-Surface Antigen Defined by Monoclonal Antibody AUA1. Int. J. Cancer: 45, 562-565 (1990) 6. Berahovich R, Xu S, Zhou H, Harto H, Xu Q, Garcia A, Liu F, Golubovskaya V M, Wu L. FLAG-tagged CD19-specific CAR-T cells eliminate CD19-bearing solid tumor cells in vitro and in vivo. Front Biosci (Landmark Ed). 2017 Jun. 1; 22: 1644-1654